F456891

General Info

Members Datasets Scaffolds Average Seq Length
508 270 1016 145

Family's Representative Sequence

Representative Sequence 3300053129|Ga0500628_004623|Ga0500628_004623_76_558
Length 160
Sequence MRRTGNSLRGILPQMAEDQAAKVEGHDGLMWIRGSGVCRDWNGIRYKLGMSGKNVGARQLSMNVATIPPGGVAGAHIHVDFEVMLYILEGRVRHEYGEGLVERVDHAAGDFIFIAPGVPHEVFNLSDTEPVVAVVARSSADEWDKIIPYARPAARDTARD

Samples

Sample ID Description Type Environment
1 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
182 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
183 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
196 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
197 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
198 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
199 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
200 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
201 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
202 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
203 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
256 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.71
Nodule 0
Rhizoplane 2.56
Rhizosphere 91.54
Stem 0
Stem Tuber 0
Unclassified 13.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500628_004623 3300053129 Bacteria 2282
2 Ga0065704_10245787 3300005289 Bacteria 1003
3 Ga0065712_10071861 3300005290 Bacteria 5023
4 Ga0065712_10110360 3300005290 Bacteria 1838
5 Ga0065715_10037565 3300005293 Bacteria 1682
6 Ga0065715_10089740 3300005293 Bacteria 8655
7 Ga0065715_10818632 3300005293 Bacteria 603
8 Ga0065707_10003305 3300005295 Bacteria 4491
9 Ga0070683_100014741 3300005329 Bacteria 6847
10 Ga0070690_100046593 3300005330 Bacteria 2756
11 Ga0070690_100774547 3300005330 Bacteria 742
12 Ga0070690_101646500 3300005330 Bacteria 521
13 Ga0070670_100007063 3300005331 Bacteria 9513
14 Ga0070670_100354527 3300005331 Bacteria 1289
15 Ga0070670_100357317 3300005331 Bacteria 1284
16 Ga0068869_100274323 3300005334 Bacteria 1354
17 Ga0068869_100375144 3300005334 Bacteria 1165
18 Ga0068869_100575723 3300005334 Bacteria 949
19 Ga0070666_10002956 3300005335 Bacteria 10298
20 Ga0070666_10011390 3300005335 Bacteria 5578
21 Ga0070660_100482419 3300005339 Bacteria 1030
22 Ga0070689_100000097 3300005340 Bacteria 50763
23 Ga0070689_100003844 3300005340 Bacteria 10065
24 Ga0070689_100157592 3300005340 Bacteria 1833
25 Ga0070687_100002498 3300005343 Bacteria 6926
26 Ga0070687_100066589 3300005343 Bacteria 1919
27 Ga0070687_100249509 3300005343 Bacteria 1102
28 Ga0070661_100606959 3300005344 Unclassified 885
29 Ga0070692_10488278 3300005345 Unclassified 796
30 Ga0070668_100134731 3300005347 Bacteria 1985
31 Ga0070668_100324948 3300005347 Bacteria 1296
32 Ga0070669_100023255 3300005353 Bacteria 4438
33 Ga0070669_100130342 3300005353 Bacteria 1928
34 Ga0070671_100104068 3300005355 Bacteria 2382
35 Ga0070674_100402550 3300005356 Bacteria 1119
36 Ga0070674_100497508 3300005356 Bacteria 1015
37 Ga0070673_100005667 3300005364 Bacteria 8024
38 Ga0070688_100000202 3300005365 Bacteria 31661
39 Ga0070688_100000234 3300005365 Bacteria 29106
40 Ga0070659_100072094 3300005366 Bacteria 2748
41 Ga0070659_100365027 3300005366 Bacteria 1214
42 Ga0070713_100012809 3300005436 Bacteria 6166
43 Ga0070701_10028259 3300005438 Bacteria 2756
44 Ga0070701_10064113 3300005438 Bacteria 1946
45 Ga0070701_10809756 3300005438 Bacteria 640
46 Ga0070705_100096016 3300005440 Bacteria 1860
47 Ga0070700_100051412 3300005441 Unclassified 2565
48 Ga0070700_100066979 3300005441 Bacteria 2280
49 Ga0070700_100207755 3300005441 Bacteria 1379
50 Ga0070700_100349589 3300005441 Unclassified 1095
51 Ga0070694_100001176 3300005444 Bacteria 15022
52 Ga0070694_100022646 3300005444 Bacteria 4029
53 Ga0070694_100133822 3300005444 Unclassified 1794
54 Ga0070694_100191304 3300005444 Bacteria 1520
55 Ga0070708_100355550 3300005445 Bacteria 1380
56 Ga0070663_100813577 3300005455 Bacteria 802
57 Ga0070678_100254753 3300005456 Bacteria 1473
58 Ga0070662_100001202 3300005457 Bacteria 15917
59 Ga0070662_100204163 3300005457 Bacteria 1570
60 Ga0070681_10155840 3300005458 Bacteria 2209
61 Ga0068867_100059240 3300005459 Bacteria 2838
62 Ga0068867_100860500 3300005459 Bacteria 813
63 Ga0070685_10000921 3300005466 Bacteria 15836
64 Ga0070685_10004320 3300005466 Bacteria 7172
65 Ga0070685_10789818 3300005466 Bacteria 699
66 Ga0070706_100339733 3300005467 Bacteria 1400
67 Ga0070706_100825328 3300005467 Unclassified 858
68 Ga0070707_100048364 3300005468 Bacteria 4074
69 Ga0070707_100064581 3300005468 Unclassified 3515
70 Ga0070707_100168889 3300005468 Bacteria 2132
71 Ga0070707_100912594 3300005468 Bacteria 843
72 Ga0070698_100015277 3300005471 Bacteria 8118
73 Ga0070698_100235977 3300005471 Bacteria 1762
74 Ga0070698_100269978 3300005471 Bacteria 1633
75 Ga0070698_100619568 3300005471 Bacteria 1023
76 Ga0070699_100001220 3300005518 Bacteria 23718
77 Ga0070699_100023492 3300005518 Bacteria 5311
78 Ga0070699_100065307 3300005518 Bacteria 3158
79 Ga0070699_100087619 3300005518 Bacteria 2718
80 Ga0070699_100342001 3300005518 Bacteria 1347
81 Ga0070699_100744527 3300005518 Bacteria 896
82 Ga0070679_100362053 3300005530 Bacteria 1398
83 Ga0070684_100010134 3300005535 Bacteria 7452
84 Ga0070684_100122782 3300005535 Bacteria 2337
85 Ga0070697_100024005 3300005536 Bacteria 4853
86 Ga0068853_100272565 3300005539 Bacteria 1559
87 Ga0070672_100011917 3300005543 Bacteria 6077
