F456880

General Info

Members Datasets Scaffolds Average Seq Length
508 241 1016 102

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0503774|Ga0501072_0503774_458_835
Length 125
Sequence MFVRTGPFRRRLAAPLLSPVARSDTVIIKILKNDKGNPPGKLADAELHFDSGPLEGLKLIGFAVWERRTGNGRNVTFPARQYSVNGERRSFALLRPVTETTAQDRIRDLVLQAYADYEAQEAIAS

Samples

Sample ID Description Type Environment
1 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
157 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
158 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
159 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
162 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
163 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
164 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
165 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
166 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
167 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
168 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
169 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
170 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
171 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
210 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
211 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
212 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
213 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
214 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
233 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
234 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 3.15
Rhizosphere 96.26
Stem 0
Stem Tuber 0
Unclassified 29.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501072_0503774 3300049588 Bacteria 958
2 ARcpr5oldR_c014001 3300000041 Bacteria 691
3 JGI24750J21931_1058377 3300002070 Unclassified 613
4 Ga0065714_10118895 3300005288 Bacteria 1373
5 Ga0065712_10068113 3300005290 Bacteria 14563
6 Ga0065712_10074428 3300005290 Bacteria 4098
7 Ga0065715_10000213 3300005293 Bacteria 23521
8 Ga0065715_10003709 3300005293 Bacteria 5066
9 Ga0065715_10096949 3300005293 Bacteria 3789
10 Ga0065715_10126501 3300005293 Bacteria 2095
11 Ga0065715_10198097 3300005293 Unclassified 1376
12 Ga0065715_10364593 3300005293 Unclassified 930
13 Ga0065715_11066327 3300005293 Bacteria 528
14 Ga0065707_10169832 3300005295 Bacteria 1493
15 Ga0065707_10608616 3300005295 Unclassified 686
16 Ga0070676_10007796 3300005328 Bacteria 5753
17 Ga0070676_10917104 3300005328 Unclassified 653
18 Ga0070676_11295400 3300005328 Bacteria 556
19 Ga0070683_100004427 3300005329 Bacteria 11580
20 Ga0070690_101019305 3300005330 Bacteria 653
21 Ga0070690_101679133 3300005330 Unclassified 516
22 Ga0070670_100001732 3300005331 Bacteria 17769
23 Ga0070670_100063336 3300005331 Bacteria 3174
24 Ga0070670_100358250 3300005331 Bacteria 1282
25 Ga0068869_100253745 3300005334 Bacteria 1406
26 Ga0068869_100432256 3300005334 Bacteria 1088
27 Ga0068869_100432366 3300005334 Bacteria 1088
28 Ga0070680_100062271 3300005336 Unclassified 3055
29 Ga0068868_100077164 3300005338 Bacteria 2665
30 Ga0070689_101203342 3300005340 Unclassified 680
31 Ga0070689_102097303 3300005340 Unclassified 518
32 Ga0070691_10006886 3300005341 Bacteria 5200
33 Ga0070687_100313327 3300005343 Bacteria 1000
34 Ga0070661_100021163 3300005344 Bacteria 4642
35 Ga0070661_100057006 3300005344 Unclassified 2863
36 Ga0070661_101228999 3300005344 Unclassified 627
37 Ga0070692_10516459 3300005345 Bacteria 777
38 Ga0070692_10840964 3300005345 Bacteria 630
39 Ga0070668_101188908 3300005347 Unclassified 691
40 Ga0070669_100030537 3300005353 Bacteria 3889
41 Ga0070669_100055907 3300005353 Bacteria 2892
42 Ga0070669_100087133 3300005353 Bacteria 2334
43 Ga0070669_100342757 3300005353 Bacteria 1211
44 Ga0070669_100470239 3300005353 Bacteria 1039
45 Ga0070675_100012054 3300005354 Bacteria 6775
46 Ga0070675_100021517 3300005354 Bacteria 5155
47 Ga0070675_100247165 3300005354 Bacteria 1560
48 Ga0070675_100652008 3300005354 Bacteria 957
49 Ga0070675_100817027 3300005354 Unclassified 852
50 Ga0070671_100148077 3300005355 Bacteria 1982
51 Ga0070674_100284181 3300005356 Bacteria 1312
52 Ga0070674_101596455 3300005356 Bacteria 588
53 Ga0070674_101688851 3300005356 Unclassified 572
54 Ga0070673_100122937 3300005364 Bacteria 2168
55 Ga0070673_100645106 3300005364 Bacteria 969
56 Ga0070673_100974216 3300005364 Bacteria 789
57 Ga0070688_100000960 3300005365 Bacteria 14418
58 Ga0070688_100201619 3300005365 Unclassified 1392
59 Ga0070688_100691670 3300005365 Unclassified 789
60 Ga0070659_101040081 3300005366 Bacteria 720
61 Ga0070667_101379567 3300005367 Unclassified 661
62 Ga0070667_101832492 3300005367 Bacteria 571
63 Ga0070667_101962288 3300005367 Unclassified 551
64 Ga0070703_10279121 3300005406 Bacteria 689
65 Ga0070701_10010738 3300005438 Bacteria 4063
66 Ga0070701_10062466 3300005438 Bacteria 1968
67 Ga0070701_10291794 3300005438 Bacteria 1000
68 Ga0070701_10883740 3300005438 Unclassified 616
