F456761

General Info

Members Datasets Scaffolds Average Seq Length
507 338 447 292

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2739367655|2739613706
Length 313
Sequence PKAAQQAAGAALAAKHETRSGHLPDTDFDSLLPPLALNRRGFITASLAGGFALAAGPVTAQTVIKTDTKGLLEGMIKIPVADGGIPAYRAAPEGKKGVPVILVVQEIFGVHEYIRDVCRRLAKEGYMAIAPELYSRQGDPSRYTEISRLISEVVNKVPDTQVLGDLDAAVAWAAKNGGNTERMGITGFCWGGRIVWLYDAHNPKVKAAVVWYGRLVGDTDPLHPVQPIEIADKLNGPVLGLYGAQDAGIPQDTIAAMKQALAKGDEAAQASKFVVYPDAGHAFHADYRPSYNADAAKDGWARAVQWLDTYLKP

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
12 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
13 2643221652 Acidovorax sp. Root402 Isolate Unclassified
14 2643221658 Variovorax sp. Root411 Isolate Unclassified
15 2643221672 Variovorax sp. Root434 Isolate Unclassified
16 2643221683 Variovorax sp. Root473 Isolate Unclassified
17 2643221717 Acidovorax sp. Root267 Isolate Unclassified
18 2738541277 Variovorax sp. GV051 Isolate Unclassified
19 2738541307 Variovorax sp. GV008 Isolate Unclassified
20 2738543019 Variovorax sp. GV040 Isolate Unclassified
21 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
22 2818991446 Variovorax sp. 1180 Isolate Unclassified
23 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
24 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
25 2842677519 Variovorax sp. R-72495 Isolate Unclassified
26 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
27 2842733646 Variovorax sp. R-72446 Isolate Unclassified
28 2842747753 Variovorax sp. R-72060 Isolate Unclassified
29 2855730933 Achromobacter sp. HZ28 Isolate Nodule
30 2855767633 Achromobacter sp. HZ34 Isolate Nodule
31 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
32 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
33 2858950400 Achromobacter sp. K91 Isolate Unclassified
34 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
35 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
36 2885198086 Variovorax sp. 679 Isolate Unclassified
37 2885211737 Variovorax sp. 553 Isolate Unclassified
38 2899924645 Variovorax sp. 369 Isolate Unclassified
39 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
40 2904456579 Variovorax sp. 2002 Isolate Unclassified
41 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
42 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
43 2928037797 Variovorax sp. 1126 Isolate Unclassified
44 2928044640 Variovorax sp. 1128 Isolate Unclassified
45 2928051484 Variovorax sp. 1133 Isolate Unclassified
46 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
47 2928070936 Variovorax gossypii 1167 Isolate Unclassified
48 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
49 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
50 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
51 2929520902 Variovorax beijingensis 502 Isolate Unclassified
52 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
53 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
54 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
55 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
56 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
57 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
58 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
59 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
60 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
61 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
62 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
63 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
64 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
65 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
66 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
67 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
68 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
69 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
70 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
71 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
72 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
73 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
74 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
75 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
76 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
77 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
78 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
79 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
80 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
81 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
82 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
83 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
84 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
85 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
86 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
87 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
88 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
89 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
90 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
91 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
92 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
93 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
94 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
95 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
96 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
97 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
98 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
99 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
100 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
101 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
102 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
103 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
104 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
105 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
108 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
109 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
110 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
111 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
112 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
113 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
114 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
115 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
116 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
117 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
118 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
119 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
120 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
121 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
122 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
123 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
125 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
126 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
127 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
128 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
129 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
130 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
131 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
132 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
134 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
135 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
141 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
147 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
153 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
154 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