88 Ga0070672_100176327 3300005543 Bacteria 1780
89 Ga0070672_101942207 3300005543 Bacteria 530
90 Ga0070686_100033257 3300005544 Bacteria 3167
91 Ga0070695_100002932 3300005545 Bacteria 9935
92 Ga0070696_100013043 3300005546 Bacteria 5578
93 Ga0070693_100108075 3300005547 Bacteria 1706
94 Ga0070665_101368737 3300005548 Bacteria 717
95 Ga0070704_100008808 3300005549 Bacteria 6071
96 Ga0070704_100386409 3300005549 Bacteria 1191
97 Ga0068855_100268941 3300005563 Bacteria 1896
98 Ga0068855_101033415 3300005563 Bacteria 862
99 Ga0070664_100031954 3300005564 Bacteria 4403
100 Ga0070664_100044625 3300005564 Bacteria 3743
101 Ga0070664_100530653 3300005564 Bacteria 1087
102 Ga0068857_100903610 3300005577 Bacteria 847
103 Ga0068857_101400418 3300005577 Bacteria 680
104 Ga0068854_100011163 3300005578 Bacteria 5835
105 Ga0068854_100136668 3300005578 Bacteria 1877
106 Ga0068856_100302488 3300005614 Bacteria 1617
107 Ga0070702_100424677 3300005615 Bacteria 957
108 Ga0068852_100193548 3300005616 Bacteria 1920
109 Ga0068859_100004484 3300005617 Bacteria 14249
110 Ga0068859_100024031 3300005617 Bacteria 6116
111 Ga0068859_100455627 3300005617 Bacteria 1375
112 Ga0068864_100933654 3300005618 Unclassified 858
113 Ga0068864_101379685 3300005618 Unclassified 706
114 Ga0068864_101950467 3300005618 Unclassified 593
115 Ga0068866_10138751 3300005718 Bacteria 1393
116 Ga0068866_10509658 3300005718 Bacteria 798
117 Ga0068861_100270996 3300005719 Unclassified 1458
118 Ga0068861_100275057 3300005719 Bacteria 1448
119 Ga0068870_10188483 3300005840 Unclassified 1243
120 Ga0068863_100134855 3300005841 Bacteria 2359
121 Ga0068863_100237798 3300005841 Bacteria 1758
122 Ga0068863_100787355 3300005841 Unclassified 948
123 Ga0068860_100027333 3300005843 Bacteria 5496
124 Ga0068862_100112529 3300005844 Bacteria 2391
125 Ga0068862_100384057 3300005844 Bacteria 1310
126 Ga0070717_10073966 3300006028 Bacteria 2849
127 Ga0075365_10011130 3300006038 Bacteria 5278
128 Ga0075365_10048038 3300006038 Bacteria 2808
129 Ga0075365_10059444 3300006038 Bacteria 2548
130 Ga0075364_10047278 3300006051 Bacteria 2802
131 Ga0075364_10083064 3300006051 Bacteria 2120
132 Ga0075364_10156321 3300006051 Bacteria 1538
133 Ga0075362_10001062 3300006177 Bacteria 8490
134 Ga0075367_10206331 3300006178 Bacteria 1228
135 Ga0075369_10186584 3300006186 Unclassified 955
136 Ga0075366_10080144 3300006195 Bacteria 1950
137 Ga0075366_10637764 3300006195 Bacteria 661
138 Ga0097621_100013730 3300006237 Bacteria 6047
139 Ga0097621_100734575 3300006237 Bacteria 911
140 Ga0075370_10006542 3300006353 Bacteria 5868
141 Ga0068871_100003663 3300006358 Bacteria 10563
142 Ga0068871_100896051 3300006358 Unclassified 822
143 Ga0075428_100017657 3300006844 Bacteria 7883
144 Ga0075428_101560470 3300006844 Bacteria 691
145 Ga0075428_101711005 3300006844 Bacteria 656
146 Ga0075430_100181778 3300006846 Bacteria 1749
147 Ga0075431_100160614 3300006847 Bacteria 2311
148 Ga0075431_100310792 3300006847 Bacteria 1591
149 Ga0075431_100397300 3300006847 Bacteria 1380
150 Ga0075431_100480048 3300006847 Bacteria 1236
151 Ga0075433_10181651 3300006852 Bacteria 1872
152 Ga0075433_10240035 3300006852 Bacteria 1609
153 Ga0075433_10851045 3300006852 Bacteria 796
154 Ga0075434_100224568 3300006871 Unclassified 1898
155 Ga0075434_100241117 3300006871 Bacteria 1828
156 Ga0075429_100286324 3300006880 Bacteria 1443
157 Ga0075429_100918690 3300006880 Bacteria 766
158 Ga0068865_100002239 3300006881 Bacteria 11387
159 Ga0068865_100002610 3300006881 Bacteria 10711
160 Ga0075436_100060807 3300006914 Bacteria 2610
161 Ga0075436_100444986 3300006914 Bacteria 943
162 Ga0075436_100493738 3300006914 Bacteria 895
163 Ga0097620_100004484 3300006931 Bacteria 14249
164 Ga0097620_100024031 3300006931 Bacteria 6116
165 Ga0097620_100455608 3300006931 Bacteria 1375
166 Ga0075435_100000001 3300007076 Bacteria 207579
167 Ga0075435_100001711 3300007076 Bacteria 14253
168 Ga0075435_100095663 3300007076 Bacteria 2456
169 Ga0075435_100139284 3300007076 Bacteria 2035
170 Ga0075435_100856365 3300007076 Bacteria 792
171 Ga0105240_10068019 3300009093 Bacteria 4413
172 Ga0105240_10122985 3300009093 Bacteria 3123
173 Ga0105240_10939379 3300009093 Bacteria 928
174 Ga0111539_10167994 3300009094 Bacteria 2564
175 Ga0111539_10272312 3300009094 Bacteria 1971
176 Ga0111539_10637532 3300009094 Unclassified 1241
177 Ga0111539_10792602 3300009094 Bacteria 1103
178 Ga0111539_10909880 3300009094 Bacteria 1023
179 Ga0105245_10499044 3300009098 Unclassified 1233
180 Ga0105245_10851550 3300009098 Bacteria 952
181 Ga0105245_10947831 3300009098 Bacteria 903
182 Ga0114129_10012873 3300009147 Bacteria 11904
183 Ga0114129_10549363 3300009147 Bacteria 1502
184 Ga0114129_10685215 3300009147 Unclassified 1319
185 Ga0114129_10738477 3300009147 Bacteria 1261
186 Ga0114129_12766279 3300009147 Bacteria 584
187 Ga0105241_10970330 3300009174 Unclassified 793
188 Ga0105242_10004720 3300009176 Bacteria 10548
189 Ga0105242_10084074 3300009176 Bacteria 2666
190 Ga0105242_11918938 3300009176 Bacteria 633
191 Ga0105248_10029680 3300009177 Bacteria 6101
192 Ga0105248_10108652 3300009177 Bacteria 3128
193 Ga0105248_10477066 3300009177 Bacteria 1406
194 Ga0105248_11203852 3300009177 Unclassified 856
195 Ga0105248_13191294 3300009177 Bacteria 522
196 Ga0105237_10086735 3300009545 Bacteria 3120
197 Ga0105238_10000032 3300009551 Bacteria 178226
198 Ga0105238_10510235 3300009551 Bacteria 1204