69 Ga0070705_100021377 3300005440 Bacteria 3442
70 Ga0070705_101652369 3300005440 Bacteria 540
71 Ga0070700_100009546 3300005441 Bacteria 5334
72 Ga0070700_100055438 3300005441 Bacteria 2481
73 Ga0070700_100124654 3300005441 Bacteria 1731
74 Ga0070700_100382946 3300005441 Bacteria 1053
75 Ga0070700_100433658 3300005441 Bacteria 996
76 Ga0070694_100051584 3300005444 Bacteria 2778
77 Ga0070694_100203831 3300005444 Bacteria 1476
78 Ga0070694_101845154 3300005444 Bacteria 516
79 Ga0070663_100032902 3300005455 Bacteria 3578
80 Ga0070663_101234092 3300005455 Unclassified 658
81 Ga0070678_100401362 3300005456 Bacteria 1191
82 Ga0070678_100415977 3300005456 Unclassified 1171
83 Ga0070678_101537244 3300005456 Unclassified 624
84 Ga0070662_100044476 3300005457 Bacteria 3181
85 Ga0070662_100085148 3300005457 Bacteria 2362
86 Ga0070662_100357555 3300005457 Bacteria 1198
87 Ga0070662_101635648 3300005457 Unclassified 556
88 Ga0070681_10349342 3300005458 Bacteria 1389
89 Ga0068867_100008638 3300005459 Bacteria 7192
90 Ga0070685_10067567 3300005466 Bacteria 2109
91 Ga0070685_10226686 3300005466 Unclassified 1227
92 Ga0070706_100171352 3300005467 Bacteria 2027
93 Ga0070706_101074191 3300005467 Unclassified 741
94 Ga0070707_100024554 3300005468 Bacteria 5710
95 Ga0070707_101158817 3300005468 Unclassified 739
96 Ga0070698_100297892 3300005471 Bacteria 1544
97 Ga0070698_100302532 3300005471 Bacteria 1530
98 Ga0070698_100735904 3300005471 Bacteria 929
99 Ga0070698_101673387 3300005471 Unclassified 589
100 Ga0070698_101986461 3300005471 Bacteria 535
101 Ga0070699_101532811 3300005518 Unclassified 611
102 Ga0070679_100325059 3300005530 Bacteria 1487
103 Ga0070679_100450320 3300005530 Bacteria 1232
104 Ga0070684_100000238 3300005535 Bacteria 38130
105 Ga0070672_100013673 3300005543 Bacteria 5739
106 Ga0070672_100034582 3300005543 Bacteria 3836
107 Ga0070672_100720275 3300005543 Bacteria 874
108 Ga0070686_100117343 3300005544 Bacteria 1822
109 Ga0070686_100210602 3300005544 Bacteria 1399
110 Ga0070686_100510016 3300005544 Bacteria 935
111 Ga0070695_100006196 3300005545 Bacteria 7064
112 Ga0070695_100201959 3300005545 Bacteria 1421
113 Ga0070695_100546041 3300005545 Bacteria 903
114 Ga0070695_100581694 3300005545 Unclassified 877
115 Ga0070695_100999122 3300005545 Unclassified 680
116 Ga0070696_100012087 3300005546 Bacteria 5785
117 Ga0070696_100028356 3300005546 Bacteria 3820
118 Ga0070693_100025253 3300005547 Bacteria 3196
119 Ga0070665_100193607 3300005548 Bacteria 2034
120 Ga0070665_100348003 3300005548 Unclassified 1487
121 Ga0070665_100721119 3300005548 Bacteria 1010
122 Ga0070704_100008360 3300005549 Bacteria 6201
123 Ga0070704_100236957 3300005549 Unclassified 1492
124 Ga0070704_100472365 3300005549 Bacteria 1084
125 Ga0070704_101825792 3300005549 Unclassified 563
126 Ga0070664_100004624 3300005564 Bacteria 11047
127 Ga0070664_100810313 3300005564 Unclassified 876
128 Ga0068854_100031928 3300005578 Bacteria 3662
129 Ga0070702_100006617 3300005615 Bacteria 5500
130 Ga0070702_100830737 3300005615 Bacteria 717
131 Ga0068852_101877548 3300005616 Unclassified 621
132 Ga0068859_101021552 3300005617 Bacteria 908
133 Ga0068864_100002411 3300005618 Bacteria 15440
134 Ga0068864_100614131 3300005618 Unclassified 1056
135 Ga0068866_10745216 3300005718 Bacteria 676
136 Ga0068861_100003921 3300005719 Bacteria 9946
137 Ga0068861_100296269 3300005719 Unclassified 1399
138 Ga0068861_100533963 3300005719 Bacteria 1066
139 Ga0068861_100569909 3300005719 Bacteria 1035
140 Ga0068851_10199389 3300005834 Unclassified 1116
141 Ga0068863_100038197 3300005841 Bacteria 4569
142 Ga0068858_100666672 3300005842 Bacteria 1011
143 Ga0068858_100747085 3300005842 Unclassified 953
144 Ga0068858_102160699 3300005842 Unclassified 550
145 Ga0068860_100430390 3300005843 Unclassified 1309
146 Ga0068862_100342189 3300005844 Bacteria 1385
147 Ga0068862_100860686 3300005844 Bacteria 889
148 Ga0068862_101060077 3300005844 Unclassified 804
149 Ga0081539_10000802 3300005985 Bacteria 61172
150 Ga0081539_10198809 3300005985 Unclassified 927
151 Ga0075363_100839584 3300006048 Unclassified 560
152 Ga0075432_10569420 3300006058 Unclassified 514
153 Ga0070716_101250496 3300006173 Bacteria 598
154 Ga0068871_100050365 3300006358 Bacteria 3369
155 Ga0068871_100620938 3300006358 Bacteria 984
156 Ga0075428_100000262 3300006844 Bacteria 51841
157 Ga0075428_100007993 3300006844 Bacteria 11731
158 Ga0075428_100010165 3300006844 Bacteria 10450
159 Ga0075428_100641273 3300006844 Bacteria 1133
160 Ga0075428_101652640 3300006844 Unclassified 669
161 Ga0075430_100000264 3300006846 Bacteria 36933
162 Ga0075430_100004786 3300006846 Bacteria 11390
163 Ga0075430_100010111 3300006846 Bacteria 7984
164 Ga0075430_100013549 3300006846 Bacteria 6951
165 Ga0075430_100076487 3300006846 Bacteria 2806
166 Ga0075430_100113616 3300006846 Bacteria 2257
167 Ga0075430_100486541 3300006846 Unclassified 1018
168 Ga0075431_100009353 3300006847 Bacteria 9838
169 Ga0075431_100019753 3300006847 Bacteria 6876