155 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
158 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
160 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
162 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
165 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
170 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
173 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
208 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
209 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
210 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
211 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
212 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
213 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
214 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
215 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
216 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
217 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
225 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
226 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
227 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
228 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
229 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
236 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
237 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
238 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
239 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
240 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
241 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
242 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
243 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
244 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
245 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
246 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
247 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
248 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
249 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
250 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
251 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
252 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
253 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
254 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
255 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
256 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
257 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
258 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
259 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
260 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
261 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
262 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
263 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
264 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
265 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
266 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
267 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
268 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
269 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
270 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
271 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
272 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
276 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
279 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
283 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
284 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
285 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
286 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
302 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
303 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
304 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
308 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
309 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
310 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
311 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
312 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
320 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
321 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
322 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
323 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
324 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
325 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
326 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
327 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
328 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
329 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
330 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
331 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
332 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
333 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
334 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
335 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
336 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
337 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.97
Metatranscriptomes 0.2
Isolates 11.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.78
Nodule 0.99
Rhizoplane 0.99
Rhizosphere 52.47
Stem 0
Stem Tuber 0
Unclassified 15.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1004642 3300002739 Bacteria 2055
2 JGI25152J39213_1001766 3300002773 Bacteria 8813
3 JGI25150J39212_1001970 3300002774 Bacteria 5384
4 JGI25159J45721_1006281 3300002987 Bacteria 3580
5 JGI25159J45721_1010680 3300002987 Bacteria 2316
6 JGI25151J46595_10001305 3300003187 Bacteria 17464
7 JGI25151J46595_10003396 3300003187 Bacteria 8813
8 JGI25151J46595_10005187 3300003187 Bacteria 6758
9 JGI25153J46596_10003476 3300003215 Bacteria 8813
10 rootH2_10006890 3300003320 Bacteria 23032
11 JGI25160J50197_1003174 3300003354 Bacteria 7465
12 JGI25160J50197_1003860 3300003354 Bacteria 6579
13 Ga0006562J51391_1025869 3300003578 Bacteria 4560
14 Ga0055535_1000076 3300003761 Bacteria 111203
15 Ga0055542_1000009 3300003762 Bacteria 416550
16 Ga0055526_1004156 3300003771 Bacteria 8813
17 Ga0055526_1004167 3300003771 Bacteria 8796
18 Ga0055537_1000011 3300003773 Bacteria 137556
19 Ga0055537_1000923 3300003773 Bacteria 13740
20 Ga0055537_1001543 3300003773 Bacteria 8813
21 Ga0055524_1002772 3300003775 Bacteria 8813
22 Ga0055524_1002784 3300003775 Bacteria 8790
23 Ga0055536_1002571 3300003781 Bacteria 10113
24 Ga0055536_1011581 3300003781 Bacteria 3362
25 Ga0055534_1000020 3300003784 Bacteria 137562
26 Ga0055534_1001303 3300003784 Bacteria 10081
27 Ga0055534_1001594 3300003784 Bacteria 8798
28 Ga0055528_1002850 3300003790 Bacteria 9025
29 Ga0055528_1002956 3300003790 Bacteria 8813
30 Ga0055528_1004218 3300003790 Bacteria 6970
31 Ga0055530_10002123 3300003791 Bacteria 13186
32 Ga0055530_10009360 3300003791 Bacteria 3775
33 Ga0055530_10013964 3300003791 Bacteria 2708
34 Ga0055540_1000970 3300003792 Bacteria 18573
35 Ga0055540_1001201 3300003792 Bacteria 15945
36 Ga0055540_1002506 3300003792 Bacteria 9603
37 Ga0055531_10004887 3300003794 Bacteria 7984
38 Ga0055531_10011049 3300003794 Bacteria 4408
39 Ga0055531_10011379 3300003794 Bacteria 4298
40 Ga0055531_10037433 3300003794 Bacteria 1476
41 Ga0055543_1001908 3300004625 Bacteria 7484
42 Ga0055543_1003088 3300004625 Bacteria 5112
43 Ga0065165_1004364 3300005262 Bacteria 8851
44 Ga0065165_1004610 3300005262 Bacteria 8383
45 Ga0065714_10007961 3300005288 Bacteria 3740