199 Ga0105249_10232006 3300009553 Bacteria 1821
200 Ga0105249_10370441 3300009553 Bacteria 1456
201 Ga0105249_11342988 3300009553 Unclassified 787
202 Ga0105249_11684528 3300009553 Bacteria 707
203 Ga0157373_10931067 3300013100 Unclassified 646
204 Ga0157369_10264563 3300013105 Unclassified 1793
205 Ga0157378_10287197 3300013297 Bacteria 1588
206 Ga0157378_11103298 3300013297 Unclassified 830
207 Ga0157372_10588988 3300013307 Bacteria 1296
208 Ga0157372_12174210 3300013307 Bacteria 637
209 Ga0157375_11202599 3300013308 Bacteria 889
210 Ga0163163_10025810 3300014325 Bacteria 5604
211 Ga0163163_10199955 3300014325 Bacteria 2047
212 Ga0163163_10778163 3300014325 Bacteria 1020
213 Ga0163163_10860918 3300014325 Bacteria 970
214 Ga0157380_10019413 3300014326 Bacteria 5065
215 Ga0157380_10593636 3300014326 Bacteria 1094
216 Ga0157380_10719169 3300014326 Bacteria 1006
217 Ga0157380_11797693 3300014326 Bacteria 672
218 Ga0182008_10590638 3300014497 Bacteria 622
219 Ga0157377_10310651 3300014745 Bacteria 1044
220 Ga0157379_11288439 3300014968 Bacteria 705
221 Ga0157376_10132566 3300014969 Bacteria 2226
222 Ga0157376_10238910 3300014969 Unclassified 1692
223 Ga0157376_10497455 3300014969 Bacteria 1197
224 Ga0157376_12836437 3300014969 Unclassified 524
225 Ga0206352_11295461 3300020078 Bacteria 827
226 Ga0207682_10434672 3300025893 Bacteria 621
227 Ga0207642_10191554 3300025899 Bacteria 1122
228 Ga0207688_10322439 3300025901 Bacteria 948
229 Ga0207688_10345390 3300025901 Bacteria 916
230 Ga0207688_10600432 3300025901 Unclassified 693
231 Ga0207680_10299830 3300025903 Bacteria 1120
232 Ga0207645_10007478 3300025907 Bacteria 7711
233 Ga0207645_10065812 3300025907 Bacteria 2316
234 Ga0207684_10134801 3300025910 Bacteria 2120
235 Ga0207684_10280471 3300025910 Bacteria 1437
236 Ga0207684_10712311 3300025910 Unclassified 852
237 Ga0207684_11445844 3300025910 Bacteria 561
238 Ga0207654_10545731 3300025911 Bacteria 823
239 Ga0207695_10725515 3300025913 Bacteria 874
240 Ga0207671_10041042 3300025914 Bacteria 3424
241 Ga0207660_10565499 3300025917 Unclassified 925
242 Ga0207660_10604644 3300025917 Bacteria 893
243 Ga0207662_10004988 3300025918 Bacteria 7025
244 Ga0207662_10028805 3300025918 Bacteria 3214
245 Ga0207662_10044858 3300025918 Bacteria 2612
246 Ga0207657_10466209 3300025919 Bacteria 991
247 Ga0207649_10530673 3300025920 Bacteria 898
248 Ga0207652_10862499 3300025921 Bacteria 801
249 Ga0207646_10041823 3300025922 Unclassified 4118
250 Ga0207646_10950867 3300025922 Bacteria 761
251 Ga0207681_10040979 3300025923 Bacteria 3085
252 Ga0207681_10058404 3300025923 Bacteria 2641
253 Ga0207694_10000041 3300025924 Bacteria 183415
254 Ga0207694_10794203 3300025924 Bacteria 799
255 Ga0207650_10208893 3300025925 Bacteria 1567
256 Ga0207650_10750769 3300025925 Bacteria 826
257 Ga0207650_11266750 3300025925 Bacteria 628
258 Ga0207659_10299436 3300025926 Bacteria 1320
259 Ga0207659_10790292 3300025926 Bacteria 815
260 Ga0207687_10047234 3300025927 Bacteria 2984
261 Ga0207687_10386260 3300025927 Bacteria 1148
262 Ga0207700_10078122 3300025928 Bacteria 2573
263 Ga0207644_10012541 3300025931 Bacteria 5632
264 Ga0207644_10389844 3300025931 Bacteria 1137
265 Ga0207644_10532797 3300025931 Bacteria 971
266 Ga0207644_11422513 3300025931 Unclassified 582
267 Ga0207690_10064774 3300025932 Bacteria 2497
268 Ga0207690_10087827 3300025932 Bacteria 2189
269 Ga0207690_10394845 3300025932 Bacteria 1102
270 Ga0207706_10001341 3300025933 Bacteria 24583
271 Ga0207706_10088748 3300025933 Bacteria 2718
272 Ga0207686_10052519 3300025934 Bacteria 2544
273 Ga0207686_10150569 3300025934 Bacteria 1619
274 Ga0207709_10226381 3300025935 Bacteria 1352
275 Ga0207670_10000034 3300025936 Bacteria 109898
276 Ga0207670_10000535 3300025936 Bacteria 20899
277 Ga0207670_11052734 3300025936 Unclassified 686
278 Ga0207669_10182772 3300025937 Bacteria 1505
279 Ga0207704_10012050 3300025938 Bacteria 4280
280 Ga0207704_10296502 3300025938 Bacteria 1236
281 Ga0207704_11000688 3300025938 Bacteria 707
282 Ga0207691_10053375 3300025940 Bacteria 3689
283 Ga0207691_10144376 3300025940 Bacteria 2096
284 Ga0207711_10053551 3300025941 Bacteria 3460
285 Ga0207711_10132044 3300025941 Bacteria 2240
286 Ga0207689_10048119 3300025942 Bacteria 3517
287 Ga0207689_10129205 3300025942 Bacteria 2079
288 Ga0207689_10230419 3300025942 Bacteria 1531
289 Ga0207661_12129116 3300025944 Bacteria 507
290 Ga0207679_10080836 3300025945 Bacteria 2483
291 Ga0207679_10147474 3300025945 Bacteria 1910
292 Ga0207679_10396122 3300025945 Bacteria 1214
293 Ga0207679_10502723 3300025945 Bacteria 1082
294 Ga0207667_10259917 3300025949 Bacteria 1775
295 Ga0207667_11183540 3300025949 Unclassified 745
296 Ga0207651_10326944 3300025960 Bacteria 1283
297 Ga0207712_10139773 3300025961 Bacteria 1857
298 Ga0207712_10259955 3300025961 Bacteria 1407
299 Ga0207668_11187593 3300025972 Bacteria 685
300 Ga0207640_10133054 3300025981 Bacteria 1800
301 Ga0207677_10181467 3300026023 Bacteria 1656
302 Ga0207703_10195539 3300026035 Bacteria 1794
303 Ga0207639_10400961 3300026041 Bacteria 1236
304 Ga0207678_10607999 3300026067 Unclassified 959
305 Ga0207678_10630037 3300026067 Bacteria 941
306 Ga0207708_10001957 3300026075 Bacteria 15193
307 Ga0207708_10066039 3300026075 Bacteria 2766
308 Ga0207708_10165995 3300026075 Bacteria 1745
309 Ga0207708_10839228 3300026075 Unclassified 793
310 Ga0207702_11765809 3300026078 Bacteria 611
