F456849

General Info

Members Datasets Scaffolds Average Seq Length
508 339 1017 117

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0022029|Ga0495603_0022029_367_774
Length 135
Sequence VQDHRERAENDTAEEHIMKYYLLSVMQPSGEPPAPEILKEIMHNLDVFHAELREAGAWVFAGGLHGPETATVVRAKDGDVLVTDGPYTESKEYLGGICLIKAPDLDAALAWGRKATVATTLPIEVRPFMGEAEDG

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
76 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
110 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
111 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
116 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
140 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
141 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
142 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
143 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
144 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
145 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
146 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
147 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
148 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
149 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
150 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
154 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
155 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
156 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
157 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
158 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
159 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
160 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
161 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
162 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
165 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
166 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
167 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
168 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
169 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
170 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
200 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
203 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
211 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
212 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
237 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
247 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
250 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
251 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
254 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
255 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
256 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
285 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
294 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
299 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
300 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
301 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
302 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
307 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
308 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
313 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
314 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
315 2643221647 Streptomyces sp. Root369 Isolate Unclassified
316 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
317 2643221714 Streptomyces sp. Root264 Isolate Unclassified
318 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
319 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
320 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
321 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
322 2867428634 Streptomyces sp. RP5T Isolate Unclassified
323 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
324 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
325 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
326 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
327 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
328 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
329 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
330 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
331 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
332 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
333 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
334 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
335 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
336 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
337 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
338 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
339 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.29
Metatranscriptomes 0.39
Isolates 5.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.54
Nodule 0
Rhizoplane 3.74
Rhizosphere 85.04
Stem 0
Stem Tuber 0.2
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0022029 3300046455 Bacteria 3858
2 JGI24739J22299_10102127 3300001989 Bacteria 865
3 rootH1_10017412 3300003316 Bacteria 2066
4 rootH2_10038119 3300003320 Bacteria 2066