46 Ga0065704_10088434 3300005289 Bacteria 2939
47 Ga0070658_10035583 3300005327 Bacteria 4011
48 Ga0070670_100175955 3300005331 Bacteria 1857
49 Ga0070670_100232846 3300005331 Bacteria 1603
50 Ga0070670_100409620 3300005331 Unclassified 1198
51 Ga0070680_100025329 3300005336 Bacteria 4741
52 Ga0068868_100055991 3300005338 Bacteria 3113
53 Ga0070660_100005639 3300005339 Bacteria 8675
54 Ga0070691_10001420 3300005341 Bacteria 10230
55 Ga0070661_100054780 3300005344 Bacteria 2921
56 Ga0070669_100042315 3300005353 Bacteria 3315
57 Ga0070669_100343569 3300005353 Unclassified 1210
58 Ga0070675_100009142 3300005354 Bacteria 7696
59 Ga0070673_100014261 3300005364 Bacteria 5528
60 Ga0070659_100005869 3300005366 Bacteria 8845
61 Ga0070659_100144181 3300005366 Bacteria 1940
62 Ga0070659_100155194 3300005366 Bacteria 1869
63 Ga0070659_100260422 3300005366 Bacteria 1439
64 Ga0070667_100148110 3300005367 Bacteria 2060
65 Ga0070709_10329845 3300005434 Bacteria 1122
66 Ga0070714_100011377 3300005435 Bacteria 7060
67 Ga0070713_100385039 3300005436 Bacteria 1307
68 Ga0070708_100108816 3300005445 Bacteria 2546
69 Ga0070708_100517794 3300005445 Bacteria 1125
70 Ga0070681_10042011 3300005458 Bacteria 4583
71 Ga0068867_100259372 3300005459 Unclassified 1416
72 Ga0070685_10041079 3300005466 Bacteria 2634
73 Ga0070698_100044361 3300005471 Bacteria 4554
74 Ga0070684_100531231 3300005535 Bacteria 1091
75 Ga0068853_100022227 3300005539 Bacteria 5295
76 Ga0068853_100025151 3300005539 Bacteria 4995
77 Ga0068855_100073244 3300005563 Bacteria 3980
78 Ga0068855_100090377 3300005563 Bacteria 3534
79 Ga0068855_100152460 3300005563 Bacteria 2627
80 Ga0070664_100067208 3300005564 Bacteria 3063
81 Ga0068856_100124277 3300005614 Bacteria 2583
82 Ga0068852_100484267 3300005616 Bacteria 1230
83 Ga0068859_100019312 3300005617 Bacteria 6848
84 Ga0068851_10020884 3300005834 Bacteria 3175
85 Ga0068870_10163907 3300005840 Bacteria 1321
86 Ga0068860_100300631 3300005843 Unclassified 1572
87 Ga0068862_100240548 3300005844 Unclassified 1646
88 Ga0075365_10006099 3300006038 Bacteria 6588
89 Ga0075365_10031561 3300006038 Bacteria 3399
90 Ga0075368_10092573 3300006042 Bacteria 1237
91 Ga0075363_100005316 3300006048 Bacteria 5716
92 Ga0075363_100010449 3300006048 Bacteria 4412
93 Ga0075364_10028688 3300006051 Bacteria 3564
94 Ga0075362_10009694 3300006177 Bacteria 3734
95 Ga0075362_10012021 3300006177 Bacteria 3425
96 Ga0075367_10016392 3300006178 Bacteria 4046
97 Ga0075367_10023646 3300006178 Bacteria 3460
98 Ga0075367_10036594 3300006178 Bacteria 2848
99 Ga0075367_10141192 3300006178 Bacteria 1492
100 Ga0075369_10135325 3300006186 Bacteria 1122
101 Ga0075366_10010276 3300006195 Bacteria 5250
102 Ga0075366_10021165 3300006195 Bacteria 3780
103 Ga0075366_10053767 3300006195 Bacteria 2392
104 Ga0097621_100390526 3300006237 Bacteria 1244
105 Ga0075370_10001218 3300006353 Bacteria 10879
106 Ga0075370_10009988 3300006353 Bacteria 4947
107 Ga0075370_10024203 3300006353 Bacteria 3352
108 Ga0075370_10102925 3300006353 Bacteria 1654
109 Ga0068871_100308313 3300006358 Bacteria 1391
110 Ga0075428_100000811 3300006844 Bacteria 32679
111 Ga0075430_100267290 3300006846 Bacteria 1416
112 Ga0075431_100257981 3300006847 Bacteria 1770
113 Ga0075433_10152379 3300006852 Bacteria 2056
114 Ga0075434_100163305 3300006871 Bacteria 2247
115 Ga0075436_100040145 3300006914 Bacteria 3229
116 Ga0097620_100019313 3300006931 Bacteria 6848
117 Ga0099826_10000588 3300006948 Bacteria 18388
118 Ga0099826_10033207 3300006948 Bacteria 3707
119 Ga0075435_100493673 3300007076 Bacteria 1058
120 Ga0105244_10001450 3300009036 Bacteria 19208
121 Ga0105244_10122015 3300009036 Bacteria 1261
122 Ga0105240_10311730 3300009093 Bacteria 1797
123 Ga0111539_10150818 3300009094 Bacteria 2721
124 Ga0114129_10113615 3300009147 Bacteria 3734
125 Ga0114129_10477861 3300009147 Bacteria 1631
126 Ga0114129_10638090 3300009147 Bacteria 1376
127 Ga0105243_10002901 3300009148 Bacteria 14193
128 Ga0105243_10120013 3300009148 Bacteria 2215
129 Ga0105241_10406450 3300009174 Bacteria 1195
130 Ga0105242_10019649 3300009176 Bacteria 5295
131 Ga0105242_10417047 3300009176 Bacteria 1257
132 Ga0105237_10065271 3300009545 Bacteria 3636
133 Ga0105238_10007695 3300009551 Bacteria 10774
134 Ga0105238_10228074 3300009551 Bacteria 1839
135 Ga0105239_10140231 3300010375 Bacteria 2693
136 Ga0105246_10007932 3300011119 Bacteria 6517
137 Ga0105246_10157921 3300011119 Bacteria 1724
138 Ga0157339_1000867 3300012505 Bacteria 1683
139 Ga0157373_10026317 3300013100 Bacteria 4203
140 Ga0157373_10101898 3300013100 Bacteria 2020
141 Ga0157371_10094037 3300013102 Bacteria 2124
142 Ga0157370_10016161 3300013104 Bacteria 7565
143 Ga0157370_10031719 3300013104 Bacteria 5166
144 Ga0157369_10005741 3300013105 Bacteria 14426
145 Ga0157372_10007501 3300013307 Bacteria 11602
146 Ga0157372_10064257 3300013307 Bacteria 4118
147 Ga0157372_10202795 3300013307 Bacteria 2298
148 Ga0157380_10247900 3300014326 Bacteria 1610
149 Ga0157380_10602581 3300014326 Bacteria 1087
150 Ga0182008_10000761 3300014497 Bacteria 22644
151 Ga0182008_10002350 3300014497 Bacteria 11907
152 Ga0182008_10007271 3300014497 Bacteria 6123
153 Ga0182006_1007232 3300015261 Bacteria 5099
154 Ga0182007_10000224 3300015262 Bacteria 38000
155 Ga0163161_10000042 3300017792 Bacteria 135368
156 Ga0163161_10006628 3300017792 Bacteria 8018
157 Ga0213872_10000450 3300021361 Bacteria 33492
158 Ga0213872_10006588 3300021361 Bacteria 5800
159 Ga0209258_100009 3300025242 Bacteria 996276
160 Ga0207425_1001199 3300025245 Bacteria 11481
161 Ga0209148_1000007 3300025254 Bacteria 1592273
162 Ga0209129_1000013 3300025258 Bacteria 524874
163 Ga0209129_1004225 3300025258 Bacteria 5755
164 Ga0209129_1005320 3300025258 Bacteria 4607
165 Ga0209565_1000058 3300025263 Bacteria 194126
166 Ga0209565_1000197 3300025263 Bacteria 71850
167 Ga0209565_1000898 3300025263 Bacteria 16165
168 Ga0209673_1000053 3300025273 Bacteria 279449
169 Ga0209673_1000279 3300025273 Bacteria 96141
170 Ga0209673_1000316 3300025273 Bacteria 89031
171 Ga0209673_1002609 3300025273 Bacteria 12118
172 Ga0209130_1000158 3300025284 Bacteria 101323
173 Ga0209130_1000363 3300025284 Bacteria 51603
174 Ga0209130_1001291 3300025284 Bacteria 17312
175 Ga0209675_1000010 3300025291 Bacteria 541927
176 Ga0209675_1000130 3300025291 Bacteria 102667
177 Ga0209675_1001105 3300025291 Bacteria 16503
178 Ga0209675_1003230 3300025291 Bacteria 7871
179 Ga0209676_1000108 3300025292 Bacteria 221168
180 Ga0209676_1000240 3300025292 Bacteria 117689
181 Ga0209676_1001478 3300025292 Bacteria 21734
182 Ga0209676_1004198 3300025292 Bacteria 8173
183 Ga0209676_1046669 3300025292 Bacteria 1170
184 Ga0209025_1000103 3300025294 Bacteria 228054
185 Ga0209025_1000129 3300025294 Bacteria 198847
186 Ga0209025_1000169 3300025294 Bacteria 161428
187 Ga0209025_1008272 3300025294 Bacteria 7513
188 Ga0209025_1020699 3300025294 Bacteria 3580
189 Ga0209564_1000171 3300025295 Bacteria 155716
190 Ga0209564_1000880 3300025295 Bacteria 39770
191 Ga0209758_1000067 3300025297 Bacteria 288575
192 Ga0209758_1002173 3300025297 Bacteria 20612
193 Ga0209050_1000002 3300025298 Bacteria 1792849
194 Ga0209050_1001106 3300025298 Bacteria 32677
195 Ga0209050_1007625 3300025298 Bacteria 6006
196 Ga0209256_1000077 3300025299 Bacteria 230410
197 Ga0209256_1000121 3300025299 Bacteria 167299
198 Ga0207426_1000101 3300025302 Bacteria 262096
199 Ga0207426_1000129 3300025302 Bacteria 210930
200 Ga0209051_1000002 3300025303 Bacteria 1631846
201 Ga0209051_1000101 3300025303 Bacteria 163793
202 Ga0209051_1000145 3300025303 Bacteria 134807
203 Ga0209051_1000289 3300025303 Bacteria 80415