311 Ga0207641_10162052 3300026088 Bacteria 2034
312 Ga0207641_10203588 3300026088 Unclassified 1826
313 Ga0207648_10055529 3300026089 Bacteria 3457
314 Ga0207648_10071619 3300026089 Bacteria 3021
315 Ga0207648_10118959 3300026089 Bacteria 2322
316 Ga0207676_10232007 3300026095 Bacteria 1650
317 Ga0207676_11383817 3300026095 Bacteria 699
318 Ga0207676_12460924 3300026095 Unclassified 517
319 Ga0207674_11144013 3300026116 Bacteria 748
320 Ga0207675_100102162 3300026118 Bacteria 2702
321 Ga0207675_100238057 3300026118 Bacteria 1758
322 Ga0207675_100513805 3300026118 Bacteria 1193
323 Ga0207683_10187322 3300026121 Bacteria 1878
324 Ga0207683_10296801 3300026121 Bacteria 1478
325 Ga0207683_10824090 3300026121 Bacteria 861
326 Ga0207698_10110570 3300026142 Bacteria 2302
327 Ga0209996_1016098 3300027395 Bacteria 1025
328 Ga0210000_1060295 3300027462 Unclassified 614
329 Ga0209968_1088671 3300027526 Unclassified 560
330 Ga0209999_1009755 3300027543 Bacteria 1732
331 Ga0209983_1006677 3300027665 Bacteria 2368
332 Ga0209974_10013670 3300027876 Bacteria 2703
333 Ga0207428_10053688 3300027907 Bacteria 3213
334 Ga0207428_10243519 3300027907 Bacteria 1343
335 Ga0268266_11340549 3300028379 Bacteria 691
336 Ga0268265_10105941 3300028380 Bacteria 2283
337 Ga0268265_10130687 3300028380 Bacteria 2086
338 Ga0268265_10396441 3300028380 Bacteria 1274
339 Ga0268264_10105957 3300028381 Bacteria 2453
340 Ga0307408_100014050 3300031548 Bacteria 5320
341 Ga0307405_10004577 3300031731 Bacteria 6559
342 Ga0307405_10016061 3300031731 Bacteria 4072
343 Ga0307413_10026073 3300031824 Bacteria 3216
344 Ga0307410_10012320 3300031852 Bacteria 4940
345 Ga0307410_10052514 3300031852 Bacteria 2753
346 Ga0307410_10657983 3300031852 Bacteria 879
347 Ga0307406_10018766 3300031901 Bacteria 4047
348 Ga0307406_10070670 3300031901 Bacteria 2286
349 Ga0307406_10116367 3300031901 Bacteria 1850
350 Ga0307407_10107529 3300031903 Bacteria 1745
351 Ga0307412_10434282 3300031911 Bacteria 1077
352 Ga0307409_100000567 3300031995 Bacteria 16063
353 Ga0307409_100034538 3300031995 Bacteria 3694
354 Ga0307409_100124813 3300031995 Bacteria 2188
355 Ga0307409_100279258 3300031995 Bacteria 1543
356 Ga0307416_100000129 3300032002 Bacteria 45777
357 Ga0307416_100947973 3300032002 Bacteria 962
358 Ga0307414_10013657 3300032004 Bacteria 4843
359 Ga0307411_10035071 3300032005 Bacteria 3128
360 Ga0307411_11196977 3300032005 Bacteria 689
361 Ga0307415_100001853 3300032126 Bacteria 10363
362 Ga0307415_100390709 3300032126 Bacteria 1184
363 Ga0373958_0055731 3300034819 Unclassified 845
364 Ga0373958_0119183 3300034819 Bacteria 636
365 Ga0373959_0000174 3300034820 Bacteria 14518
366 Ga0373928_0131346 3300035084 Unclassified 679
367 Ga0373949_0009499 3300035090 Bacteria 2131
368 Ga0373956_0299167 3300035119 Unclassified 766
369 Ga0373943_0282190 3300035170 Bacteria 939
370 Ga0373961_0126227 3300035241 Bacteria 853
371 Ga0373931_0338664 3300035691 Unclassified 939
372 Ga0373947_0032090 3300035725 Bacteria 3094
373 Ga0373947_0120991 3300035725 Bacteria 1663
374 Ga0373937_0000409 3300036401 Bacteria 40030
375 Ga0373937_0713550 3300036401 Unclassified 950
376 Ga0373925_0003355 3300037068 Bacteria 12424
377 Ga0373925_0682288 3300037068 Unclassified 847
378 Ga0395900_1066850 3300037418 Unclassified 726
379 Ga0395905_0225177 3300037471 Bacteria 1755
380 Ga0395901_0392688 3300038443 Unclassified 1426
381 Ga0439461_0069905 3300041410 Bacteria 812
382 Ga0451807_1583510 3300041486 Bacteria 648
383 Ga0451853_0175114 3300041512 Bacteria 615
384 Ga0439450_226900 3300042008 Unclassified 504
385 Ga0450922_022787 3300042124 Unclassified 653
386 Ga0439446_0171633 3300042156 Bacteria 721
387 Ga0439459_0208188 3300042438 Bacteria 537
388 Ga0439464_0024186 3300042439 Bacteria 1680
389 Ga0439464_0225550 3300042439 Bacteria 602
390 Ga0439460_0310357 3300042461 Unclassified 552
391 Ga0451577_0065463 3300042876 Bacteria 3242
392 Ga0453683_0542380 3300044673 Unclassified 756
393 Ga0466957_0524842 3300044842 Bacteria 823
394 Ga0451576_0331054 3300045051 Bacteria 1594
395 Ga0451576_0936365 3300045051 Bacteria 909
396 Ga0466967_1281378 3300045976 Bacteria 730
397 Ga0466967_2169561 3300045976 Unclassified 551
398 Ga0495592_0206271 3300046454 Bacteria 1323
399 Ga0495592_0231210 3300046454 Bacteria 1231
400 Ga0495651_0224189 3300046462 Bacteria 1299
401 Ga0495594_0421761 3300046499 Unclassified 759
402 Ga0495608_0080345 3300046511 Bacteria 2120
403 Ga0495618_0528843 3300046514 Unclassified 708
404 Ga0495628_0191928 3300046516 Bacteria 1542
405 Ga0495628_0379632 3300046516 Unclassified 1035
406 Ga0495640_0087202 3300046533 Bacteria 2065
407 Ga0495586_0444496 3300046535 Bacteria 747
408 Ga0495586_0790725 3300046535 Bacteria 547
409 Ga0495667_0267368 3300046559 Bacteria 1087
410 Ga0495635_0498488 3300046663 Bacteria 802
411 Ga0495635_0718401 3300046663 Bacteria 647
412 Ga0495599_0044721 3300046678 Bacteria 2777
413 Ga0495599_0209816 3300046678 Bacteria 1194
414 Ga0495646_0294311 3300046680 Bacteria 860
415 Ga0495646_0675667 3300046680 Unclassified 521
416 Ga0495658_0079296 3300046683 Bacteria 1924
417 Ga0495613_0255512 3300046689 Bacteria 1222
418 Ga0495649_0323023 3300046694 Bacteria 783
419 Ga0495581_0463589 3300047315 Bacteria 738
420 Ga0495674_0103485 3300047319 Bacteria 2420
421 Ga0495680_0142898 3300047322 Bacteria 1750
422 Ga0495680_0231101 3300047322 Bacteria 1317
423 Ga0495684_0479000 3300047471 Unclassified 860