5 rootH1_10013978 3300003316 Bacteria 13495
6 rootH1_10013978 3300003323 Bacteria 5217
7 JGI25407J50210_10016569 3300003373 Bacteria 1909
8 Ga0006562J51391_1099210 3300003578 Bacteria 3184
9 Ga0006562J51391_1099211 3300003578 Bacteria 3130
10 Ga0068869_101503772 3300005334 Bacteria 598
11 Ga0070682_100177781 3300005337 Bacteria 1484
12 Ga0070682_100298623 3300005337 Bacteria 1181
13 Ga0068868_100855468 3300005338 Bacteria 824
14 Ga0070668_100037476 3300005347 Bacteria 3702
15 Ga0070675_100895844 3300005354 Bacteria 813
16 Ga0070674_100257508 3300005356 Bacteria 1373
17 Ga0070659_100456110 3300005366 Bacteria 1085
18 Ga0070709_10158004 3300005434 Bacteria 1574
19 Ga0070713_100004846 3300005436 Bacteria 9117
20 Ga0070710_10175518 3300005437 Bacteria 1338
21 Ga0070711_100387189 3300005439 Bacteria 1132
22 Ga0070708_100204318 3300005445 Bacteria 1850
23 Ga0070708_101140897 3300005445 Bacteria 730
24 Ga0070663_101918773 3300005455 Bacteria 532
25 Ga0070678_100308191 3300005456 Bacteria 1348
26 Ga0070662_100019639 3300005457 Bacteria 4590
27 Ga0068867_100548977 3300005459 Bacteria 1001
28 Ga0068867_101169348 3300005459 Bacteria 705
29 Ga0070706_100347566 3300005467 Bacteria 1382
30 Ga0070707_100115448 3300005468 Bacteria 2605
31 Ga0070698_100038711 3300005471 Bacteria 4912
32 Ga0070699_100027133 3300005518 Bacteria 4939
33 Ga0070699_100129269 3300005518 Bacteria 2226
34 Ga0070697_100155216 3300005536 Bacteria 1932
35 Ga0068853_100602633 3300005539 Bacteria 1043
36 Ga0070672_100707842 3300005543 Bacteria 882
37 Ga0070665_102474609 3300005548 Bacteria 521
38 Ga0068857_102399093 3300005577 Bacteria 518
39 Ga0068854_100254610 3300005578 Bacteria 1403
40 Ga0068856_100013658 3300005614 Bacteria 7854
41 Ga0068856_101041968 3300005614 Bacteria 836
42 Ga0068861_100056502 3300005719 Bacteria 2996
43 Ga0068863_100057755 3300005841 Bacteria 3672
44 Ga0081455_10035816 3300005937 Bacteria 4428
45 Ga0081455_10078671 3300005937 Bacteria 2709
46 Ga0081455_10193502 3300005937 Bacteria 1529
47 Ga0081538_10004615 3300005981 Bacteria 12649
48 Ga0081538_10005153 3300005981 Bacteria 11844
49 Ga0070717_10077173 3300006028 Bacteria 2789
50 Ga0070717_10216182 3300006028 Bacteria 1683
51 Ga0070717_10692803 3300006028 Bacteria 926
52 Ga0075365_10127383 3300006038 Bacteria 1760
53 Ga0075363_100601123 3300006048 Bacteria 659
54 Ga0070716_100049171 3300006173 Bacteria 2388
55 Ga0070712_100461188 3300006175 Bacteria 1060
56 Ga0070712_101378438 3300006175 Bacteria 615
57 Ga0075367_10018224 3300006178 Bacteria 3870
58 Ga0097621_100482062 3300006237 Bacteria 1121
59 Ga0075370_10592800 3300006353 Bacteria 671
60 Ga0068871_100262380 3300006358 Bacteria 1507
61 Ga0075428_100239673 3300006844 Bacteria 1957
62 Ga0075431_100918071 3300006847 Bacteria 845
63 Ga0075433_10984409 3300006852 Bacteria 735
64 Ga0075434_100007864 3300006871 Bacteria 9879
65 Ga0075436_100031629 3300006914 Bacteria 3645
66 Ga0075435_100055767 3300007076 Bacteria 3192
67 Ga0105244_10195760 3300009036 Bacteria 954
68 Ga0111539_11893190 3300009094 Bacteria 692
69 Ga0111539_12499442 3300009094 Bacteria 599
70 Ga0105245_10338143 3300009098 Bacteria 1488
71 Ga0114129_10321454 3300009147 Bacteria 2057
72 Ga0114129_11488104 3300009147 Bacteria 832
73 Ga0105243_11239077 3300009148 Bacteria 761
74 Ga0105242_10028053 3300009176 Bacteria 4478
75 Ga0105238_11023940 3300009551 Bacteria 847
76 Ga0105249_10386907 3300009553 Bacteria 1426
77 Ga0105249_10765290 3300009553 Bacteria 1028
78 Ga0105239_10263309 3300010375 Bacteria 1938
79 Ga0105239_10570160 3300010375 Bacteria 1290
80 Ga0105239_11338508 3300010375 Bacteria 826
81 Ga0105239_12688446 3300010375 Bacteria 581
82 Ga0105239_12809640 3300010375 Bacteria 568
83 Ga0105246_10232772 3300011119 Bacteria 1452
84 Ga0163162_12039391 3300013306 Bacteria 658
85 Ga0163162_12352968 3300013306 Bacteria 612
86 Ga0157372_10198762 3300013307 Bacteria 2322
87 Ga0157372_10479546 3300013307 Bacteria 1450
88 Ga0157372_10934676 3300013307 Bacteria 1005
89 Ga0157375_10634075 3300013308 Bacteria 1226
90 Ga0163163_10116527 3300014325 Bacteria 2703
91 Ga0163163_11589214 3300014325 Bacteria 715
92 Ga0182008_10003877 3300014497 Bacteria 8880
93 Ga0157376_10197502 3300014969 Bacteria 1849
94 Ga0157376_10201058 3300014969 Bacteria 1833
95 Ga0182006_1111213 3300015261 Bacteria 961
96 Ga0182007_10003924 3300015262 Bacteria 6888
97 Ga0163161_10835440 3300017792 Bacteria 776
98 Ga0213872_10437004 3300021361 Bacteria 527
99 Ga0213875_10160957 3300021388 Bacteria 1053
100 Ga0224569_104718 3300022732 Bacteria 1023
101 Ga0224572_1005447 3300024225 Bacteria 2269
102 Ga0209758_1004515 3300025297 Bacteria 11533
103 Ga0207426_1019752 3300025302 Bacteria 2351
104 Ga0207692_10130482 3300025898 Bacteria 1419
105 Ga0207688_10124300 3300025901 Bacteria 1508
106 Ga0207647_10016756 3300025904 Bacteria 4993
107 Ga0207699_10038652 3300025906 Bacteria 2737
108 Ga0207684_10049126 3300025910 Bacteria 3579
109 Ga0207693_10030865 3300025915 Bacteria 4233
110 Ga0207663_10092313 3300025916 Bacteria 2012
111 Ga0207646_10120846 3300025922 Bacteria 2353
112 Ga0207646_10163897 3300025922 Bacteria 2006
113 Ga0207681_10406438 3300025923 Bacteria 1101
114 Ga0207700_10013875 3300025928 Bacteria 5262