204 Ga0209257_1000002 3300025304 Bacteria 1767052
205 Ga0209257_1000724 3300025304 Bacteria 50361
206 Ga0209257_1001897 3300025304 Bacteria 22604
207 Ga0209257_1003663 3300025304 Bacteria 12884
208 Ga0209257_1008409 3300025304 Bacteria 5875
209 Ga0207705_10000039 3300025909 Bacteria 193592
210 Ga0207654_10249307 3300025911 Bacteria 1189
211 Ga0207707_10007873 3300025912 Bacteria 9264
212 Ga0207671_10049925 3300025914 Bacteria 3098
213 Ga0207660_10000955 3300025917 Bacteria 19140
214 Ga0207660_10087443 3300025917 Bacteria 2303
215 Ga0207662_10117503 3300025918 Bacteria 1664
216 Ga0207657_10001376 3300025919 Bacteria 25943
217 Ga0207652_10001664 3300025921 Bacteria 19471
218 Ga0207681_10007556 3300025923 Bacteria 6662
219 Ga0207694_10031397 3300025924 Bacteria 4057
220 Ga0207650_10051380 3300025925 Bacteria 3050
221 Ga0207659_10040022 3300025926 Bacteria 3274
222 Ga0207664_10374166 3300025929 Bacteria 1264
223 Ga0207690_10049793 3300025932 Bacteria 2794
224 Ga0207706_10009870 3300025933 Bacteria 8758
225 Ga0207686_10186505 3300025934 Bacteria 1475
226 Ga0207709_10000094 3300025935 Bacteria 137959
227 Ga0207709_10001820 3300025935 Bacteria 14231
228 Ga0207665_10223208 3300025939 Bacteria 1382
229 Ga0207661_10068051 3300025944 Bacteria 2899
230 Ga0207679_10023073 3300025945 Bacteria 4248
231 Ga0207667_10012868 3300025949 Bacteria 9613
232 Ga0207639_10024626 3300026041 Bacteria 4358
233 Ga0207639_10044286 3300026041 Bacteria 3346
234 Ga0207639_10272273 3300026041 Bacteria 1486
235 Ga0207678_10373051 3300026067 Bacteria 1233
236 Ga0207702_10078238 3300026078 Bacteria 2863
237 Ga0207676_10548749 3300026095 Bacteria 1104
238 Ga0207674_10034527 3300026116 Bacteria 5284
239 Ga0207674_10081589 3300026116 Bacteria 3236
240 Ga0207683_10370552 3300026121 Bacteria 1316
241 Ga0207698_10346951 3300026142 Bacteria 1401
242 Ga0209983_1007187 3300027665 Bacteria 2285
243 Ga0209971_1005865 3300027682 Bacteria 2910
244 Ga0209974_10051955 3300027876 Bacteria 1379
245 Ga0268265_10175282 3300028380 Bacteria 1837
246 Ga0265334_10024567 3300028573 Bacteria 2443
247 Ga0265318_10017891 3300028577 Bacteria 2902
248 Ga0265318_10050489 3300028577 Bacteria 1563
249 Ga0268256_1047931 3300030500 Bacteria 917
250 Ga0316177_1102455 3300030731 Bacteria 3824
251 Ga0314311_1046235 3300030733 Bacteria 5736
252 Ga0316179_1082949 3300030734 Bacteria 3572
253 Ga0316178_1022865 3300030735 Bacteria 5897
254 Ga0316180_1127423 3300030736 Bacteria 1723
255 Ga0316183_1035123 3300030742 Bacteria 5837
256 Ga0316182_1269749 3300030745 Bacteria 4307
257 Ga0265330_10000022 3300031235 Bacteria 154198
258 Ga0265332_10000001 3300031238 Bacteria 863783
259 Ga0265320_10001775 3300031240 Bacteria 15283
260 Ga0265325_10021899 3300031241 Bacteria 3505
261 Ga0265340_10020214 3300031247 Bacteria 3426
262 Ga0265316_10404845 3300031344 Bacteria 982
263 Ga0307408_100000186 3300031548 Bacteria 68520
264 Ga0307408_100413942 3300031548 Bacteria 1160
265 Ga0307408_100459205 3300031548 Bacteria 1106
266 Ga0265314_10000013 3300031711 Bacteria 403405
267 Ga0265314_10002970 3300031711 Bacteria 16805
268 Ga0307516_10329492 3300031730 Bacteria 1196
269 Ga0307405_10090777 3300031731 Bacteria 2022
270 Ga0307405_10205863 3300031731 Bacteria 1432
271 Ga0307406_10000267 3300031901 Bacteria 31333
272 Ga0307406_10000468 3300031901 Bacteria 23337
273 Ga0307406_10290457 3300031901 Bacteria 1251
274 Ga0307407_10098896 3300031903 Bacteria 1806
275 Ga0307412_10000555 3300031911 Bacteria 22198
276 Ga0307412_10004531 3300031911 Bacteria 7737
277 Ga0307412_10179510 3300031911 Bacteria 1591
278 Ga0307412_10273496 3300031911 Bacteria 1323
279 Ga0307412_10288529 3300031911 Bacteria 1291
280 Ga0307412_10405885 3300031911 Bacteria 1110
281 Ga0307416_100231123 3300032002 Bacteria 1783
282 Ga0307414_10042997 3300032004 Bacteria 3074
283 Ga0307414_10067944 3300032004 Bacteria 2555
284 Ga0307510_10059672 3300033180 Bacteria 3936
285 Ga0395899_0034905 3300037312 Bacteria 3776
286 Ga0395905_0004088 3300037471 Bacteria 15284
287 Ga0436360_0923887 3300039438 Bacteria 8201
288 Ga0436360_1228156 3300039438 Bacteria 947
289 Ga0436361_0719937 3300039447 Bacteria 34414
290 Ga0436363_1095800 3300039450 Bacteria 1557
291 Ga0439466_0011610 3300041411 Bacteria 3255
292 Ga0439465_0014736 3300041413 Bacteria 2438
293 Ga0439442_001645 3300042002 Bacteria 4384
294 Ga0439449_0000726 3300042007 Bacteria 12635
295 Ga0439462_0013129 3300042015 Bacteria 2122
296 Ga0450919_005324 3300042121 Bacteria 1549
297 Ga0450898_032621 3300042134 Bacteria 961
298 Ga0450908_001104 3300042184 Bacteria 5237
299 Ga0439434_0004359 3300042435 Bacteria 4137
300 Ga0450918_005186 3300042531 Bacteria 2347
301 Ga0450893_0005190 3300042532 Bacteria 2084
302 Ga0466972_0000595 3300044658 Bacteria 17597
303 Ga0453683_0034988 3300044673 Bacteria 3166
304 Ga0495627_020882 3300046453 Bacteria 2176
305 Ga0495651_0087753 3300046462 Bacteria 2339
306 Ga0495650_0000133 3300046471 Bacteria 173878
307 Ga0495650_0002505 3300046471 Bacteria 14719
308 Ga0495584_0000356 3300046491 Bacteria 31754
309 Ga0495585_0025235 3300046492 Bacteria 3407
310 Ga0495585_0032261 3300046492 Bacteria 2967
311 Ga0495594_0236674 3300046499 Bacteria 1041
312 Ga0495596_0002163 3300046500 Bacteria 10715
313 Ga0495607_0013731 3300046501 Bacteria 5294
314 Ga0495610_0020950 3300046512 Bacteria 3609
315 Ga0495610_0038701 3300046512 Bacteria 2419
316 Ga0495610_0055741 3300046512 Bacteria 1904
317 Ga0495616_0013338 3300046513 Bacteria 4638
318 Ga0495631_0004507 3300046518 Bacteria 7402
319 Ga0495637_0005324 3300046520 Bacteria 6581
320 Ga0495637_0107174 3300046520 Bacteria 1086
321 Ga0495654_0002029 3300046530 Bacteria 13313
322 Ga0495640_0472986 3300046533 Bacteria 764
323 Ga0495609_0059439 3300046538 Bacteria 1690
324 Ga0495621_0000487 3300046539 Bacteria 9778
325 Ga0495633_0001408 3300046558 Bacteria 18752
326 Ga0495633_0065573 3300046558 Bacteria 1696
327 Ga0495668_0028386 3300046616 Bacteria 3164
328 Ga0495625_0000250 3300046660 Bacteria 84096
329 Ga0495625_0037304 3300046660 Bacteria 3567
330 Ga0495635_0143816 3300046663 Bacteria 1624
331 Ga0495661_0031923 3300046665 Bacteria 3334
332 Ga0495588_0041125 3300046674 Bacteria 2360
333 Ga0495588_0122571 3300046674 Bacteria 1370
334 Ga0495658_0042903 3300046683 Bacteria 2527
335 Ga0495658_0166657 3300046683 Bacteria 1362
336 Ga0495669_0000888 3300046684 Bacteria 12601
337 Ga0495670_0012387 3300046691 Bacteria 4193
338 Ga0495670_0023131 3300046691 Bacteria 3069
339 Ga0495671_0003897 3300046692 Bacteria 9059
340 Ga0495676_0005231 3300047321 Bacteria 11873
341 Ga0495614_0008452 3300048089 Bacteria 4576
342 Ga0495626_0020529 3300048091 Bacteria 3289
343 Ga0496100_0427430 3300048903 Bacteria 1012
344 Ga0496114_0011066 3300048917 Bacteria 7198
345 Ga0496116_0031905 3300048919 Bacteria 3762
346 Ga0496116_0052385 3300048919 Bacteria 2704
347 Ga0496116_0173516 3300048919 Bacteria 1165
348 Ga0496116_0177166 3300048919 Bacteria 1146
349 Ga0496117_0006420 3300048920 Bacteria 11914
350 Ga0496117_0022799 3300048920 Bacteria 5014
351 Ga0496117_0171154 3300048920 Bacteria 1260
352 Ga0496118_0002197 3300048921 Bacteria 27107
353 Ga0496118_0020452 3300048921 Bacteria 5868
354 Ga0496119_0016275 3300048922 Bacteria 5669
355 Ga0496120_0002927 3300048923 Bacteria 16290
356 Ga0496121_0004647 3300048924 Bacteria 18261
357 Ga0496121_0058274 3300048924 Bacteria 3194
358 Ga0496121_0139927 3300048924 Bacteria 1797
359 Ga0496122_0001063 3300048925 Bacteria 47771
360 Ga0496122_0015415 3300048925 Bacteria 7308
361 Ga0496122_0032348 3300048925 Bacteria 4328
362 Ga0496122_0098331 3300048925 Bacteria 1966
363 Ga0496123_0000246 3300048926 Bacteria 109397