424 Ga0496103_0210978 3300048906 Bacteria 1249
425 Ga0496104_1050834 3300048907 Unclassified 718
426 Ga0496105_1121866 3300048908 Unclassified 583
427 Ga0496106_0283996 3300048909 Bacteria 1326
428 Ga0496107_0125094 3300048910 Bacteria 1896
429 Ga0496109_0758744 3300048912 Bacteria 908
430 Ga0496112_0013757 3300048915 Bacteria 7483
431 Ga0496112_0205359 3300048915 Bacteria 1928
432 Ga0496112_0789464 3300048915 Bacteria 875
433 Ga0496113_0050610 3300048916 Bacteria 3098
434 Ga0496113_0416724 3300048916 Bacteria 1079
435 Ga0496114_0848578 3300048917 Bacteria 793
436 Ga0501033_0925797 3300049570 Bacteria 585
437 Ga0501036_0934089 3300049572 Unclassified 711
438 Ga0501039_1102656 3300049575 Bacteria 615
439 Ga0501040_0234288 3300049576 Bacteria 1308
440 Ga0501042_0674598 3300049578 Bacteria 751
441 Ga0501043_1041050 3300049579 Bacteria 581
442 Ga0501067_0409325 3300049583 Bacteria 757
443 Ga0501069_0151229 3300049585 Bacteria 1334
444 Ga0501075_0250111 3300049591 Bacteria 1351
445 Ga0501075_0312250 3300049591 Bacteria 1198
446 Ga0501075_0329521 3300049591 Bacteria 1164
447 Ga0501075_1259850 3300049591 Unclassified 561
448 Ga0501076_0093682 3300049592 Bacteria 2418
449 Ga0501076_0370686 3300049592 Bacteria 1177
450 Ga0501076_0374927 3300049592 Bacteria 1169
451 Ga0501077_0340905 3300049593 Bacteria 956
452 Ga0501081_0626357 3300049743 Bacteria 806
453 Ga0501268_076889 3300049765 Bacteria 684
454 Ga0501045_0231339 3300049824 Bacteria 1376
455 nmdc:mga03683_25461_c1 3300050489 Bacteria 2325
456 nmdc:mga00v17_65236_c1 3300050491 Bacteria 2246
457 nmdc:mga00v17_66826_c1 3300050491 Bacteria 2220
458 nmdc:mga00v17_779259_c1 3300050491 Bacteria 610
459 nmdc:mga0yw44_151314_c1 3300050492 Bacteria 1514
460 nmdc:mga0yw44_22225_c1 3300050492 Bacteria 3553
461 nmdc:mga0yw44_909552_c1 3300050492 Bacteria 597
462 nmdc:mga0k408_16611_c2 3300050493 Bacteria 809
463 nmdc:mga0k408_336823_c1 3300050493 Bacteria 900
464 nmdc:mga0k408_617755_c1 3300050493 Bacteria 639
465 nmdc:mga06z11_17040_c1 3300050494 Bacteria 3288
466 nmdc:mga06z11_459596_c1 3300050494 Unclassified 770
467 nmdc:mga06z11_827120_c1 3300050494 Bacteria 564
468 nmdc:mga04h51_348966_c1 3300050495 Unclassified 611
469 nmdc:mga04h51_385258_c1 3300050495 Unclassified 585
470 nmdc:mga05p37_1013241_c1 3300050507 Bacteria 881
471 nmdc:mga05p37_1401698_c1 3300050507 Unclassified 704
472 nmdc:mga05p37_1833974_c1 3300050507 Bacteria 583
473 nmdc:mga05p37_196456_c1 3300050507 Bacteria 2446
474 nmdc:mga05p37_37788_c1 3300050507 Bacteria 5922
475 nmdc:mga05p37_417811_c1 3300050507 Unclassified 1561
476 nmdc:mga05p37_506430_c1 3300050507 Bacteria 1384
477 nmdc:mga09592_493080_c1 3300050508 Bacteria 1055
478 nmdc:mga0qj67_260698_c1 3300050509 Bacteria 1406
479 nmdc:mga06r32_1625736_c1 3300050510 Bacteria 584
480 nmdc:mga06r32_172911_c1 3300050510 Bacteria 2144
481 nmdc:mga06r32_289395_c1 3300050510 Bacteria 1625
482 nmdc:mga08y16_1061644_c1 3300050511 Unclassified 787
483 nmdc:mga08y16_229355_c1 3300050511 Bacteria 1921
484 nmdc:mga08y16_59727_c1 3300050511 Bacteria 3983
485 nmdc:mga08y16_733011_c1 3300050511 Bacteria 986
486 nmdc:mga08y16_987970_c1 3300050511 Bacteria 822
487 nmdc:mga0n895_1466959_c1 3300050512 Unclassified 649
488 nmdc:mga0n895_23_c1 3300050512 Bacteria 92165
489 nmdc:mga0n895_41946_c1 3300050512 Bacteria 4450
490 nmdc:mga0n895_441873_c1 3300050512 Bacteria 1314
491 nmdc:mga0n895_734155_c1 3300050512 Bacteria 982
492 nmdc:mga0rr50_1169644_c1 3300050513 Bacteria 654
493 nmdc:mga0rr50_11_c1 3300050513 Bacteria 216152
494 nmdc:mga0rr50_14256_c1 3300050513 Bacteria 5207
495 nmdc:mga0rr50_21675_c1 3300050513 Bacteria 4392
496 nmdc:mga0rr50_317535_c1 3300050513 Bacteria 1305
497 nmdc:mga08x19_1347998_c1 3300050514 Bacteria 505
498 nmdc:mga08x19_217421_c1 3300050514 Bacteria 1312
499 nmdc:mga08x19_53252_c1 3300050514 Bacteria 2604
500 nmdc:mga08x19_814379_c1 3300050514 Bacteria 663
501 nmdc:mga0a205_134066_c1 3300050515 Bacteria 2377
502 nmdc:mga0a205_543000_c1 3300050515 Bacteria 1018
503 nmdc:mga0sz30_211861_c1 3300050516 Unclassified 861
504 Ga0495595_0031045 3300053084 Bacteria 2400
505 Ga0495619_0154570 3300053085 Bacteria 1583
506 Ga0501082_0186355 3300060353 Bacteria 1806
507 Ga0501082_0429965 3300060353 Bacteria 1153
508 Ga0530510_1218557 3300061734 Bacteria 577
509 Ga0500628_004623
510 Ga0065704_10245787
511 Ga0065712_10071861
512 Ga0065712_10110360
513 Ga0065715_10037565
514 Ga0065715_10089740
515 Ga0065715_10818632
516 Ga0065707_10003305
517 Ga0070683_100014741
518 Ga0070690_100046593
519 Ga0070690_100774547
520 Ga0070690_101646500
521 Ga0070670_100007063
522 Ga0070670_100354527
523 Ga0070670_100357317
524 Ga0068869_100274323
525 Ga0068869_100375144
526 Ga0068869_100575723
527 Ga0070666_10002956
528 Ga0070666_10011390
529 Ga0070660_100482419
530 Ga0070689_100000097
531 Ga0070689_100003844
532 Ga0070689_100157592
533 Ga0070687_100002498
534 Ga0070687_100066589
535 Ga0070687_100249509
536 Ga0070661_100606959
537 Ga0070692_10488278
538 Ga0070668_100134731
539 Ga0070668_100324948
540 Ga0070669_100023255
541 Ga0070669_100130342
542 Ga0070671_100104068
543 Ga0070674_100402550
544 Ga0070674_100497508
545 Ga0070673_100005667
546 Ga0070688_100000202
547 Ga0070688_100000234
548 Ga0070659_100072094
549 Ga0070659_100365027
550 Ga0070713_100012809
551 Ga0070701_10028259
552 Ga0070701_10064113
553 Ga0070701_10809756
554 Ga0070705_100096016
555 Ga0070700_100051412
556 Ga0070700_100066979