115 Ga0207664_10126724 3300025929 Bacteria 2144
116 Ga0207706_10056121 3300025933 Bacteria 3473
117 Ga0207686_11195857 3300025934 Bacteria 622
118 Ga0207709_10661242 3300025935 Bacteria 833
119 Ga0207669_11004360 3300025937 Bacteria 701
120 Ga0207691_10673417 3300025940 Bacteria 873
121 Ga0207689_10616453 3300025942 Bacteria 913
122 Ga0207712_10145829 3300025961 Bacteria 1822
123 Ga0207658_10287730 3300025986 Bacteria 1411
124 Ga0207677_10587681 3300026023 Bacteria 975
125 Ga0207703_11944783 3300026035 Bacteria 564
126 Ga0207639_10687345 3300026041 Bacteria 949
127 Ga0207702_10018013 3300026078 Bacteria 5846
128 Ga0207702_10933084 3300026078 Bacteria 860
129 Ga0207641_10139427 3300026088 Bacteria 2186
130 Ga0207648_11020428 3300026089 Bacteria 775
131 Ga0207675_100001895 3300026118 Bacteria 20915
132 Ga0207683_10132190 3300026121 Bacteria 2245
133 Ga0209371_1068449 3300027312 Bacteria 636
134 Ga0209371_1082033 3300027312 Bacteria 555
135 Ga0307517_10541297 3300028786 Bacteria 584
136 Ga0307515_10122650 3300028794 Bacteria 2929
137 Ga0307515_10754592 3300028794 Bacteria 592
138 Ga0268256_1076182 3300030500 Bacteria 636
139 Ga0268256_1077246 3300030500 Bacteria 630
140 Ga0268256_1080452 3300030500 Bacteria 611
141 Ga0268256_1090996 3300030500 Bacteria 555
142 Ga0307511_10043746 3300030521 Bacteria 3734
143 Ga0307512_10024305 3300030522 Bacteria 5394
144 Ga0307513_10289971 3300031456 Bacteria 1408
145 Ga0307513_10339719 3300031456 Bacteria 1253
146 Ga0307513_10522923 3300031456 Bacteria 901
147 Ga0307408_100135820 3300031548 Bacteria 1924
148 Ga0307408_100303064 3300031548 Bacteria 1339
149 Ga0307508_10019597 3300031616 Bacteria 6149
150 Ga0307514_10025281 3300031649 Bacteria 4803
151 Ga0316576_10207993 3300031727 Bacteria 1473
152 Ga0307516_10563608 3300031730 Bacteria 793
153 Ga0307405_10048313 3300031731 Bacteria 2623
154 Ga0307413_10044731 3300031824 Bacteria 2619
155 Ga0307518_10176066 3300031838 Bacteria 1452
156 Ga0307410_10226393 3300031852 Bacteria 1441
157 Ga0307410_10333200 3300031852 Bacteria 1207
158 Ga0307406_10006439 3300031901 Bacteria 6482
159 Ga0307406_10091863 3300031901 Bacteria 2045
160 Ga0307407_10004384 3300031903 Bacteria 5981
161 Ga0307407_10184134 3300031903 Bacteria 1386
162 Ga0307407_10454929 3300031903 Bacteria 930
163 Ga0307412_10160548 3300031911 Bacteria 1669
164 Ga0307412_10281029 3300031911 Bacteria 1307
165 Ga0307412_10794354 3300031911 Bacteria 821
166 Ga0307409_100044043 3300031995 Bacteria 3357
167 Ga0307409_100191793 3300031995 Bacteria 1819
168 Ga0307409_101454448 3300031995 Bacteria 712
169 Ga0307416_100050003 3300032002 Bacteria 3329
170 Ga0307416_100065431 3300032002 Bacteria 2987
171 Ga0307414_10046620 3300032004 Bacteria 2977
172 Ga0307415_100027056 3300032126 Bacteria 3628
173 Ga0307415_100056482 3300032126 Bacteria 2691
174 Ga0307415_100373422 3300032126 Bacteria 1208
175 Ga0373931_0389542 3300035691 Bacteria 880
176 Ga0373935_0681869 3300035692 Bacteria 755
177 Ga0373927_0678721 3300035695 Bacteria 681
178 Ga0316582_0157743 3300036647 Bacteria 1536
179 Ga0316584_0133187 3300036712 Bacteria 1856
180 Ga0395900_0199746 3300037418 Bacteria 2024
181 Ga0395900_0304816 3300037418 Bacteria 1578
182 Ga0395898_0086494 3300037466 Bacteria 3021
183 Ga0395898_0095792 3300037466 Bacteria 2851
184 Ga0395898_0815817 3300037466 Bacteria 873
185 Ga0436364_0120581 3300037853 Bacteria 911
186 Ga0436364_1221416 3300037853 Bacteria 1596
187 Ga0436364_1477777 3300037853 Bacteria 1271
188 Ga0395901_0106089 3300038443 Bacteria 2949
189 Ga0395901_0376347 3300038443 Bacteria 1462
190 Ga0436361_0918201 3300039447 Bacteria 1153
191 Ga0451787_695620 3300041441 Bacteria 2213
192 Ga0451789_0718013 3300041443 Bacteria 3526
193 Ga0451791_1787661 3300041451 Bacteria 7517
194 Ga0451793_0607380 3300041452 Bacteria 10788
195 Ga0451797_0561658 3300041453 Bacteria 6908
196 Ga0451797_0870456 3300041453 Bacteria 1155
197 Ga0451795_0617636 3300041456 Bacteria 3272
198 Ga0451800_1171825 3300041459 Bacteria 680
199 Ga0451802_0591508 3300041460 Bacteria 1174
200 Ga0451837_0293854 3300041494 Bacteria 724
201 Ga0451839_0636022 3300041496 Bacteria 800
202 Ga0451841_0832554 3300041498 Bacteria 2272
203 Ga0451849_1042011 3300041505 Bacteria 795
204 Ga0451853_0066073 3300041512 Bacteria 837
205 Ga0451853_1720011 3300041512 Bacteria 3789
206 Ga0451853_1784110 3300041512 Bacteria 2084
207 Ga0451853_3716943 3300041512 Bacteria 1108
208 Ga0439448_0000439 3300042005 Bacteria 9561
209 Ga0439448_0229616 3300042005 Bacteria 653
210 Ga0439449_0282166 3300042007 Bacteria 626
211 Ga0439450_008504 3300042008 Bacteria 1917
212 Ga0439450_099645 3300042008 Bacteria 736
213 Ga0439451_013624 3300042009 Bacteria 1643
214 Ga0439454_000293 3300042011 Bacteria 3698
215 Ga0439455_0031565 3300042012 Bacteria 1319
216 Ga0439463_001394 3300042016 Bacteria 6425
217 Ga0450913_016788 3300042117 Bacteria 642
218 Ga0450900_002519 3300042136 Bacteria 1951
219 Ga0450903_000118 3300042138 Bacteria 17039
220 Ga0450905_015003 3300042142 Bacteria 1108
221 Ga0439458_0008181 3300042157 Bacteria 2324
222 Ga0439458_0057408 3300042157 Bacteria 968
223 Ga0439458_0123007 3300042157 Bacteria 684
224 Ga0439458_0163711 3300042157 Bacteria 599