364 Ga0496123_0019909 3300048926 Bacteria 5267
365 Ga0496123_0031241 3300048926 Bacteria 3878
366 Ga0496123_0054024 3300048926 Bacteria 2648
367 Ga0496123_0066365 3300048926 Bacteria 2286
368 Ga0496124_0035302 3300048927 Bacteria 4375
369 Ga0496124_0040584 3300048927 Bacteria 4024
370 Ga0496124_0065223 3300048927 Bacteria 3037
371 Ga0496124_0086727 3300048927 Bacteria 2561
372 Ga0496125_0000011 3300048928 Bacteria 655895
373 Ga0496125_0004092 3300048928 Bacteria 17061
374 Ga0496125_0011633 3300048928 Bacteria 8788
375 Ga0496125_0015819 3300048928 Bacteria 7271
376 Ga0496125_0046020 3300048928 Bacteria 3665
377 Ga0496125_0178884 3300048928 Bacteria 1416
378 Ga0496126_0016962 3300048929 Bacteria 7266
379 Ga0496126_0030818 3300048929 Bacteria 5077
380 Ga0496126_0309150 3300048929 Bacteria 1302
381 Ga0496126_0362872 3300048929 Bacteria 1183
382 Ga0501031_0017538 3300049568 Bacteria 4654
383 Ga0501032_0026617 3300049569 Bacteria 3976
384 Ga0501033_0014868 3300049570 Bacteria 5909
385 Ga0501037_0022850 3300049573 Bacteria 4624
386 Ga0501038_0052405 3300049574 Bacteria 3518
387 Ga0501043_0048752 3300049579 Bacteria 3329
388 Ga0501047_0111211 3300049581 Bacteria 2622
389 Ga0501047_0299870 3300049581 Bacteria 1450
390 Ga0501070_0000018 3300049586 Bacteria 172755
391 Ga0501223_035495 3300049663 Bacteria 970
392 Ga0501249_001227 3300049679 Bacteria 5381
393 Ga0501080_0001258 3300049742 Bacteria 21102
394 Ga0501262_000085 3300049759 Bacteria 11574
395 Ga0501035_0002267 3300049822 Bacteria 18998
396 Ga0501044_0010434 3300049823 Bacteria 10082
397 Ga0501044_0020605 3300049823 Bacteria 7039
398 Ga0501044_0038477 3300049823 Bacteria 4994
399 Ga0501044_0061866 3300049823 Bacteria 3829
400 Ga0501044_0083970 3300049823 Bacteria 3219
401 Ga0501044_0312343 3300049823 Bacteria 1498
402 Ga0501044_0446946 3300049823 Bacteria 1200
403 nmdc:mga03683_13018_c1 3300050489 Bacteria 3053
404 nmdc:mga03683_3582_c1 3300050489 Bacteria 5033
405 nmdc:mga03683_41937_c1 3300050489 Bacteria 1881
406 nmdc:mga03n38_105237_c1 3300050490 Bacteria 1366
407 nmdc:mga03n38_15837_c1 3300050490 Bacteria 2920
408 nmdc:mga03n38_35105_c1 3300050490 Bacteria 2146
409 nmdc:mga00v17_9638_c1 3300050491 Bacteria 5236
410 nmdc:mga0yw44_10228_c1 3300050492 Bacteria 4784
411 nmdc:mga0yw44_320632_c1 3300050492 Bacteria 1040
412 nmdc:mga0k408_35738_c1 3300050493 Bacteria 2849
413 nmdc:mga0k408_42474_c1 3300050493 Bacteria 2619
414 nmdc:mga0k408_5785_c1 3300050493 Bacteria 6582
415 nmdc:mga06z11_113495_c1 3300050494 Bacteria 1503
416 nmdc:mga06z11_46838_c1 3300050494 Bacteria 2193
417 nmdc:mga07m45_185497_c1 3300050496 Bacteria 1210
418 nmdc:mga07m45_477_c1 3300050496 Bacteria 16941
419 nmdc:mga06r32_211438_c1 3300050510 Bacteria 1927
420 nmdc:mga08y16_327565_c1 3300050511 Bacteria 1576
421 nmdc:mga0rr50_33756_c1 3300050513 Bacteria 3658
422 nmdc:mga0rr50_445852_c1 3300050513 Bacteria 1097
423 nmdc:mga08x19_3834_c1 3300050514 Bacteria 8945
424 nmdc:mga0a205_172915_c1 3300050515 Bacteria 2056
425 Ga0500610_0014943 3300053079 Bacteria 3659
426 Ga0500646_0017187 3300053090 Bacteria 1895
427 Ga0500651_0000107 3300053093 Bacteria 50947
428 Ga0500571_000836 3300053110 Bacteria 13275
429 Ga0500593_000288 3300053117 Bacteria 20475
430 Ga0500607_003871 3300053121 Bacteria 10629
431 Ga0500607_015342 3300053121 Bacteria 4418
432 Ga0500655_000799 3300053133 Bacteria 6190
433 Ga0500658_0000554 3300053134 Bacteria 15719
434 Ga0500559_0000783 3300053136 Bacteria 20793
435 Ga0500559_0003895 3300053136 Bacteria 7214
436 Ga0500559_0006920 3300053136 Bacteria 5073
437 Ga0500564_013092 3300053138 Bacteria 3706
438 Ga0500568_0002458 3300053139 Bacteria 10893
439 Ga0500573_0104437 3300053140 Bacteria 1591
440 Ga0500574_001493 3300053141 Bacteria 3506
441 Ga0500622_0173185 3300053156 Bacteria 1003
442 Ga0500624_002853 3300053157 Bacteria 2293
443 Ga0500627_0001255 3300053158 Bacteria 7018
444 Ga0500634_0093612 3300053161 Bacteria 1519
445 Ga0500638_003444 3300053162 Bacteria 5855
446 Ga0500596_011673 3300053735 Bacteria 1341
447 Ga0501082_0346960 3300060353 Bacteria 1294

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046533 Ga0495640_0472986 Ga0495640_0472986_13_699 223
2 3300006914 Ga0075436_100040145 Ga0075436_1000401453 238
3 3300005434 Ga0070709_10329845 Ga0070709_103298451 243
4 3300005435 Ga0070714_100011377 Ga0070714_1000113774 243
5 3300005436 Ga0070713_100385039 Ga0070713_1003850392 243
6 3300005563 Ga0068855_100090377 Ga0068855_1000903772 243
7 3300005614 Ga0068856_100124277 Ga0068856_1001242772 243
8 3300013307 Ga0157372_10202795 Ga0157372_102027952 243
9 3300025929 Ga0207664_10374166 Ga0207664_103741661 243
10 3300025949 Ga0207667_10012868 Ga0207667_100128686 243
11 3300026078 Ga0207702_10078238 Ga0207702_100782382 243
12 3300039438 Ga0436360_0923887 Ga0436360_0923887_142_918 253
13 iso_pu_bacteria 2643221644 2644248028 256
14 3300042532 Ga0450893_0005190 Ga0450893_0005190_1104_1889 257
15 iso_pu_bacteria 2858950400 2858956598 257
16 iso_pu_bacteria 2941479691 2941482222 257
17 3300005445 Ga0070708_100108816 Ga0070708_1001088162 260
18 3300050514 nmdc:mga08x19_3834_c1 nmdc:mga08x19_3834_c1_4502_5347 260
19 3300030500 Ga0268256_1047931 Ga0268256_10479311 261
20 3300031911 Ga0307412_10000555 Ga0307412_100005554 261
21 3300048919 Ga0496116_0052385 Ga0496116_0052385_1745_2533 261
22 3300048922 Ga0496119_0016275 Ga0496119_0016275_2599_3387 261
23 3300048923 Ga0496120_0002927 Ga0496120_0002927_8023_8811 261
24 3300048924 Ga0496121_0004647 Ga0496121_0004647_9523_10311 261
25 3300048925 Ga0496122_0032348 Ga0496122_0032348_1427_2215 261
26 3300048926 Ga0496123_0019909 Ga0496123_0019909_3674_4462 261
27 3300048928 Ga0496125_0000011 Ga0496125_0000011_423954_424742 261
28 3300048929 Ga0496126_0030818 Ga0496126_0030818_888_1676 261
29 3300039438 Ga0436360_1228156 Ga0436360_1228156_49_843 262
30 3300049823 Ga0501044_0446946 Ga0501044_0446946_11_802 262
31 3300042134 Ga0450898_032621 Ga0450898_032621_62_865 263
32 3300009147 Ga0114129_10113615 Ga0114129_101136152 265
33 3300039450 Ga0436363_1095800 Ga0436363_1095800_89_967 265
34 3300050510 nmdc:mga06r32_211438_c1 nmdc:mga06r32_211438_c1_688_1494 265
35 iso_pu_bacteria 2881412998 2881418055 266
36 3300005331 Ga0070670_100175955 Ga0070670_1001759552 267
37 3300025925 Ga0207650_10051380 Ga0207650_100513801 267
38 3300003320 rootH2_10006890 rootH2_100068906 269
39 3300005366 Ga0070659_100260422 Ga0070659_1002604221 270
40 3300049581 Ga0501047_0299870 Ga0501047_0299870_108_974 270
41 3300049823 Ga0501044_0020605 Ga0501044_0020605_1732_2598 270
42 3300006847 Ga0075431_100257981 Ga0075431_1002579812 271
43 3300048929 Ga0496126_0362872 Ga0496126_0362872_302_1162 271
44 3300005327 Ga0070658_10035583 Ga0070658_100355833 274
45 3300005336 Ga0070680_100025329 Ga0070680_1000253292 274
46 3300005339 Ga0070660_100005639 Ga0070660_1000056394 274
47 3300005341 Ga0070691_10001420 Ga0070691_100014207 274
48 3300005366 Ga0070659_100005869 Ga0070659_1000058691 274
49 3300005458 Ga0070681_10042011 Ga0070681_100420112 274
50 3300005539 Ga0068853_100025151 Ga0068853_1000251512 274
51 3300005563 Ga0068855_100152460 Ga0068855_1001524601 274
52 3300009174 Ga0105241_10406450 Ga0105241_104064501 274
53 3300009551 Ga0105238_10007695 Ga0105238_1000769510 274
54 3300013104 Ga0157370_10031719 Ga0157370_100317194 274
55 3300013307 Ga0157372_10007501 Ga0157372_100075012 274
56 3300025909 Ga0207705_10000039 Ga0207705_1000003938 274
57 3300025911 Ga0207654_10249307 Ga0207654_102493071 274
58 3300025912 Ga0207707_10007873 Ga0207707_100078736 274
59 3300025917 Ga0207660_10000955 Ga0207660_1000095515 274
60 3300025919 Ga0207657_10001376 Ga0207657_100013766 274