557 Ga0070700_100207755
558 Ga0070700_100349589
559 Ga0070694_100001176
560 Ga0070694_100022646
561 Ga0070694_100133822
562 Ga0070694_100191304
563 Ga0070708_100355550
564 Ga0070663_100813577
565 Ga0070678_100254753
566 Ga0070662_100001202
567 Ga0070662_100204163
568 Ga0070681_10155840
569 Ga0068867_100059240
570 Ga0068867_100860500
571 Ga0070685_10000921
572 Ga0070685_10004320
573 Ga0070685_10789818
574 Ga0070706_100339733
575 Ga0070706_100825328
576 Ga0070707_100048364
577 Ga0070707_100064581
578 Ga0070707_100168889
579 Ga0070707_100912594
580 Ga0070698_100015277
581 Ga0070698_100235977
582 Ga0070698_100269978
583 Ga0070698_100619568
584 Ga0070699_100001220
585 Ga0070699_100023492
586 Ga0070699_100065307
587 Ga0070699_100087619
588 Ga0070699_100342001
589 Ga0070699_100744527
590 Ga0070679_100362053
591 Ga0070684_100010134
592 Ga0070684_100122782
593 Ga0070697_100024005
594 Ga0068853_100272565
595 Ga0070672_100011917
596 Ga0070672_100176327
597 Ga0070672_101942207
598 Ga0070686_100033257
599 Ga0070695_100002932
600 Ga0070696_100013043
601 Ga0070693_100108075
602 Ga0070665_101368737
603 Ga0070704_100008808
604 Ga0070704_100386409
605 Ga0068855_100268941
606 Ga0068855_101033415
607 Ga0070664_100031954
608 Ga0070664_100044625
609 Ga0070664_100530653
610 Ga0068857_100903610
611 Ga0068857_101400418
612 Ga0068854_100011163
613 Ga0068854_100136668
614 Ga0068856_100302488
615 Ga0070702_100424677
616 Ga0068852_100193548
617 Ga0068859_100004484
618 Ga0068859_100024031
619 Ga0068859_100455627
620 Ga0068864_100933654
621 Ga0068864_101379685
622 Ga0068864_101950467
623 Ga0068866_10138751
624 Ga0068866_10509658
625 Ga0068861_100270996
626 Ga0068861_100275057
627 Ga0068870_10188483
628 Ga0068863_100134855
629 Ga0068863_100237798
630 Ga0068863_100787355
631 Ga0068860_100027333
632 Ga0068862_100112529
633 Ga0068862_100384057
634 Ga0070717_10073966
635 Ga0075365_10011130
636 Ga0075365_10048038
637 Ga0075365_10059444
638 Ga0075364_10047278
639 Ga0075364_10083064
640 Ga0075364_10156321
641 Ga0075362_10001062
642 Ga0075367_10206331
643 Ga0075369_10186584
644 Ga0075366_10080144
645 Ga0075366_10637764
646 Ga0097621_100013730
647 Ga0097621_100734575
648 Ga0075370_10006542
649 Ga0068871_100003663
650 Ga0068871_100896051
651 Ga0075428_100017657
652 Ga0075428_101560470
653 Ga0075428_101711005
654 Ga0075430_100181778
655 Ga0075431_100160614
656 Ga0075431_100310792
657 Ga0075431_100397300
658 Ga0075431_100480048
659 Ga0075433_10181651
660 Ga0075433_10240035
661 Ga0075433_10851045
662 Ga0075434_100224568
663 Ga0075434_100241117
664 Ga0075429_100286324
665 Ga0075429_100918690
666 Ga0068865_100002239
667 Ga0068865_100002610
668 Ga0075436_100060807
669 Ga0075436_100444986
670 Ga0075436_100493738
671 Ga0097620_100004484
672 Ga0097620_100024031
673 Ga0097620_100455608
674 Ga0075435_100000001
675 Ga0075435_100001711
676 Ga0075435_100095663
677 Ga0075435_100139284
678 Ga0075435_100856365
679 Ga0105240_10068019
680 Ga0105240_10122985
681 Ga0105240_10939379
682 Ga0111539_10167994
683 Ga0111539_10272312
684 Ga0111539_10637532
685 Ga0111539_10792602
686 Ga0111539_10909880
687 Ga0105245_10499044
688 Ga0105245_10851550
689 Ga0105245_10947831
690 Ga0114129_10012873
691 Ga0114129_10549363
692 Ga0114129_10685215
693 Ga0114129_10738477
694 Ga0114129_12766279
695 Ga0105241_10970330
696 Ga0105242_10004720
697 Ga0105242_10084074
698 Ga0105242_11918938
699 Ga0105248_10029680
700 Ga0105248_10108652
701 Ga0105248_10477066
702 Ga0105248_11203852
703 Ga0105248_13191294
704 Ga0105237_10086735
705 Ga0105238_10000032
706 Ga0105238_10510235
707 Ga0105249_10232006
708 Ga0105249_10370441
709 Ga0105249_11342988
710 Ga0105249_11684528
711 Ga0157373_10931067
712 Ga0157369_10264563
713 Ga0157378_10287197
714 Ga0157378_11103298
715 Ga0157372_10588988
716 Ga0157372_12174210
717 Ga0157375_11202599
718 Ga0163163_10025810
719 Ga0163163_10199955
720 Ga0163163_10778163
721 Ga0163163_10860918
722 Ga0157380_10019413
723 Ga0157380_10593636
724 Ga0157380_10719169
725 Ga0157380_11797693
726 Ga0182008_10590638
727 Ga0157377_10310651
728 Ga0157379_11288439
729 Ga0157376_10132566
730 Ga0157376_10238910
731 Ga0157376_10497455
732 Ga0157376_12836437
733 Ga0206352_11295461
734 Ga0207682_10434672
735 Ga0207642_10191554
736 Ga0207688_10322439
737 Ga0207688_10345390
738 Ga0207688_10600432
739 Ga0207680_10299830
740 Ga0207645_10007478
741 Ga0207645_10065812
742 Ga0207684_10134801
743 Ga0207684_10280471
744 Ga0207684_10712311
745 Ga0207684_11445844
746 Ga0207654_10545731
747 Ga0207695_10725515
748 Ga0207671_10041042
749 Ga0207660_10565499
750 Ga0207660_10604644
751 Ga0207662_10004988
752 Ga0207662_10028805
753 Ga0207662_10044858
754 Ga0207657_10466209
755 Ga0207649_10530673
756 Ga0207652_10862499
757 Ga0207646_10041823
758 Ga0207646_10950867
759 Ga0207681_10040979
760 Ga0207681_10058404
761 Ga0207694_10000041
762 Ga0207694_10794203
763 Ga0207650_10208893
764 Ga0207650_10750769
765 Ga0207650_11266750
766 Ga0207659_10299436
767 Ga0207659_10790292
768 Ga0207687_10047234
769 Ga0207687_10386260
770 Ga0207700_10078122
771 Ga0207644_10012541
772 Ga0207644_10389844
773 Ga0207644_10532797
774 Ga0207644_11422513
775 Ga0207690_10064774
776 Ga0207690_10087827
777 Ga0207690_10394845
778 Ga0207706_10001341
779 Ga0207706_10088748
780 Ga0207686_10052519
781 Ga0207686_10150569
782 Ga0207709_10226381
783 Ga0207670_10000034
784 Ga0207670_10000535
785 Ga0207670_11052734
786 Ga0207669_10182772
787 Ga0207704_10012050