170 Ga0075431_100076573 3300006847 Unclassified 3452
171 Ga0075431_100143240 3300006847 Unclassified 2463
172 Ga0075431_100404138 3300006847 Bacteria 1367
173 Ga0075431_100750430 3300006847 Bacteria 951
174 Ga0075431_101606122 3300006847 Unclassified 608
175 Ga0075433_10002214 3300006852 Bacteria 14745
176 Ga0075433_10119827 3300006852 Bacteria 2336
177 Ga0075434_100026992 3300006871 Bacteria 5635
178 Ga0075434_100069692 3300006871 Bacteria 3506
179 Ga0075429_100010146 3300006880 Bacteria 8159
180 Ga0075429_100010415 3300006880 Bacteria 8046
181 Ga0075429_100025021 3300006880 Bacteria 5182
182 Ga0075429_100845823 3300006880 Unclassified 801
183 Ga0068865_100407967 3300006881 Unclassified 1114
184 Ga0068865_101258550 3300006881 Unclassified 656
185 Ga0068865_101548773 3300006881 Unclassified 595
186 Ga0068865_101781856 3300006881 Unclassified 556
187 Ga0075436_100022501 3300006914 Bacteria 4329
188 Ga0075436_100038602 3300006914 Bacteria 3296
189 Ga0075436_100226413 3300006914 Bacteria 1328
190 Ga0097620_101021547 3300006931 Bacteria 908
191 Ga0075435_100137586 3300007076 Bacteria 2047
192 Ga0111539_10000368 3300009094 Bacteria 55696
193 Ga0111539_10079662 3300009094 Bacteria 3853
194 Ga0111539_10150746 3300009094 Bacteria 2722
195 Ga0111539_10159535 3300009094 Bacteria 2638
196 Ga0111539_10240242 3300009094 Bacteria 2108
197 Ga0111539_11549470 3300009094 Unclassified 769
198 Ga0111539_12766801 3300009094 Unclassified 568
199 Ga0114129_10000101 3300009147 Bacteria 84064
200 Ga0114129_10000408 3300009147 Bacteria 50625
201 Ga0114129_10022993 3300009147 Bacteria 8844
202 Ga0114129_10213768 3300009147 Bacteria 2605
203 Ga0114129_10654909 3300009147 Bacteria 1355
204 Ga0114129_10770406 3300009147 Unclassified 1230
205 Ga0114129_10834948 3300009147 Bacteria 1173
206 Ga0114129_11364540 3300009147 Unclassified 876
207 Ga0105243_10568973 3300009148 Unclassified 1086
208 Ga0105242_12330091 3300009176 Bacteria 582
209 Ga0105248_10201874 3300009177 Bacteria 2240
210 Ga0105249_10544378 3300009553 Bacteria 1211
211 Ga0105249_11196681 3300009553 Unclassified 831
212 Ga0105249_11740475 3300009553 Bacteria 696
213 Ga0105249_12059113 3300009553 Bacteria 643
214 Ga0105239_10724293 3300010375 Bacteria 1138
215 Ga0105239_13401507 3300010375 Bacteria 517
216 Ga0105246_10622136 3300011119 Unclassified 936
217 Ga0105246_10894969 3300011119 Unclassified 795
218 Ga0157339_1014732 3300012505 Unclassified 763
219 Ga0157374_10352703 3300013296 Unclassified 1462
220 Ga0157378_11810790 3300013297 Unclassified 659
221 Ga0157378_12004415 3300013297 Bacteria 629
222 Ga0163162_10021524 3300013306 Bacteria 6351
223 Ga0157375_10207760 3300013308 Bacteria 2115
224 Ga0157375_10590005 3300013308 Bacteria 1271
225 Ga0157375_13632548 3300013308 Unclassified 513
226 Ga0163163_10005422 3300014325 Bacteria 11028
227 Ga0163163_10151153 3300014325 Unclassified 2365
228 Ga0157380_10666642 3300014326 Bacteria 1040
229 Ga0157380_11599448 3300014326 Bacteria 707
230 Ga0157380_13306021 3300014326 Unclassified 515
231 Ga0157377_10068553 3300014745 Bacteria 2044
232 Ga0157377_10206938 3300014745 Bacteria 1249
233 Ga0206354_11600100 3300020081 Unclassified 1290
234 Ga0207688_10079756 3300025901 Bacteria 1867
235 Ga0207645_10007334 3300025907 Bacteria 7796
236 Ga0207684_11542830 3300025910 Unclassified 539
237 Ga0207707_10325790 3300025912 Bacteria 1326
238 Ga0207660_10183922 3300025917 Unclassified 1624
239 Ga0207652_10412574 3300025921 Bacteria 1218
240 Ga0207652_10618062 3300025921 Bacteria 971
241 Ga0207646_10076283 3300025922 Bacteria 2995
242 Ga0207646_11164469 3300025922 Unclassified 677
243 Ga0207681_10186881 3300025923 Bacteria 1582
244 Ga0207681_10496153 3300025923 Bacteria 999
245 Ga0207650_10130253 3300025925 Bacteria 1968
246 Ga0207650_10498555 3300025925 Bacteria 1017
247 Ga0207659_10012725 3300025926 Bacteria 5369
248 Ga0207659_10377410 3300025926 Bacteria 1182
249 Ga0207687_10923117 3300025927 Unclassified 747
250 Ga0207700_10179737 3300025928 Unclassified 1771
251 Ga0207644_10500807 3300025931 Bacteria 1002
252 Ga0207690_11354447 3300025932 Bacteria 595
253 Ga0207706_10023538 3300025933 Bacteria 5529
254 Ga0207706_10038506 3300025933 Bacteria 4241
255 Ga0207706_11270329 3300025933 Unclassified 609
256 Ga0207669_10587882 3300025937 Bacteria 903
257 Ga0207704_10091966 3300025938 Bacteria 1995
258 Ga0207704_10687664 3300025938 Bacteria 846
259 Ga0207704_11308857 3300025938 Unclassified 620
260 Ga0207704_11484098 3300025938 Unclassified 582
261 Ga0207704_11726619 3300025938 Unclassified 538
262 Ga0207691_10009739 3300025940 Bacteria 9222
263 Ga0207691_10204745 3300025940 Bacteria 1716
264 Ga0207691_11440421 3300025940 Unclassified 565
265 Ga0207711_10098575 3300025941 Bacteria 2582
266 Ga0207689_10370281 3300025942 Bacteria 1192
267 Ga0207689_10637725 3300025942 Unclassified 897
268 Ga0207689_10792714 3300025942 Bacteria 800
269 Ga0207679_10989145 3300025945 Unclassified 771
270 Ga0207651_10403673 3300025960 Bacteria 1163
271 Ga0207712_10636285 3300025961 Bacteria 926