61 3300025921 Ga0207652_10001664 Ga0207652_100016644 274
62 3300025924 Ga0207694_10031397 Ga0207694_100313972 274
63 3300025932 Ga0207690_10049793 Ga0207690_100497932 274
64 3300026041 Ga0207639_10044286 Ga0207639_100442862 274
65 3300046491 Ga0495584_0000356 Ga0495584_0000356_22711_23595 274
66 3300046492 Ga0495585_0025235 Ga0495585_0025235_1692_2576 274
67 3300046492 Ga0495585_0032261 Ga0495585_0032261_1807_2691 274
68 3300046501 Ga0495607_0013731 Ga0495607_0013731_1145_2029 274
69 3300046512 Ga0495610_0038701 Ga0495610_0038701_860_1744 274
70 3300046513 Ga0495616_0013338 Ga0495616_0013338_1827_2711 274
71 3300046558 Ga0495633_0065573 Ga0495633_0065573_136_1020 274
72 3300046665 Ga0495661_0031923 Ga0495661_0031923_2367_3251 274
73 3300046691 Ga0495670_0012387 Ga0495670_0012387_2578_3462 274
74 3300009094 Ga0111539_10150818 Ga0111539_101508181 275
75 3300049823 Ga0501044_0038477 Ga0501044_0038477_691_1554 275
76 3300049823 Ga0501044_0061866 Ga0501044_0061866_2440_3303 275
77 3300050511 nmdc:mga08y16_327565_c1 nmdc:mga08y16_327565_c1_637_1515 275
78 3300049823 Ga0501044_0312343 Ga0501044_0312343_443_1309 276
79 3300014326 Ga0157380_10602581 Ga0157380_106025812 277
80 3300005535 Ga0070684_100531231 Ga0070684_1005312311 278
81 3300021361 Ga0213872_10006588 Ga0213872_100065885 278
82 3300025944 Ga0207661_10068051 Ga0207661_100680513 278
83 3300021361 Ga0213872_10000450 Ga0213872_1000045010 279
84 3300039447 Ga0436361_0719937 Ga0436361_0719937_8747_9631 279
85 3300046500 Ga0495596_0002163 Ga0495596_0002163_1038_1922 280
86 3300046684 Ga0495669_0000888 Ga0495669_0000888_2021_2905 280
87 3300048091 Ga0495626_0020529 Ga0495626_0020529_1511_2395 280
88 3300049568 Ga0501031_0017538 Ga0501031_0017538_1696_2559 280
89 3300049569 Ga0501032_0026617 Ga0501032_0026617_1545_2408 280
90 3300049574 Ga0501038_0052405 Ga0501038_0052405_2186_3049 280
91 3300049579 Ga0501043_0048752 Ga0501043_0048752_1392_2255 280
92 3300049581 Ga0501047_0111211 Ga0501047_0111211_536_1399 280
93 3300049586 Ga0501070_0000018 Ga0501070_0000018_17173_18036 280
94 3300049742 Ga0501080_0001258 Ga0501080_0001258_17101_17964 280
95 3300049822 Ga0501035_0002267 Ga0501035_0002267_17023_17886 280
96 3300049823 Ga0501044_0010434 Ga0501044_0010434_5768_6631 280
97 3300005445 Ga0070708_100517794 Ga0070708_1005177941 281
98 3300005471 Ga0070698_100044361 Ga0070698_1000443613 281
99 3300046499 Ga0495594_0236674 Ga0495594_0236674_131_985 281
100 3300060353 Ga0501082_0346960 Ga0501082_0346960_381_1268 281
101 iso_pu_bacteria 2855730933 2855734814 281
102 iso_pu_bacteria 2855767633 2855770598 281
103 3300006846 Ga0075430_100267290 Ga0075430_1002672901 282
104 3300005617 Ga0068859_100019312 Ga0068859_1000193122 283
105 3300005840 Ga0068870_10163907 Ga0068870_101639071 283
106 3300006931 Ga0097620_100019313 Ga0097620_1000193136 283
107 3300025918 Ga0207662_10117503 Ga0207662_101175032 283
108 3300026116 Ga0207674_10081589 Ga0207674_100815893 283
109 3300005338 Ga0068868_100055991 Ga0068868_1000559912 284
110 3300005366 Ga0070659_100144181 Ga0070659_1001441812 284
111 3300006844 Ga0075428_100000811 Ga0075428_10000081110 284
112 3300006852 Ga0075433_10152379 Ga0075433_101523792 284
113 3300006871 Ga0075434_100163305 Ga0075434_1001633051 284
114 3300007076 Ga0075435_100493673 Ga0075435_1004936732 284
115 3300009147 Ga0114129_10477861 Ga0114129_104778612 284
116 3300009147 Ga0114129_10638090 Ga0114129_106380902 284
117 3300009176 Ga0105242_10417047 Ga0105242_104170472 284
118 3300014326 Ga0157380_10247900 Ga0157380_102479002 284
119 3300025917 Ga0207660_10087443 Ga0207660_100874432 284
120 3300031344 Ga0265316_10404845 Ga0265316_104048451 284
121 3300044673 Ga0453683_0034988 Ga0453683_0034988_414_1277 284
122 3300050513 nmdc:mga0rr50_445852_c1 nmdc:mga0rr50_445852_c1_121_984 284
123 3300050515 nmdc:mga0a205_172915_c1 nmdc:mga0a205_172915_c1_298_1161 284
124 3300005331 Ga0070670_100409620 Ga0070670_1004096201 285
125 3300005353 Ga0070669_100343569 Ga0070669_1003435692 285
126 3300005354 Ga0070675_100009142 Ga0070675_1000091421 285
127 3300005364 Ga0070673_100014261 Ga0070673_1000142611 285
128 3300005459 Ga0068867_100259372 Ga0068867_1002593721 285
129 3300005466 Ga0070685_10041079 Ga0070685_100410792 285
130 3300005843 Ga0068860_100300631 Ga0068860_1003006312 285
131 3300005844 Ga0068862_100240548 Ga0068862_1002405482 285
132 3300006237 Ga0097621_100390526 Ga0097621_1003905262 285
133 3300025926 Ga0207659_10040022 Ga0207659_100400222 285
134 3300026095 Ga0207676_10548749 Ga0207676_105487491 285
135 3300026121 Ga0207683_10370552 Ga0207683_103705522 285
136 3300028577 Ga0265318_10050489 Ga0265318_100504892 285
137 3300031240 Ga0265320_10001775 Ga0265320_100017751 285
138 3300031711 Ga0265314_10002970 Ga0265314_100029709 285
139 3300033180 Ga0307510_10059672 Ga0307510_100596723 285
140 3300048921 Ga0496118_0002197 Ga0496118_0002197_13283_14179 285
141 3300049570 Ga0501033_0014868 Ga0501033_0014868_1154_2017 285
142 3300049573 Ga0501037_0022850 Ga0501037_0022850_1081_1944 285
143 3300049823 Ga0501044_0083970 Ga0501044_0083970_1697_2560 285
144 3300025939 Ga0207665_10223208 Ga0207665_102232081 286
145 3300050513 nmdc:mga0rr50_33756_c1 nmdc:mga0rr50_33756_c1_885_1763 286
146 3300003354 JGI25160J50197_1003860 JGI25160J50197_10038602 287
147 3300046558 Ga0495633_0001408 Ga0495633_0001408_8896_9804 287
148 iso_pu_bacteria 2857537821 2857541820 287
149 iso_pu_bacteria 2857576091 2857580535 287
150 3300009176 Ga0105242_10019649 Ga0105242_100196492 288
151 3300025934 Ga0207686_10186505 Ga0207686_101865051 288
152 iso_pu_bacteria 2881927736 2881928785 288
153 3300042007 Ga0439449_0000726 Ga0439449_0000726_1139_2047 289
154 3300048926 Ga0496123_0066365 Ga0496123_0066365_347_1252 289
155 3300032004 Ga0307414_10067944 Ga0307414_100679442 291
156 3300046471 Ga0495650_0000133 Ga0495650_0000133_93241_94119 291
157 iso_pu_bacteria 2739367655 2739613706 291
158 3300037312 Ga0395899_0034905 Ga0395899_0034905_2614_3495 292
159 3300046471 Ga0495650_0002505 Ga0495650_0002505_5185_6066 292
160 iso_pu_bacteria 2932422444 2932423174 292
161 3300037471 Ga0395905_0004088 Ga0395905_0004088_12908_13891 293
162 3300044658 Ga0466972_0000595 Ga0466972_0000595_3678_4562 293
163 3300048917 Ga0496114_0011066 Ga0496114_0011066_3005_3889 293
164 3300048928 Ga0496125_0004092 Ga0496125_0004092_8575_9459 293
165 3300048929 Ga0496126_0309150 Ga0496126_0309150_243_1127 293
166 3300050489 nmdc:mga03683_41937_c1 nmdc:mga03683_41937_c1_252_1139 294
167 iso_pu_bacteria 2513020051 2513228165 294
168 iso_pu_bacteria 2547132374 2548499878 294
169 iso_pu_bacteria 2599185214 2599626979 294
170 iso_pu_bacteria 2599185226 2599676225 294
171 iso_pu_bacteria 2599185227 2599684537 294
172 iso_pu_bacteria 2599185229 2599696530 294
173 iso_pu_bacteria 2643221570 2643868105 294
174 iso_pu_bacteria 2643221596 2643993892 294
175 iso_pu_bacteria 2643221609 2644059676 294
176 iso_pu_bacteria 2643221611 2644074819 294
177 iso_pu_bacteria 2643221652 2644293715 294
178 iso_pu_bacteria 2643221658 2644324707 294
179 iso_pu_bacteria 2643221672 2644396570 294
180 iso_pu_bacteria 2643221717 2644644804 294
181 iso_pu_bacteria 2738541277 2738718927 294
182 iso_pu_bacteria 2738541307 2738879965 294
183 iso_pu_bacteria 2738543019 2739281689 294
184 iso_pu_bacteria 2831265667 2831271378 294
185 iso_pu_bacteria 2838054893 2838055915 294
186 iso_pu_bacteria 2842718218 2842721402 294
187 iso_pu_bacteria 2885198086 2885200536 294
188 iso_pu_bacteria 2885211737 2885214681 294
189 iso_pu_bacteria 2928070936 2928076599 294
190 iso_pu_bacteria 2928084124 2928089277 294
191 iso_pu_bacteria 2928115317 2928119152 294