788 Ga0207704_10296502
789 Ga0207704_11000688
790 Ga0207691_10053375
791 Ga0207691_10144376
792 Ga0207711_10053551
793 Ga0207711_10132044
794 Ga0207689_10048119
795 Ga0207689_10129205
796 Ga0207689_10230419
797 Ga0207661_12129116
798 Ga0207679_10080836
799 Ga0207679_10147474
800 Ga0207679_10396122
801 Ga0207679_10502723
802 Ga0207667_10259917
803 Ga0207667_11183540
804 Ga0207651_10326944
805 Ga0207712_10139773
806 Ga0207712_10259955
807 Ga0207668_11187593
808 Ga0207640_10133054
809 Ga0207677_10181467
810 Ga0207703_10195539
811 Ga0207639_10400961
812 Ga0207678_10607999
813 Ga0207678_10630037
814 Ga0207708_10001957
815 Ga0207708_10066039
816 Ga0207708_10165995
817 Ga0207708_10839228
818 Ga0207702_11765809
819 Ga0207641_10162052
820 Ga0207641_10203588
821 Ga0207648_10055529
822 Ga0207648_10071619
823 Ga0207648_10118959
824 Ga0207676_10232007
825 Ga0207676_11383817
826 Ga0207676_12460924
827 Ga0207674_11144013
828 Ga0207675_100102162
829 Ga0207675_100238057
830 Ga0207675_100513805
831 Ga0207683_10187322
832 Ga0207683_10296801
833 Ga0207683_10824090
834 Ga0207698_10110570
835 Ga0209996_1016098
836 Ga0210000_1060295
837 Ga0209968_1088671
838 Ga0209999_1009755
839 Ga0209983_1006677
840 Ga0209974_10013670
841 Ga0207428_10053688
842 Ga0207428_10243519
843 Ga0268266_11340549
844 Ga0268265_10105941
845 Ga0268265_10130687
846 Ga0268265_10396441
847 Ga0268264_10105957
848 Ga0307408_100014050
849 Ga0307405_10004577
850 Ga0307405_10016061
851 Ga0307413_10026073
852 Ga0307410_10012320
853 Ga0307410_10052514
854 Ga0307410_10657983
855 Ga0307406_10018766
856 Ga0307406_10070670
857 Ga0307406_10116367
858 Ga0307407_10107529
859 Ga0307412_10434282
860 Ga0307409_100000567
861 Ga0307409_100034538
862 Ga0307409_100124813
863 Ga0307409_100279258
864 Ga0307416_100000129
865 Ga0307416_100947973
866 Ga0307414_10013657
867 Ga0307411_10035071
868 Ga0307411_11196977
869 Ga0307415_100001853
870 Ga0307415_100390709
871 Ga0373958_0055731
872 Ga0373958_0119183
873 Ga0373959_0000174
874 Ga0373928_0131346
875 Ga0373949_0009499
876 Ga0373956_0299167
877 Ga0373943_0282190
878 Ga0373961_0126227
879 Ga0373931_0338664
880 Ga0373947_0032090
881 Ga0373947_0120991
882 Ga0373937_0000409
883 Ga0373937_0713550
884 Ga0373925_0003355
885 Ga0373925_0682288
886 Ga0395900_1066850
887 Ga0395905_0225177
888 Ga0395901_0392688
889 Ga0439461_0069905
890 Ga0451807_1583510
891 Ga0451853_0175114
892 Ga0439450_226900
893 Ga0450922_022787
894 Ga0439446_0171633
895 Ga0439459_0208188
896 Ga0439464_0024186
897 Ga0439464_0225550
898 Ga0439460_0310357
899 Ga0451577_0065463
900 Ga0453683_0542380
901 Ga0466957_0524842
902 Ga0451576_0331054
903 Ga0451576_0936365
904 Ga0466967_1281378
905 Ga0466967_2169561
906 Ga0495592_0206271
907 Ga0495592_0231210
908 Ga0495651_0224189
909 Ga0495594_0421761
910 Ga0495608_0080345
911 Ga0495618_0528843
912 Ga0495628_0191928
913 Ga0495628_0379632
914 Ga0495640_0087202
915 Ga0495586_0444496
916 Ga0495586_0790725
917 Ga0495667_0267368
918 Ga0495635_0498488
919 Ga0495635_0718401
920 Ga0495599_0044721
921 Ga0495599_0209816
922 Ga0495646_0294311
923 Ga0495646_0675667
924 Ga0495658_0079296
925 Ga0495613_0255512
926 Ga0495649_0323023
927 Ga0495581_0463589
928 Ga0495674_0103485
929 Ga0495680_0142898
930 Ga0495680_0231101
931 Ga0495684_0479000
932 Ga0496103_0210978
933 Ga0496104_1050834
934 Ga0496105_1121866
935 Ga0496106_0283996
936 Ga0496107_0125094
937 Ga0496109_0758744
938 Ga0496112_0013757
939 Ga0496112_0205359
940 Ga0496112_0789464
941 Ga0496113_0050610
942 Ga0496113_0416724
943 Ga0496114_0848578
944 Ga0501033_0925797
945 Ga0501036_0934089
946 Ga0501039_1102656
947 Ga0501040_0234288
948 Ga0501042_0674598
949 Ga0501043_1041050
950 Ga0501067_0409325
951 Ga0501069_0151229
952 Ga0501075_0250111
953 Ga0501075_0312250
954 Ga0501075_0329521
955 Ga0501075_1259850
956 Ga0501076_0093682
957 Ga0501076_0370686
958 Ga0501076_0374927
959 Ga0501077_0340905
960 Ga0501081_0626357
961 Ga0501268_076889
962 Ga0501045_0231339
963 nmdc:mga03683_25461_c1
964 nmdc:mga00v17_65236_c1
965 nmdc:mga00v17_66826_c1
966 nmdc:mga00v17_779259_c1
967 nmdc:mga0yw44_151314_c1
968 nmdc:mga0yw44_22225_c1
969 nmdc:mga0yw44_909552_c1
970 nmdc:mga0k408_16611_c2
971 nmdc:mga0k408_336823_c1
972 nmdc:mga0k408_617755_c1
973 nmdc:mga06z11_17040_c1
974 nmdc:mga06z11_459596_c1
975 nmdc:mga06z11_827120_c1
976 nmdc:mga04h51_348966_c1
977 nmdc:mga04h51_385258_c1
978 nmdc:mga05p37_1013241_c1
979 nmdc:mga05p37_1401698_c1
980 nmdc:mga05p37_1833974_c1
981 nmdc:mga05p37_196456_c1
982 nmdc:mga05p37_37788_c1
983 nmdc:mga05p37_417811_c1
984 nmdc:mga05p37_506430_c1
985 nmdc:mga09592_493080_c1
986 nmdc:mga0qj67_260698_c1
987 nmdc:mga06r32_1625736_c1
988 nmdc:mga06r32_172911_c1
989 nmdc:mga06r32_289395_c1
990 nmdc:mga08y16_1061644_c1
991 nmdc:mga08y16_229355_c1
992 nmdc:mga08y16_59727_c1
993 nmdc:mga08y16_733011_c1
994 nmdc:mga08y16_987970_c1
995 nmdc:mga0n895_1466959_c1
996 nmdc:mga0n895_23_c1
997 nmdc:mga0n895_41946_c1
998 nmdc:mga0n895_441873_c1
999 nmdc:mga0n895_734155_c1
1000 nmdc:mga0rr50_1169644_c1
1001 nmdc:mga0rr50_11_c1
1002 nmdc:mga0rr50_14256_c1
1003 nmdc:mga0rr50_21675_c1
1004 nmdc:mga0rr50_317535_c1
1005 nmdc:mga08x19_1347998_c1
1006 nmdc:mga08x19_217421_c1
1007 nmdc:mga08x19_53252_c1
1008 nmdc:mga08x19_814379_c1
1009 nmdc:mga0a205_134066_c1
1010 nmdc:mga0a205_543000_c1
1011 nmdc:mga0sz30_211861_c1
1012 Ga0495595_0031045
1013 Ga0495619_0154570
1014 Ga0501082_0186355
1015 Ga0501082_0429965
1016 Ga0530510_1218557