225 Ga0439444_0000868 3300042437 Bacteria 3672
226 Ga0439464_0000097 3300042439 Bacteria 12959
227 Ga0439460_0000221 3300042461 Bacteria 11405
228 Ga0450916_000141 3300042530 Bacteria 5045
229 Ga0450918_117998 3300042531 Unclassified 529
230 Ga0450901_004995 3300042533 Bacteria 1364
231 Ga0439440_0000634 3300042993 Bacteria 5978
232 Ga0466972_0025928 3300044658 Bacteria 2904
233 Ga0466972_0051606 3300044658 Bacteria 1983
234 Ga0466972_0599611 3300044658 Bacteria 521
235 Ga0466965_0007140 3300044683 Bacteria 5115
236 Ga0466965_0197207 3300044683 Bacteria 1067
237 Ga0466965_0228106 3300044683 Bacteria 994
238 Ga0466965_0490318 3300044683 Bacteria 688
239 Ga0466966_0001620 3300044684 Bacteria 14498
240 Ga0466966_0311992 3300044684 Bacteria 945
241 Ga0466961_0000576 3300044693 Bacteria 23314
242 Ga0466963_0000279 3300044694 Bacteria 22827
243 Ga0466963_0064279 3300044694 Bacteria 2458
244 Ga0466963_0549202 3300044694 Bacteria 816
245 Ga0466964_0021210 3300044706 Bacteria 2511
246 Ga0466964_0515706 3300044706 Bacteria 644
247 Ga0466971_0008676 3300044719 Bacteria 4434
248 Ga0466971_0156006 3300044719 Bacteria 1067
249 Ga0466971_0194583 3300044719 Bacteria 956
250 Ga0466971_0475015 3300044719 Bacteria 615
251 Ga0466970_0000264 3300044765 Bacteria 25682
252 Ga0466970_0152180 3300044765 Bacteria 1277
253 Ga0466957_0001635 3300044842 Bacteria 11755
254 Ga0466957_0151991 3300044842 Bacteria 1498
255 Ga0466957_0524305 3300044842 Bacteria 823
256 Ga0466960_0003858 3300044901 Bacteria 5812
257 Ga0466960_0016178 3300044901 Bacteria 3230
258 Ga0466960_0071931 3300044901 Bacteria 1723
259 Ga0466959_0000297 3300045049 Bacteria 29628
260 Ga0466959_1090564 3300045049 Bacteria 531
261 Ga0466958_0000301 3300045836 Bacteria 19375
262 Ga0466958_0388913 3300045836 Bacteria 900
263 Ga0466958_0517308 3300045836 Bacteria 775
264 Ga0466958_0576517 3300045836 Bacteria 731
265 Ga0466967_0005722 3300045976 Bacteria 8672
266 Ga0466967_0020060 3300045976 Bacteria 5392
267 Ga0466967_0361546 3300045976 Bacteria 1406
268 Ga0495627_170662 3300046453 Bacteria 604
269 Ga0495592_0023206 3300046454 Bacteria 4719
270 Ga0495603_0008900 3300046455 Bacteria 6070
271 Ga0495603_0012917 3300046455 Bacteria 5049
272 Ga0495603_0038090 3300046455 Bacteria 2884
273 Ga0495603_0073632 3300046455 Bacteria 2006
274 Ga0495590_0303031 3300046457 Bacteria 601
275 Ga0495629_0001825 3300046459 Bacteria 16672
276 Ga0495629_0007040 3300046459 Bacteria 8289
277 Ga0495629_0011281 3300046459 Bacteria 6492
278 Ga0495629_0210165 3300046459 Bacteria 1344
279 Ga0495629_0572924 3300046459 Bacteria 756
280 Ga0495638_0184503 3300046460 Bacteria 1188
281 Ga0495638_0481260 3300046460 Bacteria 629
282 Ga0495651_0106971 3300046462 Bacteria 2073
283 Ga0495580_0108850 3300046472 Bacteria 1924
284 Ga0495605_0021885 3300046474 Bacteria 3381
285 Ga0495639_0045648 3300046475 Bacteria 1983
286 Ga0495639_0089641 3300046475 Bacteria 1441
287 Ga0495662_0008499 3300046476 Bacteria 5047
288 Ga0495662_0016831 3300046476 Bacteria 3538
289 Ga0495662_0143538 3300046476 Bacteria 1175
290 Ga0495584_0045161 3300046491 Bacteria 2223
291 Ga0495585_0101441 3300046492 Bacteria 1538
292 Ga0495585_0549400 3300046492 Bacteria 546
293 Ga0495594_0000264 3300046499 Bacteria 25699
294 Ga0495594_0006025 3300046499 Bacteria 6224
295 Ga0495594_0033350 3300046499 Bacteria 2799
296 Ga0495594_0033608 3300046499 Bacteria 2789
297 Ga0495594_0116513 3300046499 Bacteria 1509
298 Ga0495594_0502333 3300046499 Bacteria 689
299 Ga0495596_0047246 3300046500 Bacteria 1689
300 Ga0495596_0297672 3300046500 Bacteria 627
301 Ga0495607_0061860 3300046501 Bacteria 2126
302 Ga0495583_0070524 3300046506 Bacteria 1536
303 Ga0495606_0016828 3300046507 Bacteria 5556
304 Ga0495606_0041110 3300046507 Bacteria 3102
305 Ga0495608_0081009 3300046511 Bacteria 2110
306 Ga0495610_0130162 3300046512 Bacteria 1093
307 Ga0495616_0006312 3300046513 Bacteria 7192
308 Ga0495616_0095709 3300046513 Bacteria 1399
309 Ga0495618_0170438 3300046514 Bacteria 1385
310 Ga0495620_0006444 3300046515 Bacteria 6450
311 Ga0495620_0046956 3300046515 Bacteria 1861
312 Ga0495628_0162003 3300046516 Bacteria 1699
313 Ga0495628_0356943 3300046516 Bacteria 1074
314 Ga0495630_0195569 3300046517 Bacteria 1543
315 Ga0495631_0004619 3300046518 Bacteria 7291
316 Ga0495632_0160510 3300046519 Bacteria 1036
317 Ga0495637_0357885 3300046520 Bacteria 511
318 Ga0495643_0004948 3300046522 Bacteria 9148
319 Ga0495644_0246315 3300046523 Bacteria 694
320 Ga0495666_0036450 3300046526 Bacteria 2395
321 Ga0495642_0271634 3300046528 Bacteria 742
322 Ga0495642_0299729 3300046528 Bacteria 704
323 Ga0495640_0012887 3300046533 Bacteria 6376
324 Ga0495640_0519965 3300046533 Bacteria 723
325 Ga0495586_0620631 3300046535 Bacteria 625
326 Ga0495598_0018599 3300046537 Bacteria 1809
327 Ga0495621_0235943 3300046539 Bacteria 744
328 Ga0495597_0042082 3300046542 Bacteria 2038
329 Ga0495597_0300677 3300046542 Bacteria 622
330 Ga0495645_0057186 3300046543 Bacteria 2832
331 Ga0495622_0008412 3300046557 Bacteria 4777
332 Ga0495622_0013090 3300046557 Bacteria 3850
333 Ga0495622_0164253 3300046557 Bacteria 1000
334 Ga0495622_0287158 3300046557 Bacteria 718
335 Ga0495667_0131401 3300046559 Bacteria 1615