272 Ga0207712_11352615 3300025961 Unclassified 637
273 Ga0207712_11903533 3300025961 Bacteria 532
274 Ga0207668_10107446 3300025972 Bacteria 2087
275 Ga0207668_10165701 3300025972 Unclassified 1727
276 Ga0207668_10181663 3300025972 Bacteria 1660
277 Ga0207668_11064660 3300025972 Unclassified 724
278 Ga0207640_10470653 3300025981 Unclassified 1040
279 Ga0207658_11746434 3300025986 Unclassified 568
280 Ga0207703_10261361 3300026035 Bacteria 1565
281 Ga0207703_12294312 3300026035 Unclassified 515
282 Ga0207678_11515781 3300026067 Bacteria 592
283 Ga0207708_10022472 3300026075 Bacteria 4763
284 Ga0207708_10090269 3300026075 Bacteria 2362
285 Ga0207708_10125065 3300026075 Bacteria 2006
286 Ga0207708_10336798 3300026075 Unclassified 1234
287 Ga0207708_11341693 3300026075 Unclassified 627
288 Ga0207708_11428354 3300026075 Unclassified 607
289 Ga0207641_12419780 3300026088 Unclassified 524
290 Ga0207648_10026344 3300026089 Bacteria 5168
291 Ga0207676_10008908 3300026095 Bacteria 7140
292 Ga0207675_100002118 3300026118 Bacteria 19672
293 Ga0207675_100070209 3300026118 Bacteria 3274
294 Ga0207675_100070446 3300026118 Bacteria 3268
295 Ga0207675_100337125 3300026118 Bacteria 1475
296 Ga0207675_102202539 3300026118 Bacteria 566
297 Ga0207683_10018709 3300026121 Bacteria 5908
298 Ga0207683_10275843 3300026121 Unclassified 1536
299 Ga0207683_10283149 3300026121 Bacteria 1515
300 Ga0207683_10564634 3300026121 Bacteria 1052
301 Ga0209971_1028205 3300027682 Bacteria 1343
302 Ga0207428_10001318 3300027907 Bacteria 26410
303 Ga0207428_10034862 3300027907 Bacteria 4119
304 Ga0207428_11132782 3300027907 Unclassified 546
305 Ga0268265_10286018 3300028380 Bacteria 1477
306 Ga0268265_11516130 3300028380 Bacteria 674
307 Ga0307408_100034047 3300031548 Bacteria 3564
308 Ga0307408_100236002 3300031548 Bacteria 1500
309 Ga0307408_101222904 3300031548 Bacteria 701
310 Ga0307408_101756386 3300031548 Unclassified 592
311 Ga0307405_10193357 3300031731 Bacteria 1471
312 Ga0307405_10640971 3300031731 Bacteria 872
313 Ga0307405_10832577 3300031731 Bacteria 775
314 Ga0307405_11973478 3300031731 Unclassified 522
315 Ga0307413_10216346 3300031824 Bacteria 1396
316 Ga0307413_10514082 3300031824 Bacteria 964
317 Ga0307410_10105107 3300031852 Bacteria 2032
318 Ga0307410_10861662 3300031852 Bacteria 774
319 Ga0307406_10051214 3300031901 Bacteria 2621
320 Ga0307406_10339659 3300031901 Bacteria 1169
321 Ga0307406_10571078 3300031901 Bacteria 928
322 Ga0307406_11171258 3300031901 Bacteria 666
323 Ga0307406_11385885 3300031901 Bacteria 616
324 Ga0307407_10007607 3300031903 Bacteria 4915
325 Ga0307407_10096513 3300031903 Bacteria 1825
326 Ga0307412_10074948 3300031911 Bacteria 2320
327 Ga0307412_10079899 3300031911 Unclassified 2257
328 Ga0307412_11738130 3300031911 Unclassified 572
329 Ga0307409_100357851 3300031995 Bacteria 1380
330 Ga0307409_100392981 3300031995 Bacteria 1322
331 Ga0307409_100494840 3300031995 Bacteria 1189
332 Ga0307409_100652587 3300031995 Bacteria 1046
333 Ga0307409_100687426 3300031995 Bacteria 1021
334 Ga0307409_100777630 3300031995 Bacteria 963
335 Ga0307416_100156940 3300032002 Bacteria 2096
336 Ga0307416_100670799 3300032002 Bacteria 1123
337 Ga0307416_100985246 3300032002 Bacteria 946
338 Ga0307414_11623808 3300032004 Unclassified 603
339 Ga0307414_12291514 3300032004 Unclassified 504
340 Ga0307411_10051362 3300032005 Bacteria 2689
341 Ga0307411_12349706 3300032005 Bacteria 501
342 Ga0307415_100029497 3300032126 Unclassified 3507
343 Ga0307415_100913755 3300032126 Bacteria 810
344 Ga0373940_0366863 3300035088 Unclassified 508
345 Ga0373936_0086963 3300035113 Bacteria 1307
346 Ga0373939_0384008 3300035114 Unclassified 579
347 Ga0373924_0168088 3300035410 Unclassified 963
348 Ga0373935_0371061 3300035692 Unclassified 1023
349 Ga0373933_0079995 3300035724 Unclassified 2002
350 Ga0373937_0009383 3300036401 Bacteria 8500
351 Ga0395898_0516859 3300037466 Unclassified 1135
352 Ga0395901_1063948 3300038443 Unclassified 781
353 Ga0439461_0041430 3300041410 Unclassified 996
354 Ga0451802_0296826 3300041460 Unclassified 601
355 Ga0451802_0383504 3300041460 Bacteria 579
356 Ga0439433_0079985 3300041999 Unclassified 794
357 Ga0439445_0087058 3300042004 Unclassified 877
358 Ga0439449_0235040 3300042007 Unclassified 688
359 Ga0439454_029677 3300042011 Unclassified 851
360 Ga0439462_0135775 3300042015 Unclassified 688
361 Ga0450923_083055 3300042125 Bacteria 723
362 Ga0450890_021453 3300042127 Unclassified 879
363 Ga0450896_008215 3300042133 Bacteria 1446
364 Ga0450896_089880 3300042133 Unclassified 523
365 Ga0450910_097374 3300042147 Unclassified 526
366 Ga0439446_0141046 3300042156 Unclassified 787
367 Ga0439446_0343227 3300042156 Unclassified 531
368 Ga0439435_0005934 3300042436 Unclassified 2717
369 Ga0439435_0099927 3300042436 Unclassified 890
370 Ga0439464_0004739 3300042439 Bacteria 3484
371 Ga0439464_0026532 3300042439 Bacteria 1608
372 Ga0439464_0041974 3300042439 Unclassified 1306
373 Ga0439460_0047324 3300042461 Unclassified 1280