192 iso_pu_bacteria 2974320154 2974322510 294
193 iso_pu_bacteria 2990710928 2990713535 294
194 iso_pu_bacteria 2643221628 2644160458 295
195 iso_pu_bacteria 2643221683 2644465527 295
196 iso_pu_bacteria 2818991446 2819599405 295
197 iso_pu_bacteria 2842677519 2842678083 295
198 iso_pu_bacteria 2842733646 2842734454 295
199 iso_pu_bacteria 2842747753 2842749308 295
200 iso_pu_bacteria 2899924645 2899925855 295
201 iso_pu_bacteria 2904449895 2904450370 295
202 iso_pu_bacteria 2904456579 2904456807 295
203 iso_pu_bacteria 2904541872 2904544340 295
204 iso_pu_bacteria 2919462493 2919463199 295
205 iso_pu_bacteria 2928037797 2928041757 295
206 iso_pu_bacteria 2928044640 2928049321 295
207 iso_pu_bacteria 2928051484 2928052071 295
208 iso_pu_bacteria 2928064002 2928065249 295
209 iso_pu_bacteria 2929160207 2929162089 295
210 iso_pu_bacteria 2929520902 2929521081 295
211 iso_pu_bacteria 2945909444 2945913502 295
212 iso_pu_bacteria 2945945610 2945949098 295
213 iso_pu_bacteria 2945972063 2945973143 295
214 iso_pu_bacteria 2945984333 2945991106 295
215 iso_pu_bacteria 2954767861 2954768458 295
216 3300003781 Ga0055536_1002571 Ga0055536_10025714 297
217 3300003791 Ga0055530_10009360 Ga0055530_100093603 297
218 3300003792 Ga0055540_1001201 Ga0055540_10012014 297
219 3300003794 Ga0055531_10004887 Ga0055531_100048874 297
220 3300005366 Ga0070659_100155194 Ga0070659_1001551942 297
221 3300005563 Ga0068855_100073244 Ga0068855_1000732445 297
222 3300005564 Ga0070664_100067208 Ga0070664_1000672084 297
223 3300005616 Ga0068852_100484267 Ga0068852_1004842671 297
224 3300006038 Ga0075365_10031561 Ga0075365_100315613 297
225 3300006178 Ga0075367_10016392 Ga0075367_100163923 297
226 3300006178 Ga0075367_10141192 Ga0075367_101411922 297
227 3300006195 Ga0075366_10021165 Ga0075366_100211655 297
228 3300006353 Ga0075370_10001218 Ga0075370_100012187 297
229 3300006358 Ga0068871_100308313 Ga0068871_1003083132 297
230 3300009036 Ga0105244_10001450 Ga0105244_100014507 297
231 3300009148 Ga0105243_10002901 Ga0105243_1000290111 297
232 3300009545 Ga0105237_10065271 Ga0105237_100652713 297
233 3300009551 Ga0105238_10228074 Ga0105238_102280741 297
234 3300010375 Ga0105239_10140231 Ga0105239_101402312 297
235 3300011119 Ga0105246_10007932 Ga0105246_100079326 297
236 3300013100 Ga0157373_10101898 Ga0157373_101018982 297
237 3300013105 Ga0157369_10005741 Ga0157369_100057417 297
238 3300014497 Ga0182008_10002350 Ga0182008_100023507 297
239 3300015261 Ga0182006_1007232 Ga0182006_10072323 297
240 3300015262 Ga0182007_10000224 Ga0182007_100002245 297
241 3300025292 Ga0209676_1001478 Ga0209676_100147812 297
242 3300025298 Ga0209050_1001106 Ga0209050_100110624 297
243 3300025303 Ga0209051_1000145 Ga0209051_100014571 297
244 3300025304 Ga0209257_1000724 Ga0209257_10007248 297
245 3300025914 Ga0207671_10049925 Ga0207671_100499252 297
246 3300025933 Ga0207706_10009870 Ga0207706_100098705 297
247 3300025935 Ga0207709_10001820 Ga0207709_100018207 297
248 3300025945 Ga0207679_10023073 Ga0207679_100230735 297
249 3300026041 Ga0207639_10272273 Ga0207639_102722732 297
250 3300026067 Ga0207678_10373051 Ga0207678_103730511 297
251 3300026142 Ga0207698_10346951 Ga0207698_103469512 297
252 3300048919 Ga0496116_0031905 Ga0496116_0031905_1511_2407 297
253 3300048920 Ga0496117_0006420 Ga0496117_0006420_3107_4003 297
254 3300048921 Ga0496118_0020452 Ga0496118_0020452_45_941 297
255 3300048924 Ga0496121_0058274 Ga0496121_0058274_1266_2162 297
256 3300048925 Ga0496122_0015415 Ga0496122_0015415_3439_4332 297
257 3300048926 Ga0496123_0031241 Ga0496123_0031241_150_1043 297
258 3300048926 Ga0496123_0054024 Ga0496123_0054024_416_1309 297
259 3300048927 Ga0496124_0040584 Ga0496124_0040584_1414_2310 297
260 3300048927 Ga0496124_0086727 Ga0496124_0086727_1509_2405 297
261 3300048928 Ga0496125_0011633 Ga0496125_0011633_6064_6960 297
262 3300048928 Ga0496125_0015819 Ga0496125_0015819_3416_4309 297
263 3300048929 Ga0496126_0016962 Ga0496126_0016962_3371_4264 297
264 3300050490 nmdc:mga03n38_105237_c1 nmdc:mga03n38_105237_c1_114_1010 297
265 3300050492 nmdc:mga0yw44_320632_c1 nmdc:mga0yw44_320632_c1_104_997 297
266 3300050493 nmdc:mga0k408_35738_c1 nmdc:mga0k408_35738_c1_1362_2255 297
267 3300002739 JGI25158J39367_1004642 JGI25158J39367_10046422 298
268 3300002773 JGI25152J39213_1001766 JGI25152J39213_10017667 298
269 3300002774 JGI25150J39212_1001970 JGI25150J39212_10019705 298
270 3300002987 JGI25159J45721_1006281 JGI25159J45721_10062812 298
271 3300002987 JGI25159J45721_1010680 JGI25159J45721_10106802 298
272 3300003187 JGI25151J46595_10001305 JGI25151J46595_1000130513 298
273 3300003187 JGI25151J46595_10003396 JGI25151J46595_100033967 298
274 3300003187 JGI25151J46595_10005187 JGI25151J46595_100051872 298
275 3300003215 JGI25153J46596_10003476 JGI25153J46596_100034764 298
276 3300003354 JGI25160J50197_1003174 JGI25160J50197_10031746 298
277 3300003578 Ga0006562J51391_1025869 Ga0006562J51391_10258693 298
278 3300003761 Ga0055535_1000076 Ga0055535_100007636 298
279 3300003762 Ga0055542_1000009 Ga0055542_1000009176 298
280 3300003771 Ga0055526_1004156 Ga0055526_10041564 298
281 3300003771 Ga0055526_1004167 Ga0055526_10041677 298
282 3300003773 Ga0055537_1000011 Ga0055537_100001160 298
283 3300003773 Ga0055537_1000923 Ga0055537_10009235 298
284 3300003773 Ga0055537_1001543 Ga0055537_10015437 298
285 3300003775 Ga0055524_1002772 Ga0055524_10027727 298
286 3300003775 Ga0055524_1002784 Ga0055524_10027847 298
287 3300003781 Ga0055536_1011581 Ga0055536_10115811 298
288 3300003784 Ga0055534_1000020 Ga0055534_100002075 298
289 3300003784 Ga0055534_1001303 Ga0055534_10013037 298
290 3300003784 Ga0055534_1001594 Ga0055534_10015944 298
291 3300003790 Ga0055528_1002850 Ga0055528_10028505 298
292 3300003790 Ga0055528_1002956 Ga0055528_10029567 298
293 3300003790 Ga0055528_1004218 Ga0055528_10042183 298
294 3300003791 Ga0055530_10002123 Ga0055530_100021238 298
295 3300003791 Ga0055530_10013964 Ga0055530_100139641 298
296 3300003792 Ga0055540_1000970 Ga0055540_100097012 298
297 3300003792 Ga0055540_1002506 Ga0055540_10025062 298
298 3300003794 Ga0055531_10011049 Ga0055531_100110494 298
299 3300003794 Ga0055531_10011379 Ga0055531_100113794 298
300 3300003794 Ga0055531_10037433 Ga0055531_100374331 298
301 3300004625 Ga0055543_1001908 Ga0055543_10019084 298
302 3300004625 Ga0055543_1003088 Ga0055543_10030884 298
303 3300005262 Ga0065165_1004364 Ga0065165_10043644 298
304 3300005262 Ga0065165_1004610 Ga0065165_10046107 298
305 3300005288 Ga0065714_10007961 Ga0065714_100079612 298
306 3300005289 Ga0065704_10088434 Ga0065704_100884341 298
307 3300005331 Ga0070670_100232846 Ga0070670_1002328462 298
308 3300005344 Ga0070661_100054780 Ga0070661_1000547801 298
309 3300005353 Ga0070669_100042315 Ga0070669_1000423153 298
310 3300005367 Ga0070667_100148110 Ga0070667_1001481103 298
311 3300005539 Ga0068853_100022227 Ga0068853_1000222275 298
312 3300005834 Ga0068851_10020884 Ga0068851_100208843 298
313 3300006038 Ga0075365_10006099 Ga0075365_100060992 298
314 3300006042 Ga0075368_10092573 Ga0075368_100925732 298
315 3300006048 Ga0075363_100005316 Ga0075363_1000053164 298
316 3300006048 Ga0075363_100010449 Ga0075363_1000104492 298
317 3300006051 Ga0075364_10028688 Ga0075364_100286883 298
318 3300006177 Ga0075362_10009694 Ga0075362_100096943 298
319 3300006177 Ga0075362_10012021 Ga0075362_100120213 298
320 3300006178 Ga0075367_10023646 Ga0075367_100236462 298
321 3300006178 Ga0075367_10036594 Ga0075367_100365943 298
322 3300006186 Ga0075369_10135325 Ga0075369_101353251 298
323 3300006195 Ga0075366_10010276 Ga0075366_100102764 298
324 3300006195 Ga0075366_10053767 Ga0075366_100537672 298