336 Ga0495656_0102564 3300046615 Bacteria 1325
337 Ga0495668_0085807 3300046616 Bacteria 1726
338 Ga0495668_0535089 3300046616 Bacteria 646
339 Ga0495668_0662354 3300046616 Bacteria 577
340 Ga0495634_0210150 3300046642 Bacteria 1205
341 Ga0495634_0406066 3300046642 Bacteria 808
342 Ga0495611_0210731 3300046648 Bacteria 905
343 Ga0495611_0314860 3300046648 Bacteria 720
344 Ga0495625_0175775 3300046660 Bacteria 1427
345 Ga0495625_0299923 3300046660 Bacteria 1028
346 Ga0495635_0118535 3300046663 Bacteria 1806
347 Ga0495635_0121432 3300046663 Bacteria 1782
348 Ga0495661_0107363 3300046665 Bacteria 1561
349 Ga0495661_0394724 3300046665 Bacteria 674
350 Ga0495588_0007433 3300046674 Bacteria 4985
351 Ga0495588_0027287 3300046674 Bacteria 2854
352 Ga0495588_0101194 3300046674 Bacteria 1514
353 Ga0495588_0131160 3300046674 Bacteria 1322
354 Ga0495657_0028365 3300046675 Bacteria 3939
355 Ga0495657_0041760 3300046675 Bacteria 3136
356 Ga0495657_0049965 3300046675 Bacteria 2815
357 Ga0495623_0223603 3300046679 Bacteria 1071
358 Ga0495613_0049346 3300046689 Bacteria 3106
359 Ga0495613_0068326 3300046689 Bacteria 2591
360 Ga0495613_0166952 3300046689 Bacteria 1563
361 Ga0495624_0081680 3300046690 Bacteria 2001
362 Ga0495670_0545800 3300046691 Bacteria 631
363 Ga0495671_0426617 3300046692 Bacteria 634
364 Ga0495589_0007416 3300046794 Bacteria 5744
365 Ga0495589_0060406 3300046794 Bacteria 1862
366 Ga0495589_0078629 3300046794 Bacteria 1605
367 Ga0495589_0235709 3300046794 Bacteria 857
368 Ga0495589_0322644 3300046794 Bacteria 713
369 Ga0495600_0698891 3300046809 Bacteria 610
370 Ga0495660_0046759 3300046810 Bacteria 2372
371 Ga0495660_0077611 3300046810 Bacteria 1747
372 Ga0495581_0144325 3300047315 Bacteria 1389
373 Ga0495581_0261724 3300047315 Bacteria 1011
374 Ga0495581_0277723 3300047315 Bacteria 979
375 Ga0495604_0099689 3300047317 Bacteria 2137
376 Ga0495636_0003082 3300047318 Bacteria 6463
377 Ga0495636_0013863 3300047318 Bacteria 3201
378 Ga0495636_0029571 3300047318 Bacteria 2237
379 Ga0495636_0233753 3300047318 Bacteria 846
380 Ga0495636_0590462 3300047318 Bacteria 542
381 Ga0495672_0068569 3300047320 Bacteria 2016
382 Ga0495676_0002693 3300047321 Bacteria 15921
383 Ga0495676_0003492 3300047321 Bacteria 14228
384 Ga0495680_0817039 3300047322 Bacteria 608
385 Ga0495683_0046595 3300047323 Bacteria 2175
386 Ga0495687_000773 3300047443 Bacteria 34590
387 Ga0495687_060793 3300047443 Bacteria 1556
388 Ga0495687_138353 3300047443 Bacteria 851
389 Ga0495687_182469 3300047443 Bacteria 683
390 Ga0495687_259932 3300047443 Bacteria 513
391 Ga0495675_0027464 3300047444 Bacteria 3626
392 Ga0495675_0570755 3300047444 Bacteria 644
393 Ga0495675_0799434 3300047444 Bacteria 522
394 Ga0495677_0045222 3300047445 Bacteria 1615
395 Ga0495685_004164 3300047447 Bacteria 4656
396 Ga0495685_023936 3300047447 Bacteria 2102
397 Ga0495685_078769 3300047447 Bacteria 1098
398 Ga0495681_0122978 3300047470 Bacteria 1112
399 Ga0495681_0311777 3300047470 Bacteria 606
400 Ga0495686_0518939 3300047472 Bacteria 625
401 Ga0495593_0054396 3300047673 Bacteria 2110
402 Ga0495593_0090258 3300047673 Bacteria 1578
403 Ga0495593_0120987 3300047673 Bacteria 1332
404 Ga0495593_0254863 3300047673 Bacteria 878
405 Ga0495614_0000342 3300048089 Bacteria 18503
406 Ga0495614_0065044 3300048089 Bacteria 1568
407 Ga0495615_0189496 3300048090 Bacteria 630
408 Ga0495626_0160351 3300048091 Bacteria 943
409 Ga0496101_1016322 3300048904 Bacteria 652
410 Ga0496104_1671719 3300048907 Bacteria 539
411 Ga0496105_1137662 3300048908 Bacteria 578
412 Ga0496106_0167848 3300048909 Bacteria 1738
413 Ga0496107_0238670 3300048910 Bacteria 1353
414 Ga0496109_0169826 3300048912 Bacteria 2046
415 Ga0496109_1831862 3300048912 Bacteria 540
416 Ga0496110_1342650 3300048913 Bacteria 624
417 Ga0496114_0994897 3300048917 Bacteria 722
418 Ga0496115_0132763 3300048918 Bacteria 2052
419 Ga0496126_0656168 3300048929 Bacteria 820
420 Ga0501031_0058818 3300049568 Bacteria 2505
421 Ga0501031_0068667 3300049568 Bacteria 2309
422 Ga0501032_0006359 3300049569 Bacteria 8706
423 Ga0501033_0296903 3300049570 Bacteria 1138
424 Ga0501034_0022499 3300049571 Bacteria 6423
425 Ga0501034_0386060 3300049571 Bacteria 1325
426 Ga0501034_1248953 3300049571 Bacteria 621
427 Ga0501034_1352257 3300049571 Bacteria 588
428 Ga0501036_0123945 3300049572 Bacteria 2182
429 Ga0501036_0169353 3300049572 Bacteria 1840
430 Ga0501037_0000929 3300049573 Bacteria 21761
431 Ga0501038_0015918 3300049574 Bacteria 6834
432 Ga0501038_0033205 3300049574 Bacteria 4546
433 Ga0501039_0089342 3300049575 Bacteria 2401
434 Ga0501041_0117756 3300049577 Bacteria 1650
435 Ga0501042_0099837 3300049578 Bacteria 2086
436 Ga0501043_0005804 3300049579 Bacteria 9933
437 Ga0501043_0034296 3300049579 Bacteria 3992
438 Ga0501047_0051408 3300049581 Bacteria 3982
439 Ga0501069_0141013 3300049585 Bacteria 1382
440 Ga0501069_0805174 3300049585 Bacteria 569
441 Ga0501070_0016848 3300049586 Bacteria 6133
442 Ga0501074_0001291 3300049590 Bacteria 16615
443 Ga0501075_0045749 3300049591 Bacteria 3286
444 Ga0501076_0496045 3300049592 Bacteria 1006
445 Ga0501202_078503 3300049652 Bacteria 772
446 Ga0501257_120800 3300049686 Bacteria 701