374 Ga0450893_0075455 3300042532 Bacteria 660
375 Ga0451577_0016390 3300042876 Bacteria 6866
376 Ga0439440_0062497 3300042993 Bacteria 953
377 Ga0453684_0045769 3300044712 Bacteria 5830
378 Ga0495638_0126966 3300046460 Bacteria 1502
379 Ga0495643_0335035 3300046522 Bacteria 681
380 Ga0495586_0701970 3300046535 Bacteria 584
381 Ga0495659_0291255 3300046664 Bacteria 688
382 Ga0495588_0061673 3300046674 Bacteria 1943
383 Ga0496101_0914141 3300048904 Bacteria 691
384 Ga0496101_1442083 3300048904 Unclassified 537
385 Ga0496102_0381898 3300048905 Bacteria 1326
386 Ga0496102_0518586 3300048905 Bacteria 1114
387 Ga0496104_0070097 3300048907 Bacteria 3333
388 Ga0496105_0061140 3300048908 Bacteria 3108
389 Ga0496106_0082243 3300048909 Bacteria 2475
390 Ga0496107_0618062 3300048910 Bacteria 800
391 Ga0496108_0632004 3300048911 Unclassified 931
392 Ga0496109_0010970 3300048912 Bacteria 7764
393 Ga0496110_0014670 3300048913 Bacteria 6513
394 Ga0496111_0137211 3300048914 Bacteria 1812
395 Ga0496112_0003773 3300048915 Bacteria 12647
396 Ga0496112_1417615 3300048915 Unclassified 609
397 Ga0501031_0167365 3300049568 Bacteria 1436
398 Ga0501031_0299417 3300049568 Unclassified 1042
399 Ga0501034_0020819 3300049571 Bacteria 6693
400 Ga0501034_0342913 3300049571 Bacteria 1424
401 Ga0501036_0025176 3300049572 Bacteria 5020
402 Ga0501036_0199558 3300049572 Bacteria 1683
403 Ga0501037_0373700 3300049573 Bacteria 981
404 Ga0501038_0212890 3300049574 Unclassified 1545
405 Ga0501038_1122470 3300049574 Unclassified 573
406 Ga0501040_0733808 3300049576 Unclassified 714
407 Ga0501041_0029065 3300049577 Bacteria 3335
408 Ga0501041_0471858 3300049577 Bacteria 797
409 Ga0501042_0200077 3300049578 Unclassified 1440
410 Ga0501043_1036901 3300049579 Bacteria 582
411 Ga0501046_0202775 3300049580 Bacteria 1475
412 Ga0501047_0043660 3300049581 Bacteria 4330
413 Ga0501048_0052404 3300049582 Bacteria 2904
414 Ga0501048_0301120 3300049582 Bacteria 1141
415 Ga0501070_0135430 3300049586 Bacteria 2034
416 Ga0501070_0592776 3300049586 Bacteria 884
417 Ga0501071_0180697 3300049587 Bacteria 1581
418 Ga0501071_0334054 3300049587 Bacteria 1152
419 Ga0501071_0969593 3300049587 Bacteria 656
420 Ga0501072_1166029 3300049588 Unclassified 599
421 Ga0501073_0112846 3300049589 Bacteria 1885
422 Ga0501073_0135616 3300049589 Bacteria 1706
423 Ga0501074_0404564 3300049590 Bacteria 968
424 Ga0501074_0956011 3300049590 Unclassified 603
425 Ga0501074_1042588 3300049590 Bacteria 575
426 Ga0501074_1044185 3300049590 Bacteria 574
427 Ga0501076_0036006 3300049592 Bacteria 3876
428 Ga0501077_0449557 3300049593 Bacteria 825
429 Ga0501077_0532785 3300049593 Unclassified 753
430 Ga0501208_011473 3300049655 Unclassified 1278
431 Ga0501217_152814 3300049661 Bacteria 691
432 Ga0501235_192413 3300049669 Unclassified 549
433 Ga0501246_018353 3300049676 Bacteria 704
434 Ga0501260_031665 3300049689 Bacteria 612
435 Ga0501225_0029681 3300049705 Bacteria 1503
436 Ga0501079_0015881 3300049741 Bacteria 5755
437 Ga0501079_0162812 3300049741 Bacteria 1740
438 Ga0501080_1013318 3300049742 Unclassified 720
439 Ga0501081_0130846 3300049743 Bacteria 1793
440 Ga0501081_0178593 3300049743 Bacteria 1535
441 Ga0501081_0727294 3300049743 Bacteria 746
442 Ga0501279_101824 3300049775 Bacteria 518
443 Ga0501035_0172018 3300049822 Bacteria 1871
444 Ga0501035_0437815 3300049822 Bacteria 1083
445 Ga0501044_0004157 3300049823 Bacteria 16261
446 Ga0501045_0044873 3300049824 Bacteria 3220
447 Ga0501045_1417421 3300049824 Bacteria 504
448 nmdc:mga05p37_1151578_c1 3300050507 Bacteria 807
449 nmdc:mga05p37_161644_c1 3300050507 Bacteria 2735
450 nmdc:mga05p37_215053_c1 3300050507 Bacteria 2322
451 nmdc:mga05p37_218764_c1 3300050507 Viruses 2299
452 nmdc:mga05p37_2745_c1 3300050507 Bacteria 20452
453 nmdc:mga05p37_3160_c1 3300050507 Bacteria 19167
454 nmdc:mga05p37_316997_c1 3300050507 Unclassified 1847
455 nmdc:mga05p37_489087_c1 3300050507 Bacteria 1415
456 nmdc:mga09592_1556004_c1 3300050508 Bacteria 536
457 nmdc:mga09592_3132_c1 3300050508 Bacteria 13434
458 nmdc:mga09592_62696_c1 3300050508 Bacteria 3145
459 nmdc:mga09592_948_c2 3300050508 Bacteria 15223
460 nmdc:mga0qj67_1386713_c1 3300050509 Unclassified 543
461 nmdc:mga0qj67_193124_c1 3300050509 Bacteria 1654
462 nmdc:mga0qj67_265409_c1 3300050509 Bacteria 1392
463 nmdc:mga0qj67_36349_c1 3300050509 Bacteria 3853
464 nmdc:mga0qj67_374894_c1 3300050509 Unclassified 1149
465 nmdc:mga0qj67_47405_c1 3300050509 Bacteria 3395
466 nmdc:mga0qj67_85273_c1 3300050509 Bacteria 2533
467 nmdc:mga06r32_118598_c1 3300050510 Bacteria 2609
468 nmdc:mga06r32_1505517_c1 3300050510 Unclassified 613
469 nmdc:mga06r32_1683851_c1 3300050510 Unclassified 571
470 nmdc:mga06r32_627911_c1 3300050510 Bacteria 1044
471 nmdc:mga06r32_7731_c1 3300050510 Bacteria 9666
472 nmdc:mga06r32_807594_c1 3300050510 Bacteria 898
473 nmdc:mga06r32_83183_c1 3300050510 Bacteria 3119
474 nmdc:mga08y16_119453_c1 3300050511 Bacteria 2744
475 nmdc:mga08y16_1435634_c1 3300050511 Unclassified 652