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

63

137

0.92

PF00190

Cupin_1

Cupin

53

151

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u4v-assembly1.cif.gz_A non-crosslinked wild type cysteine dioxygenase 0.8877 43 118
6u1m-assembly1.cif.gz_A resting state of rat cysteine dioxygenase r60e variant 0.8839 43 118
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.8704 43 118
4wvz-assembly2.cif.gz_B crystal structure of artificial crosslinked thiol dioxygenase g95c variant from pseudomonas aeruginosa 0.8463 43 120
2vpv-assembly1.cif.gz_B dimerization domain of mif2p 0.8408 44 119
ID Description Score Start End Superfamily
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8651 44 119 2.60.120.10
2oa2A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8442 42 118 2.60.120.10
2vpvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8408 44 119 2.60.120.10
af_O06336_46_171_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8333 29 130 2.60.120.10
2vqaB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8303 24 119 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2V8BXD0-F1-model_v4 Cupin 0.9688 8 117
AF-A0A7Y2G8C9-F1-model_v4 Cupin domain-containing protein 0.958 8 120
AF-A0A7X4E0U2-F1-model_v4 Cupin domain-containing protein 0.9559 8 131
AF-A0A7Y2HWR4-F1-model_v4 Cupin domain-containing protein 0.9555 8 130
AF-A0A523EE13-F1-model_v4 Cupin domain-containing protein 0.9537 8 134

Map