447 Ga0501079_0128578 3300049741 Bacteria 1971
448 Ga0501080_0017499 3300049742 Bacteria 6629
449 Ga0501081_0219486 3300049743 Bacteria 1382
450 Ga0501083_0258784 3300049744 Bacteria 1132
451 Ga0501035_0199425 3300049822 Bacteria 1717
452 Ga0501035_0207644 3300049822 Bacteria 1677
453 Ga0501044_0036285 3300049823 Bacteria 5158
454 Ga0501044_0058789 3300049823 Bacteria 3941
455 Ga0501045_0053445 3300049824 Bacteria 2951
456 nmdc:mga03n38_489698_c1 3300050490 Bacteria 689
457 nmdc:mga03n38_499982_c1 3300050490 Bacteria 682
458 nmdc:mga0yw44_20169_c1 3300050492 Bacteria 3693
459 nmdc:mga0yw44_239985_c1 3300050492 Bacteria 1204
460 nmdc:mga06z11_28789_c1 3300050494 Bacteria 2669
461 nmdc:mga07m45_445395_c1 3300050496 Bacteria 751
462 nmdc:mga07m45_698379_c1 3300050496 Bacteria 583
463 nmdc:mga05p37_1347799_c1 3300050507 Bacteria 723
464 nmdc:mga06r32_657988_c1 3300050510 Bacteria 1015
465 nmdc:mga0n895_39248_c1 3300050512 Bacteria 4593
466 nmdc:mga0rr50_34206_c1 3300050513 Bacteria 3638
467 nmdc:mga08x19_138579_c1 3300050514 Bacteria 1642
468 nmdc:mga0a205_122598_c1 3300050515 Bacteria 2499
469 Ga0495601_0343722 3300053077 Bacteria 970
470 Ga0495595_0193889 3300053084 Bacteria 1010
471 Ga0495619_0902395 3300053085 Unclassified 594
472 Ga0500560_015750 3300053107 Bacteria 2048
473 Ga0500573_0085915 3300053140 Bacteria 1783
474 Ga0500600_0089905 3300053149 Bacteria 1642
475 Ga0500600_0179844 3300053149 Bacteria 1019
476 Ga0500600_0222938 3300053149 Bacteria 868
477 Ga0501084_0048328 3300054114 Bacteria 3562
478 Ga0501082_0169235 3300060353 Bacteria 1899
479 Ga0466962_0004101 3300061719 Bacteria 6977
480 Ga0466962_0093076 3300061719 Bacteria 1445
481 Ga0530510_0038253 3300061734 Bacteria 3464
482 Ga0530510_0359879 3300061734 Bacteria 1094
483 2585305981 2582581313 Bacteria 10042643
484 2616693723 2616644814 Bacteria 11555299
485 2644265157 2643221647 Bacteria 10741251
486 2644441827 2643221678 Bacteria 9540101
487 2644630790 2643221714 Bacteria 9015452
488 2785366258 2784746768 Bacteria 10036182
489 2786667227 2786546132 Bacteria 10419719
490 2808846846 2808606359 Bacteria 9866990
491 2862282395 2862281513 Bacteria 9621493
492 2867431924 2867428634 Bacteria 9590268
493 2877684259 2877676314 Bacteria 9512378
494 2899371149 2899370129 Bacteria 6781179
495 2919473867 2919468124 Bacteria 9133025
496 2946073027 2946072368 Bacteria 8999607
497 2954389590 2954380949 Bacteria 10050426
498 2954682315 2954673503 Bacteria 9685905
499 2954690609 2954682443 Bacteria 9862841
500 2954700437 2954691527 Bacteria 10720516
501 2954701791 2954701450 Bacteria 10834262
502 2954719113 2954711539 Bacteria 10867210
503 2954729083 2954721474 Bacteria 10456478
504 2954732728 2954731030 Bacteria 10243860
505 2954747982 2954740390 Bacteria 10229294
506 2954751606 2954749733 Bacteria 10366972
507 2954767107 2954759201 Bacteria 9358192
508 8008581409 8008574985 Bacteria 7815457
509 8056830994 8056829672 Bacteria 9045328
510 Ga0495603_0022029
511 JGI24739J22299_10102127
512 rootH1_10017412
513 rootH2_10038119
514 rootH1_10013978
515 JGI25407J50210_10016569
516 Ga0006562J51391_1099210
517 Ga0006562J51391_1099211
518 Ga0068869_101503772
519 Ga0070682_100177781
520 Ga0070682_100298623
521 Ga0068868_100855468
522 Ga0070668_100037476
523 Ga0070675_100895844
524 Ga0070674_100257508
525 Ga0070659_100456110
526 Ga0070709_10158004
527 Ga0070713_100004846
528 Ga0070710_10175518
529 Ga0070711_100387189
530 Ga0070708_100204318
531 Ga0070708_101140897
532 Ga0070663_101918773
533 Ga0070678_100308191
534 Ga0070662_100019639
535 Ga0068867_100548977
536 Ga0068867_101169348
537 Ga0070706_100347566
538 Ga0070707_100115448
539 Ga0070698_100038711
540 Ga0070699_100027133
541 Ga0070699_100129269
542 Ga0070697_100155216
543 Ga0068853_100602633
544 Ga0070672_100707842
545 Ga0070665_102474609
546 Ga0068857_102399093
547 Ga0068854_100254610
548 Ga0068856_100013658
549 Ga0068856_101041968
550 Ga0068861_100056502
551 Ga0068863_100057755
552 Ga0081455_10035816
553 Ga0081455_10078671
554 Ga0081455_10193502
555 Ga0081538_10004615
556 Ga0081538_10005153
557 Ga0070717_10077173
558 Ga0070717_10216182
559 Ga0070717_10692803
560 Ga0075365_10127383
561 Ga0075363_100601123
562 Ga0070716_100049171
563 Ga0070712_100461188
564 Ga0070712_101378438
565 Ga0075367_10018224
566 Ga0097621_100482062
567 Ga0075370_10592800
568 Ga0068871_100262380
569 Ga0075428_100239673
570 Ga0075431_100918071
571 Ga0075433_10984409
572 Ga0075434_100007864
573 Ga0075436_100031629
574 Ga0075435_100055767
575 Ga0105244_10195760
576 Ga0111539_11893190
577 Ga0111539_12499442
578 Ga0105245_10338143
579 Ga0114129_10321454
580 Ga0114129_11488104
581 Ga0105243_11239077
582 Ga0105242_10028053
583 Ga0105238_11023940
584 Ga0105249_10386907
585 Ga0105249_10765290
586 Ga0105239_10263309
587 Ga0105239_10570160
588 Ga0105239_11338508
589 Ga0105239_12688446
590 Ga0105239_12809640
591 Ga0105246_10232772
592 Ga0163162_12039391
593 Ga0163162_12352968
594 Ga0157372_10198762
595 Ga0157372_10479546
596 Ga0157372_10934676
597 Ga0157375_10634075
598 Ga0163163_10116527
599 Ga0163163_11589214
600 Ga0182008_10003877
601 Ga0157376_10197502
602 Ga0157376_10201058
603 Ga0182006_1111213
604 Ga0182007_10003924
605 Ga0163161_10835440