476 nmdc:mga08y16_282624_c1 3300050511 Bacteria 1711
477 nmdc:mga08y16_310806_c1 3300050511 Bacteria 1623
478 nmdc:mga08y16_404224_c1 3300050511 Bacteria 1397
479 nmdc:mga08y16_59133_c1 3300050511 Bacteria 2305
480 nmdc:mga08y16_61148_c1 3300050511 Bacteria 3933
481 nmdc:mga08y16_80621_c1 3300050511 Bacteria 3394
482 nmdc:mga0n895_1462197_c1 3300050512 Unclassified 650
483 nmdc:mga0n895_25803_c1 3300050512 Bacteria 5557
484 nmdc:mga0n895_690237_c1 3300050512 Bacteria 1017
485 nmdc:mga0rr50_125917_c1 3300050513 Bacteria 2046
486 nmdc:mga08x19_3276_c1 3300050514 Bacteria 9679
487 nmdc:mga08x19_347789_c1 3300050514 Bacteria 1035
488 nmdc:mga08x19_496154_c1 3300050514 Bacteria 862
489 nmdc:mga0a205_136424_c1 3300050515 Bacteria 2354
490 nmdc:mga0a205_17935_c1 3300050515 Bacteria 6645
491 Ga0495601_0036449 3300053077 Unclassified 3071
492 Ga0495612_0087981 3300053078 Unclassified 1312
493 Ga0500592_018391 3300053116 Bacteria 1122
494 Ga0500628_161938 3300053129 Bacteria 631
495 Ga0501084_0072665 3300054114 Bacteria 2881
496 Ga0501084_0130691 3300054114 Bacteria 2114
497 Ga0501084_0747361 3300054114 Unclassified 824
498 Ga0590071_000040 3300059421 Bacteria 32740
499 Ga0590074_004142 3300059423 Bacteria 2397
500 Ga0590075_001075 3300059424 Bacteria 7064
501 Ga0590077_001222 3300059426 Bacteria 6199
502 Ga0590077_017145 3300059426 Bacteria 1522
503 Ga0590077_029521 3300059426 Bacteria 1193
504 Ga0501082_0438001 3300060353 Unclassified 1142
505 Ga0501082_0653570 3300060353 Bacteria 920
506 Ga0501082_0695996 3300060353 Unclassified 889
507 Ga0501082_1885891 3300060353 Unclassified 521
508 Ga0530510_0008426 3300061734 Bacteria 7186
509 Ga0501072_0503774
510 ARcpr5oldR_c014001
511 JGI24750J21931_1058377
512 Ga0065714_10118895
513 Ga0065712_10068113
514 Ga0065712_10074428
515 Ga0065715_10000213
516 Ga0065715_10003709
517 Ga0065715_10096949
518 Ga0065715_10126501
519 Ga0065715_10198097
520 Ga0065715_10364593
521 Ga0065715_11066327
522 Ga0065707_10169832
523 Ga0065707_10608616
524 Ga0070676_10007796
525 Ga0070676_10917104
526 Ga0070676_11295400
527 Ga0070683_100004427
528 Ga0070690_101019305
529 Ga0070690_101679133
530 Ga0070670_100001732
531 Ga0070670_100063336
532 Ga0070670_100358250
533 Ga0068869_100253745
534 Ga0068869_100432256
535 Ga0068869_100432366
536 Ga0070680_100062271
537 Ga0068868_100077164
538 Ga0070689_101203342
539 Ga0070689_102097303
540 Ga0070691_10006886
541 Ga0070687_100313327
542 Ga0070661_100021163
543 Ga0070661_100057006
544 Ga0070661_101228999
545 Ga0070692_10516459
546 Ga0070692_10840964
547 Ga0070668_101188908
548 Ga0070669_100030537
549 Ga0070669_100055907
550 Ga0070669_100087133
551 Ga0070669_100342757
552 Ga0070669_100470239
553 Ga0070675_100012054
554 Ga0070675_100021517
555 Ga0070675_100247165
556 Ga0070675_100652008
557 Ga0070675_100817027
558 Ga0070671_100148077
559 Ga0070674_100284181
560 Ga0070674_101596455
561 Ga0070674_101688851
562 Ga0070673_100122937
563 Ga0070673_100645106
564 Ga0070673_100974216
565 Ga0070688_100000960
566 Ga0070688_100201619
567 Ga0070688_100691670
568 Ga0070659_101040081
569 Ga0070667_101379567
570 Ga0070667_101832492
571 Ga0070667_101962288
572 Ga0070703_10279121
573 Ga0070701_10010738
574 Ga0070701_10062466
575 Ga0070701_10291794
576 Ga0070701_10883740
577 Ga0070705_100021377
578 Ga0070705_101652369
579 Ga0070700_100009546
580 Ga0070700_100055438
581 Ga0070700_100124654
582 Ga0070700_100382946
583 Ga0070700_100433658
584 Ga0070694_100051584
585 Ga0070694_100203831
586 Ga0070694_101845154
587 Ga0070663_100032902
588 Ga0070663_101234092
589 Ga0070678_100401362
590 Ga0070678_100415977
591 Ga0070678_101537244
592 Ga0070662_100044476
593 Ga0070662_100085148
594 Ga0070662_100357555
595 Ga0070662_101635648
596 Ga0070681_10349342
597 Ga0068867_100008638
598 Ga0070685_10067567
599 Ga0070685_10226686
600 Ga0070706_100171352
601 Ga0070706_101074191
602 Ga0070707_100024554
603 Ga0070707_101158817
604 Ga0070698_100297892
605 Ga0070698_100302532
606 Ga0070698_100735904
607 Ga0070698_101673387
608 Ga0070698_101986461
609 Ga0070699_101532811
610 Ga0070679_100325059
611 Ga0070679_100450320
612 Ga0070684_100000238
613 Ga0070672_100013673
614 Ga0070672_100034582
615 Ga0070672_100720275
616 Ga0070686_100117343
617 Ga0070686_100210602
618 Ga0070686_100510016
619 Ga0070695_100006196
620 Ga0070695_100201959
621 Ga0070695_100546041
622 Ga0070695_100581694
623 Ga0070695_100999122
624 Ga0070696_100012087
625 Ga0070696_100028356
626 Ga0070693_100025253
627 Ga0070665_100193607
628 Ga0070665_100348003
629 Ga0070665_100721119
630 Ga0070704_100008360
631 Ga0070704_100236957
632 Ga0070704_100472365
633 Ga0070704_101825792
634 Ga0070664_100004624
635 Ga0070664_100810313
636 Ga0068854_100031928
637 Ga0070702_100006617
638 Ga0070702_100830737
639 Ga0068852_101877548
640 Ga0068859_101021552
641 Ga0068864_100002411
642 Ga0068864_100614131
643 Ga0068866_10745216
644 Ga0068861_100003921
645 Ga0068861_100296269
646 Ga0068861_100533963
647 Ga0068861_100569909
648 Ga0068851_10199389
649 Ga0068863_100038197