606 Ga0213872_10437004
607 Ga0213875_10160957
608 Ga0224569_104718
609 Ga0224572_1005447
610 Ga0209758_1004515
611 Ga0207426_1019752
612 Ga0207692_10130482
613 Ga0207688_10124300
614 Ga0207647_10016756
615 Ga0207699_10038652
616 Ga0207684_10049126
617 Ga0207693_10030865
618 Ga0207663_10092313
619 Ga0207646_10120846
620 Ga0207646_10163897
621 Ga0207681_10406438
622 Ga0207700_10013875
623 Ga0207664_10126724
624 Ga0207706_10056121
625 Ga0207686_11195857
626 Ga0207709_10661242
627 Ga0207669_11004360
628 Ga0207691_10673417
629 Ga0207689_10616453
630 Ga0207712_10145829
631 Ga0207658_10287730
632 Ga0207677_10587681
633 Ga0207703_11944783
634 Ga0207639_10687345
635 Ga0207702_10018013
636 Ga0207702_10933084
637 Ga0207641_10139427
638 Ga0207648_11020428
639 Ga0207675_100001895
640 Ga0207683_10132190
641 Ga0209371_1068449
642 Ga0209371_1082033
643 Ga0307517_10541297
644 Ga0307515_10122650
645 Ga0307515_10754592
646 Ga0268256_1076182
647 Ga0268256_1077246
648 Ga0268256_1080452
649 Ga0268256_1090996
650 Ga0307511_10043746
651 Ga0307512_10024305
652 Ga0307513_10289971
653 Ga0307513_10339719
654 Ga0307513_10522923
655 Ga0307408_100135820
656 Ga0307408_100303064
657 Ga0307508_10019597
658 Ga0307514_10025281
659 Ga0316576_10207993
660 Ga0307516_10563608
661 Ga0307405_10048313
662 Ga0307413_10044731
663 Ga0307518_10176066
664 Ga0307410_10226393
665 Ga0307410_10333200
666 Ga0307406_10006439
667 Ga0307406_10091863
668 Ga0307407_10004384
669 Ga0307407_10184134
670 Ga0307407_10454929
671 Ga0307412_10160548
672 Ga0307412_10281029
673 Ga0307412_10794354
674 Ga0307409_100044043
675 Ga0307409_100191793
676 Ga0307409_101454448
677 Ga0307416_100050003
678 Ga0307416_100065431
679 Ga0307414_10046620
680 Ga0307415_100027056
681 Ga0307415_100056482
682 Ga0307415_100373422
683 Ga0373931_0389542
684 Ga0373935_0681869
685 Ga0373927_0678721
686 Ga0316582_0157743
687 Ga0316584_0133187
688 Ga0395900_0199746
689 Ga0395900_0304816
690 Ga0395898_0086494
691 Ga0395898_0095792
692 Ga0395898_0815817
693 Ga0436364_0120581
694 Ga0436364_1221416
695 Ga0436364_1477777
696 Ga0395901_0106089
697 Ga0395901_0376347
698 Ga0436361_0918201
699 Ga0451787_695620
700 Ga0451789_0718013
701 Ga0451791_1787661
702 Ga0451793_0607380
703 Ga0451797_0561658
704 Ga0451797_0870456
705 Ga0451795_0617636
706 Ga0451800_1171825
707 Ga0451802_0591508
708 Ga0451837_0293854
709 Ga0451839_0636022
710 Ga0451841_0832554
711 Ga0451849_1042011
712 Ga0451853_0066073
713 Ga0451853_1720011
714 Ga0451853_1784110
715 Ga0451853_3716943
716 Ga0439448_0000439
717 Ga0439448_0229616
718 Ga0439449_0282166
719 Ga0439450_008504
720 Ga0439450_099645
721 Ga0439451_013624
722 Ga0439454_000293
723 Ga0439455_0031565
724 Ga0439463_001394
725 Ga0450913_016788
726 Ga0450900_002519
727 Ga0450903_000118
728 Ga0450905_015003
729 Ga0439458_0008181
730 Ga0439458_0057408
731 Ga0439458_0123007
732 Ga0439458_0163711
733 Ga0439444_0000868
734 Ga0439464_0000097
735 Ga0439460_0000221
736 Ga0450916_000141
737 Ga0450918_117998
738 Ga0450901_004995
739 Ga0439440_0000634
740 Ga0466972_0025928
741 Ga0466972_0051606
742 Ga0466972_0599611
743 Ga0466965_0007140
744 Ga0466965_0197207
745 Ga0466965_0228106
746 Ga0466965_0490318
747 Ga0466966_0001620
748 Ga0466966_0311992
749 Ga0466961_0000576
750 Ga0466963_0000279
751 Ga0466963_0064279
752 Ga0466963_0549202
753 Ga0466964_0021210
754 Ga0466964_0515706
755 Ga0466971_0008676
756 Ga0466971_0156006
757 Ga0466971_0194583
758 Ga0466971_0475015
759 Ga0466970_0000264
760 Ga0466970_0152180
761 Ga0466957_0001635
762 Ga0466957_0151991
763 Ga0466957_0524305
764 Ga0466960_0003858
765 Ga0466960_0016178
766 Ga0466960_0071931
767 Ga0466959_0000297
768 Ga0466959_1090564
769 Ga0466958_0000301
770 Ga0466958_0388913
771 Ga0466958_0517308
772 Ga0466958_0576517
773 Ga0466967_0005722
774 Ga0466967_0020060
775 Ga0466967_0361546
776 Ga0495627_170662
777 Ga0495592_0023206
778 Ga0495603_0008900
779 Ga0495603_0012917
780 Ga0495603_0038090
781 Ga0495603_0073632
782 Ga0495590_0303031
783 Ga0495629_0001825
784 Ga0495629_0007040
785 Ga0495629_0011281
786 Ga0495629_0210165
787 Ga0495629_0572924
788 Ga0495638_0184503
789 Ga0495638_0481260
790 Ga0495651_0106971
791 Ga0495580_0108850
792 Ga0495605_0021885
793 Ga0495639_0045648
794 Ga0495639_0089641
795 Ga0495662_0008499
796 Ga0495662_0016831
797 Ga0495662_0143538
798 Ga0495584_0045161
799 Ga0495585_0101441
800 Ga0495585_0549400
801 Ga0495594_0000264
802 Ga0495594_0006025
803 Ga0495594_0033350
804 Ga0495594_0033608
805 Ga0495594_0116513
806 Ga0495594_0502333
807 Ga0495596_0047246
808 Ga0495596_0297672
809 Ga0495607_0061860
810 Ga0495583_0070524
811 Ga0495606_0016828
812 Ga0495606_0041110
813 Ga0495608_0081009
814 Ga0495610_0130162
815 Ga0495616_0006312
816 Ga0495616_0095709
817 Ga0495618_0170438
818 Ga0495620_0006444
819 Ga0495620_0046956
820 Ga0495628_0162003
821 Ga0495628_0356943
822 Ga0495630_0195569
823 Ga0495631_0004619
824 Ga0495632_0160510
825 Ga0495637_0357885
826 Ga0495643_0004948
827 Ga0495644_0246315
828 Ga0495666_0036450
829 Ga0495642_0271634
830 Ga0495642_0299729
831 Ga0495640_0012887
832 Ga0495640_0519965
833 Ga0495586_0620631
834 Ga0495598_0018599
835 Ga0495621_0235943
836 Ga0495597_0042082
837 Ga0495597_0300677
838 Ga0495645_0057186