650 Ga0068858_100666672
651 Ga0068858_100747085
652 Ga0068858_102160699
653 Ga0068860_100430390
654 Ga0068862_100342189
655 Ga0068862_100860686
656 Ga0068862_101060077
657 Ga0081539_10000802
658 Ga0081539_10198809
659 Ga0075363_100839584
660 Ga0075432_10569420
661 Ga0070716_101250496
662 Ga0068871_100050365
663 Ga0068871_100620938
664 Ga0075428_100000262
665 Ga0075428_100007993
666 Ga0075428_100010165
667 Ga0075428_100641273
668 Ga0075428_101652640
669 Ga0075430_100000264
670 Ga0075430_100004786
671 Ga0075430_100010111
672 Ga0075430_100013549
673 Ga0075430_100076487
674 Ga0075430_100113616
675 Ga0075430_100486541
676 Ga0075431_100009353
677 Ga0075431_100019753
678 Ga0075431_100076573
679 Ga0075431_100143240
680 Ga0075431_100404138
681 Ga0075431_100750430
682 Ga0075431_101606122
683 Ga0075433_10002214
684 Ga0075433_10119827
685 Ga0075434_100026992
686 Ga0075434_100069692
687 Ga0075429_100010146
688 Ga0075429_100010415
689 Ga0075429_100025021
690 Ga0075429_100845823
691 Ga0068865_100407967
692 Ga0068865_101258550
693 Ga0068865_101548773
694 Ga0068865_101781856
695 Ga0075436_100022501
696 Ga0075436_100038602
697 Ga0075436_100226413
698 Ga0097620_101021547
699 Ga0075435_100137586
700 Ga0111539_10000368
701 Ga0111539_10079662
702 Ga0111539_10150746
703 Ga0111539_10159535
704 Ga0111539_10240242
705 Ga0111539_11549470
706 Ga0111539_12766801
707 Ga0114129_10000101
708 Ga0114129_10000408
709 Ga0114129_10022993
710 Ga0114129_10213768
711 Ga0114129_10654909
712 Ga0114129_10770406
713 Ga0114129_10834948
714 Ga0114129_11364540
715 Ga0105243_10568973
716 Ga0105242_12330091
717 Ga0105248_10201874
718 Ga0105249_10544378
719 Ga0105249_11196681
720 Ga0105249_11740475
721 Ga0105249_12059113
722 Ga0105239_10724293
723 Ga0105239_13401507
724 Ga0105246_10622136
725 Ga0105246_10894969
726 Ga0157339_1014732
727 Ga0157374_10352703
728 Ga0157378_11810790
729 Ga0157378_12004415
730 Ga0163162_10021524
731 Ga0157375_10207760
732 Ga0157375_10590005
733 Ga0157375_13632548
734 Ga0163163_10005422
735 Ga0163163_10151153
736 Ga0157380_10666642
737 Ga0157380_11599448
738 Ga0157380_13306021
739 Ga0157377_10068553
740 Ga0157377_10206938
741 Ga0206354_11600100
742 Ga0207688_10079756
743 Ga0207645_10007334
744 Ga0207684_11542830
745 Ga0207707_10325790
746 Ga0207660_10183922
747 Ga0207652_10412574
748 Ga0207652_10618062
749 Ga0207646_10076283
750 Ga0207646_11164469
751 Ga0207681_10186881
752 Ga0207681_10496153
753 Ga0207650_10130253
754 Ga0207650_10498555
755 Ga0207659_10012725
756 Ga0207659_10377410
757 Ga0207687_10923117
758 Ga0207700_10179737
759 Ga0207644_10500807
760 Ga0207690_11354447
761 Ga0207706_10023538
762 Ga0207706_10038506
763 Ga0207706_11270329
764 Ga0207669_10587882
765 Ga0207704_10091966
766 Ga0207704_10687664
767 Ga0207704_11308857
768 Ga0207704_11484098
769 Ga0207704_11726619
770 Ga0207691_10009739
771 Ga0207691_10204745
772 Ga0207691_11440421
773 Ga0207711_10098575
774 Ga0207689_10370281
775 Ga0207689_10637725
776 Ga0207689_10792714
777 Ga0207679_10989145
778 Ga0207651_10403673
779 Ga0207712_10636285
780 Ga0207712_11352615
781 Ga0207712_11903533
782 Ga0207668_10107446
783 Ga0207668_10165701
784 Ga0207668_10181663
785 Ga0207668_11064660
786 Ga0207640_10470653
787 Ga0207658_11746434
788 Ga0207703_10261361
789 Ga0207703_12294312
790 Ga0207678_11515781
791 Ga0207708_10022472
792 Ga0207708_10090269
793 Ga0207708_10125065
794 Ga0207708_10336798
795 Ga0207708_11341693
796 Ga0207708_11428354
797 Ga0207641_12419780
798 Ga0207648_10026344
799 Ga0207676_10008908
800 Ga0207675_100002118
801 Ga0207675_100070209
802 Ga0207675_100070446
803 Ga0207675_100337125
804 Ga0207675_102202539
805 Ga0207683_10018709
806 Ga0207683_10275843
807 Ga0207683_10283149
808 Ga0207683_10564634
809 Ga0209971_1028205
810 Ga0207428_10001318
811 Ga0207428_10034862
812 Ga0207428_11132782
813 Ga0268265_10286018
814 Ga0268265_11516130
815 Ga0307408_100034047
816 Ga0307408_100236002
817 Ga0307408_101222904
818 Ga0307408_101756386
819 Ga0307405_10193357
820 Ga0307405_10640971
821 Ga0307405_10832577
822 Ga0307405_11973478
823 Ga0307413_10216346
824 Ga0307413_10514082
825 Ga0307410_10105107
826 Ga0307410_10861662
827 Ga0307406_10051214
828 Ga0307406_10339659
829 Ga0307406_10571078
830 Ga0307406_11171258
831 Ga0307406_11385885
832 Ga0307407_10007607
833 Ga0307407_10096513
834 Ga0307412_10074948
835 Ga0307412_10079899
836 Ga0307412_11738130
837 Ga0307409_100357851
838 Ga0307409_100392981
839 Ga0307409_100494840
840 Ga0307409_100652587
841 Ga0307409_100687426
842 Ga0307409_100777630
843 Ga0307416_100156940
844 Ga0307416_100670799
845 Ga0307416_100985246
846 Ga0307414_11623808
847 Ga0307414_12291514
848 Ga0307411_10051362
849 Ga0307411_12349706
850 Ga0307415_100029497
851 Ga0307415_100913755
852 Ga0373940_0366863
853 Ga0373936_0086963
854 Ga0373939_0384008
855 Ga0373924_0168088
856 Ga0373935_0371061
857 Ga0373933_0079995
858 Ga0373937_0009383
859 Ga0395898_0516859
860 Ga0395901_1063948
861 Ga0439461_0041430
862 Ga0451802_0296826
863 Ga0451802_0383504
864 Ga0439433_0079985
865 Ga0439445_0087058
866 Ga0439449_0235040
867 Ga0439454_029677
868 Ga0439462_0135775
869 Ga0450923_083055
870 Ga0450890_021453
871 Ga0450896_008215
872 Ga0450896_089880
873 Ga0450910_097374
874 Ga0439446_0141046
875 Ga0439446_0343227
876 Ga0439435_0005934
877 Ga0439435_0099927
878 Ga0439464_0004739
879 Ga0439464_0026532
880 Ga0439464_0041974
881 Ga0439460_0047324
882 Ga0450893_0075455
883 Ga0451577_0016390
884 Ga0439440_0062497
885 Ga0453684_0045769
886 Ga0495638_0126966
887 Ga0495643_0335035
888 Ga0495586_0701970
889 Ga0495659_0291255
890 Ga0495588_0061673
891 Ga0496101_0914141
892 Ga0496101_1442083
893 Ga0496102_0381898
894 Ga0496102_0518586
895 Ga0496104_0070097
896 Ga0496105_0061140
897 Ga0496106_0082243
898 Ga0496107_0618062
899 Ga0496108_0632004
900 Ga0496109_0010970
901 Ga0496110_0014670
902 Ga0496111_0137211
903 Ga0496112_0003773
904 Ga0496112_1417615
905 Ga0501031_0167365
906 Ga0501031_0299417
907 Ga0501034_0020819
908 Ga0501034_0342913
909 Ga0501036_0025176
910 Ga0501036_0199558
911 Ga0501037_0373700
912 Ga0501038_0212890
913 Ga0501038_1122470
914 Ga0501040_0733808
915 Ga0501041_0029065
916 Ga0501041_0471858
917 Ga0501042_0200077
918 Ga0501043_1036901
919 Ga0501046_0202775
920 Ga0501047_0043660
921 Ga0501048_0052404
922 Ga0501048_0301120
923 Ga0501070_0135430
924 Ga0501070_0592776
925 Ga0501071_0180697
926 Ga0501071_0334054
927 Ga0501071_0969593
928 Ga0501072_1166029
929 Ga0501073_0112846
930 Ga0501073_0135616
931 Ga0501074_0404564
932 Ga0501074_0956011
933 Ga0501074_1042588
934 Ga0501074_1044185
935 Ga0501076_0036006
936 Ga0501077_0449557
937 Ga0501077_0532785
938 Ga0501208_011473
939 Ga0501217_152814
940 Ga0501235_192413
941 Ga0501246_018353
942 Ga0501260_031665
943 Ga0501225_0029681
944 Ga0501079_0015881
945 Ga0501079_0162812
946 Ga0501080_1013318
947 Ga0501081_0130846
948 Ga0501081_0178593
949 Ga0501081_0727294
950 Ga0501279_101824
951 Ga0501035_0172018
952 Ga0501035_0437815
953 Ga0501044_0004157
954 Ga0501045_0044873
955 Ga0501045_1417421
956 nmdc:mga05p37_1151578_c1
957 nmdc:mga05p37_161644_c1
958 nmdc:mga05p37_215053_c1
959 nmdc:mga05p37_218764_c1
960 nmdc:mga05p37_2745_c1
961 nmdc:mga05p37_3160_c1
962 nmdc:mga05p37_316997_c1
963 nmdc:mga05p37_489087_c1
964 nmdc:mga09592_1556004_c1
965 nmdc:mga09592_3132_c1
966 nmdc:mga09592_62696_c1
967 nmdc:mga09592_948_c2
968 nmdc:mga0qj67_1386713_c1
969 nmdc:mga0qj67_193124_c1
970 nmdc:mga0qj67_265409_c1
971 nmdc:mga0qj67_36349_c1
972 nmdc:mga0qj67_374894_c1
973 nmdc:mga0qj67_47405_c1
974 nmdc:mga0qj67_85273_c1
975 nmdc:mga06r32_118598_c1
976 nmdc:mga06r32_1505517_c1
977 nmdc:mga06r32_1683851_c1
978 nmdc:mga06r32_627911_c1
979 nmdc:mga06r32_7731_c1
980 nmdc:mga06r32_807594_c1
981 nmdc:mga06r32_83183_c1
982 nmdc:mga08y16_119453_c1
983 nmdc:mga08y16_1435634_c1
984 nmdc:mga08y16_282624_c1
985 nmdc:mga08y16_310806_c1
986 nmdc:mga08y16_404224_c1
987 nmdc:mga08y16_59133_c1
988 nmdc:mga08y16_61148_c1
989 nmdc:mga08y16_80621_c1
990 nmdc:mga0n895_1462197_c1
991 nmdc:mga0n895_25803_c1
992 nmdc:mga0n895_690237_c1
993 nmdc:mga0rr50_125917_c1
994 nmdc:mga08x19_3276_c1
995 nmdc:mga08x19_347789_c1
996 nmdc:mga08x19_496154_c1
997 nmdc:mga0a205_136424_c1
998 nmdc:mga0a205_17935_c1
999 Ga0495601_0036449
1000 Ga0495612_0087981
1001 Ga0500592_018391
1002 Ga0500628_161938
1003 Ga0501084_0072665
1004 Ga0501084_0130691
1005 Ga0501084_0747361
1006 Ga0590071_000040
1007 Ga0590074_004142
1008 Ga0590075_001075
1009 Ga0590077_001222
1010 Ga0590077_017145
1011 Ga0590077_029521
1012 Ga0501082_0438001
1013 Ga0501082_0653570
1014 Ga0501082_0695996
1015 Ga0501082_1885891
1016 Ga0530510_0008426

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uc8-assembly2.cif.gz_A n-terminal globular domain of the rsv nucleoprotein in complex with c- terminal phenylalanine of the phosphoprotein 0.474 51 97
8j62-assembly1.cif.gz_G cryo-em structure of apobec3g-vif complex 0.4475 3 66
8e40-assembly1.cif.gz_B full-length apobec3g in complex with hiv-1 vif, cbf-beta, and fork rna 0.4467 3 66
8h0i-assembly1.cif.gz_G cryo-em structure of apobec3g-vif complex 0.4439 3 66
3s2d-assembly1.cif.gz_B rna polymerase ii initiation complex with a 5-nt rna containing a 5br-u 0.4383 2 53
ID Description Score Start End Superfamily
af_K7M733_53_374_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.4774 37 69 2.130.10.10
2pphA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.4505 51 81 3.10.20.90
af_Q0D7D9_259_498_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4425 51 91 1.25.40.10
af_P18486_380_484_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.4391 34 99 3.90.1150.10
4g6tB00 Special;Helix non-globular;Arc Repressor Mutant, subunit A; 0.438 54 99 6.10.20.120
ID Description Score Start End GO Terms
AF-A0A2V8HBJ7-F1-model_v4 SpoVG family protein 0.9833 2 100
AF-A0A3N5YGT4-F1-model_v4 SpoVG family protein 0.9818 1 91
AF-A0A7W1DS03-F1-model_v4 Uncharacterized protein 0.9788 2 97
AF-A0A1F2T6M0-F1-model_v4 SpoVG family protein 0.9774 1 100
AF-A0A1F2RCQ4-F1-model_v4 SpoVG family protein 0.9769 2 100

Map