839 Ga0495622_0008412
840 Ga0495622_0013090
841 Ga0495622_0164253
842 Ga0495622_0287158
843 Ga0495667_0131401
844 Ga0495656_0102564
845 Ga0495668_0085807
846 Ga0495668_0535089
847 Ga0495668_0662354
848 Ga0495634_0210150
849 Ga0495634_0406066
850 Ga0495611_0210731
851 Ga0495611_0314860
852 Ga0495625_0175775
853 Ga0495625_0299923
854 Ga0495635_0118535
855 Ga0495635_0121432
856 Ga0495661_0107363
857 Ga0495661_0394724
858 Ga0495588_0007433
859 Ga0495588_0027287
860 Ga0495588_0101194
861 Ga0495588_0131160
862 Ga0495657_0028365
863 Ga0495657_0041760
864 Ga0495657_0049965
865 Ga0495623_0223603
866 Ga0495613_0049346
867 Ga0495613_0068326
868 Ga0495613_0166952
869 Ga0495624_0081680
870 Ga0495670_0545800
871 Ga0495671_0426617
872 Ga0495589_0007416
873 Ga0495589_0060406
874 Ga0495589_0078629
875 Ga0495589_0235709
876 Ga0495589_0322644
877 Ga0495600_0698891
878 Ga0495660_0046759
879 Ga0495660_0077611
880 Ga0495581_0144325
881 Ga0495581_0261724
882 Ga0495581_0277723
883 Ga0495604_0099689
884 Ga0495636_0003082
885 Ga0495636_0013863
886 Ga0495636_0029571
887 Ga0495636_0233753
888 Ga0495636_0590462
889 Ga0495672_0068569
890 Ga0495676_0002693
891 Ga0495676_0003492
892 Ga0495680_0817039
893 Ga0495683_0046595
894 Ga0495687_000773
895 Ga0495687_060793
896 Ga0495687_138353
897 Ga0495687_182469
898 Ga0495687_259932
899 Ga0495675_0027464
900 Ga0495675_0570755
901 Ga0495675_0799434
902 Ga0495677_0045222
903 Ga0495685_004164
904 Ga0495685_023936
905 Ga0495685_078769
906 Ga0495681_0122978
907 Ga0495681_0311777
908 Ga0495686_0518939
909 Ga0495593_0054396
910 Ga0495593_0090258
911 Ga0495593_0120987
912 Ga0495593_0254863
913 Ga0495614_0000342
914 Ga0495614_0065044
915 Ga0495615_0189496
916 Ga0495626_0160351
917 Ga0496101_1016322
918 Ga0496104_1671719
919 Ga0496105_1137662
920 Ga0496106_0167848
921 Ga0496107_0238670
922 Ga0496109_0169826
923 Ga0496109_1831862
924 Ga0496110_1342650
925 Ga0496114_0994897
926 Ga0496115_0132763
927 Ga0496126_0656168
928 Ga0501031_0058818
929 Ga0501031_0068667
930 Ga0501032_0006359
931 Ga0501033_0296903
932 Ga0501034_0022499
933 Ga0501034_0386060
934 Ga0501034_1248953
935 Ga0501034_1352257
936 Ga0501036_0123945
937 Ga0501036_0169353
938 Ga0501037_0000929
939 Ga0501038_0015918
940 Ga0501038_0033205
941 Ga0501039_0089342
942 Ga0501041_0117756
943 Ga0501042_0099837
944 Ga0501043_0005804
945 Ga0501043_0034296
946 Ga0501047_0051408
947 Ga0501069_0141013
948 Ga0501069_0805174
949 Ga0501070_0016848
950 Ga0501074_0001291
951 Ga0501075_0045749
952 Ga0501076_0496045
953 Ga0501202_078503
954 Ga0501257_120800
955 Ga0501079_0128578
956 Ga0501080_0017499
957 Ga0501081_0219486
958 Ga0501083_0258784
959 Ga0501035_0199425
960 Ga0501035_0207644
961 Ga0501044_0036285
962 Ga0501044_0058789
963 Ga0501045_0053445
964 nmdc:mga03n38_489698_c1
965 nmdc:mga03n38_499982_c1
966 nmdc:mga0yw44_20169_c1
967 nmdc:mga0yw44_239985_c1
968 nmdc:mga06z11_28789_c1
969 nmdc:mga07m45_445395_c1
970 nmdc:mga07m45_698379_c1
971 nmdc:mga05p37_1347799_c1
972 nmdc:mga06r32_657988_c1
973 nmdc:mga0n895_39248_c1
974 nmdc:mga0rr50_34206_c1
975 nmdc:mga08x19_138579_c1
976 nmdc:mga0a205_122598_c1
977 Ga0495601_0343722
978 Ga0495595_0193889
979 Ga0495619_0902395
980 Ga0500560_015750
981 Ga0500573_0085915
982 Ga0500600_0089905
983 Ga0500600_0179844
984 Ga0500600_0222938
985 Ga0501084_0048328
986 Ga0501082_0169235
987 Ga0466962_0004101
988 Ga0466962_0093076
989 Ga0530510_0038253
990 Ga0530510_0359879
991 2585305981
992 2616693723
993 2644265157
994 2644441827
995 2644630790
996 2785366258
997 2786667227
998 2808846846
999 2862282395
1000 2867431924
1001 2877684259
1002 2899371149
1003 2919473867
1004 2946073027
1005 2954389590
1006 2954682315
1007 2954690609
1008 2954700437
1009 2954701791
1010 2954719113
1011 2954729083
1012 2954732728
1013 2954747982
1014 2954751606
1015 2954767107
1016 8008581409
1017 8056830994

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

18

129

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7189 2 118
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7083 2 118
3gnv-assembly1.cif.gz_A hcv ns5b polymerase in complex with 1,5 benzodiazepine inhibitor 1b 0.6801 79 113
2gqq-assembly1.cif.gz_A-2 crystal structure of e. coli leucine-responsive regulatory protein (lrp) 0.6744 2 118
3cso-assembly2.cif.gz_B hcv polymerase in complex with a 1,5 benzodiazepine inhibitor 0.6732 78 113
ID Description Score Start End Superfamily
4f3nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8492 17 43 3.40.50.12710
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7189 2 118 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7083 2 118 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7062 1 118 3.30.70.1060
af_Q9H254_2415_2531_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6855 79 104 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A1F2X1Q6-F1-model_v4 YCII-related domain-containing protein 0.7845 1 115
AF-A0A1F2X1Q6-F1-model_v4 YCII-related domain-containing protein 0.7783 1 115
AF-A0A0K1JDG1-F1-model_v4 YCII-related domain-containing protein 0.7604 1 115
AF-A0A0Q7NKL9-F1-model_v4 YCII-related domain-containing protein 0.7552 1 113
AF-A0A0L6CMM4-F1-model_v4 YCII-related domain-containing protein 0.7537 1 114

Map