325 3300006353 Ga0075370_10009988 Ga0075370_100099885 298
326 3300006353 Ga0075370_10024203 Ga0075370_100242034 298
327 3300006353 Ga0075370_10102925 Ga0075370_101029252 298
328 3300006948 Ga0099826_10000588 Ga0099826_100005887 298
329 3300006948 Ga0099826_10033207 Ga0099826_100332071 298
330 3300009036 Ga0105244_10122015 Ga0105244_101220151 298
331 3300009093 Ga0105240_10311730 Ga0105240_103117302 298
332 3300009148 Ga0105243_10120013 Ga0105243_101200132 298
333 3300011119 Ga0105246_10157921 Ga0105246_101579212 298
334 3300012505 Ga0157339_1000867 Ga0157339_10008672 298
335 3300013100 Ga0157373_10026317 Ga0157373_100263174 298
336 3300013102 Ga0157371_10094037 Ga0157371_100940372 298
337 3300013104 Ga0157370_10016161 Ga0157370_100161615 298
338 3300013307 Ga0157372_10064257 Ga0157372_100642574 298
339 3300014497 Ga0182008_10000761 Ga0182008_1000076110 298
340 3300014497 Ga0182008_10007271 Ga0182008_100072713 298
341 3300017792 Ga0163161_10000042 Ga0163161_1000004266 298
342 3300017792 Ga0163161_10006628 Ga0163161_1000662810 298
343 3300025242 Ga0209258_100009 Ga0209258_100009476 298
344 3300025245 Ga0207425_1001199 Ga0207425_10011993 298
345 3300025254 Ga0209148_1000007 Ga0209148_1000007476 298
346 3300025258 Ga0209129_1000013 Ga0209129_1000013128 298
347 3300025258 Ga0209129_1004225 Ga0209129_10042255 298
348 3300025258 Ga0209129_1005320 Ga0209129_10053202 298
349 3300025263 Ga0209565_1000058 Ga0209565_1000058114 298
350 3300025263 Ga0209565_1000197 Ga0209565_100019777 298
351 3300025263 Ga0209565_1000898 Ga0209565_100089811 298
352 3300025273 Ga0209673_1000053 Ga0209673_1000053190 298
353 3300025273 Ga0209673_1000279 Ga0209673_100027971 298
354 3300025273 Ga0209673_1000316 Ga0209673_100031617 298
355 3300025273 Ga0209673_1002609 Ga0209673_10026095 298
356 3300025284 Ga0209130_1000158 Ga0209130_100015824 298
357 3300025284 Ga0209130_1000363 Ga0209130_100036332 298
358 3300025284 Ga0209130_1001291 Ga0209130_100129111 298
359 3300025291 Ga0209675_1000010 Ga0209675_1000010471 298
360 3300025291 Ga0209675_1000130 Ga0209675_100013036 298
361 3300025291 Ga0209675_1001105 Ga0209675_100110512 298
362 3300025291 Ga0209675_1003230 Ga0209675_10032302 298
363 3300025292 Ga0209676_1000108 Ga0209676_1000108180 298
364 3300025292 Ga0209676_1000240 Ga0209676_100024092 298
365 3300025292 Ga0209676_1004198 Ga0209676_10041985 298
366 3300025292 Ga0209676_1046669 Ga0209676_10466691 298
367 3300025294 Ga0209025_1000103 Ga0209025_1000103102 298
368 3300025294 Ga0209025_1000129 Ga0209025_100012975 298
369 3300025294 Ga0209025_1000169 Ga0209025_100016986 298
370 3300025294 Ga0209025_1008272 Ga0209025_10082726 298
371 3300025294 Ga0209025_1020699 Ga0209025_10206993 298
372 3300025295 Ga0209564_1000171 Ga0209564_100017186 298
373 3300025295 Ga0209564_1000880 Ga0209564_100088021 298
374 3300025297 Ga0209758_1000067 Ga0209758_1000067127 298
375 3300025297 Ga0209758_1002173 Ga0209758_10021737 298
376 3300025298 Ga0209050_1000002 Ga0209050_1000002438 298
377 3300025298 Ga0209050_1007625 Ga0209050_10076253 298
378 3300025299 Ga0209256_1000077 Ga0209256_100007732 298
379 3300025299 Ga0209256_1000121 Ga0209256_100012186 298
380 3300025302 Ga0207426_1000101 Ga0207426_1000101128 298
381 3300025302 Ga0207426_1000129 Ga0207426_1000129131 298
382 3300025303 Ga0209051_1000002 Ga0209051_1000002206 298
383 3300025303 Ga0209051_1000101 Ga0209051_100010144 298
384 3300025303 Ga0209051_1000289 Ga0209051_100028984 298
385 3300025304 Ga0209257_1000002 Ga0209257_1000002347 298
386 3300025304 Ga0209257_1001897 Ga0209257_10018979 298
387 3300025304 Ga0209257_1003663 Ga0209257_10036638 298
388 3300025304 Ga0209257_1008409 Ga0209257_10084095 298
389 3300025923 Ga0207681_10007556 Ga0207681_100075568 298
390 3300025935 Ga0207709_10000094 Ga0207709_10000094100 298
391 3300026041 Ga0207639_10024626 Ga0207639_100246262 298
392 3300026116 Ga0207674_10034527 Ga0207674_100345275 298
393 3300027665 Ga0209983_1007187 Ga0209983_10071871 298
394 3300027682 Ga0209971_1005865 Ga0209971_10058654 298
395 3300027876 Ga0209974_10051955 Ga0209974_100519552 298
396 3300028380 Ga0268265_10175282 Ga0268265_101752822 298
397 3300028573 Ga0265334_10024567 Ga0265334_100245673 298
398 3300028577 Ga0265318_10017891 Ga0265318_100178913 298
399 3300030731 Ga0316177_1102455 Ga0316177_11024553 298
400 3300030733 Ga0314311_1046235 Ga0314311_10462352 298
401 3300030734 Ga0316179_1082949 Ga0316179_10829492 298
402 3300030735 Ga0316178_1022865 Ga0316178_10228651 298
403 3300030736 Ga0316180_1127423 Ga0316180_11274232 298
404 3300030742 Ga0316183_1035123 Ga0316183_10351236 298
405 3300030745 Ga0316182_1269749 Ga0316182_12697494 298
406 3300031235 Ga0265330_10000022 Ga0265330_10000022106 298
407 3300031238 Ga0265332_10000001 Ga0265332_10000001615 298
408 3300031241 Ga0265325_10021899 Ga0265325_100218994 298
409 3300031247 Ga0265340_10020214 Ga0265340_100202144 298
410 3300031548 Ga0307408_100000186 Ga0307408_10000018662 298
411 3300031548 Ga0307408_100413942 Ga0307408_1004139422 298
412 3300031548 Ga0307408_100459205 Ga0307408_1004592051 298
413 3300031711 Ga0265314_10000013 Ga0265314_10000013202 298
414 3300031730 Ga0307516_10329492 Ga0307516_103294921 298
415 3300031731 Ga0307405_10090777 Ga0307405_100907772 298
416 3300031731 Ga0307405_10205863 Ga0307405_102058632 298
417 3300031901 Ga0307406_10000267 Ga0307406_100002673 298
418 3300031901 Ga0307406_10000468 Ga0307406_1000046818 298
419 3300031901 Ga0307406_10290457 Ga0307406_102904571 298
420 3300031903 Ga0307407_10098896 Ga0307407_100988962 298
421 3300031911 Ga0307412_10004531 Ga0307412_100045317 298
422 3300031911 Ga0307412_10179510 Ga0307412_101795102 298
423 3300031911 Ga0307412_10273496 Ga0307412_102734962 298
424 3300031911 Ga0307412_10288529 Ga0307412_102885292 298
425 3300031911 Ga0307412_10405885 Ga0307412_104058851 298
426 3300032002 Ga0307416_100231123 Ga0307416_1002311232 298
427 3300032004 Ga0307414_10042997 Ga0307414_100429972 298
428 3300041411 Ga0439466_0011610 Ga0439466_0011610_1199_2098 298
429 3300041413 Ga0439465_0014736 Ga0439465_0014736_1101_2000 298
430 3300042002 Ga0439442_001645 Ga0439442_001645_2715_3614 298
431 3300042015 Ga0439462_0013129 Ga0439462_0013129_361_1272 298
432 3300042121 Ga0450919_005324 Ga0450919_005324_46_945 298
433 3300042184 Ga0450908_001104 Ga0450908_001104_3917_4816 298
434 3300042435 Ga0439434_0004359 Ga0439434_0004359_1168_2067 298
435 3300042531 Ga0450918_005186 Ga0450918_005186_704_1603 298
436 3300046453 Ga0495627_020882 Ga0495627_020882_218_1117 298
437 3300046462 Ga0495651_0087753 Ga0495651_0087753_36_932 298
438 3300046512 Ga0495610_0020950 Ga0495610_0020950_1958_2854 298
439 3300046512 Ga0495610_0055741 Ga0495610_0055741_332_1231 298
440 3300046518 Ga0495631_0004507 Ga0495631_0004507_1968_2864 298
441 3300046520 Ga0495637_0005324 Ga0495637_0005324_1486_2385 298
442 3300046520 Ga0495637_0107174 Ga0495637_0107174_130_1026 298
443 3300046530 Ga0495654_0002029 Ga0495654_0002029_7591_8502 298
444 3300046538 Ga0495609_0059439 Ga0495609_0059439_742_1641 298
445 3300046539 Ga0495621_0000487 Ga0495621_0000487_7017_7913 298
446 3300046616 Ga0495668_0028386 Ga0495668_0028386_672_1568 298
447 3300046660 Ga0495625_0000250 Ga0495625_0000250_65483_66382 298
448 3300046660 Ga0495625_0037304 Ga0495625_0037304_1943_2839 298
449 3300046663 Ga0495635_0143816 Ga0495635_0143816_358_1254 298
450 3300046674 Ga0495588_0041125 Ga0495588_0041125_966_1862 298
451 3300046674 Ga0495588_0122571 Ga0495588_0122571_379_1278 298
452 3300046683 Ga0495658_0042903 Ga0495658_0042903_139_1035 298
453 3300046683 Ga0495658_0166657 Ga0495658_0166657_437_1336 298
454 3300046691 Ga0495670_0023131 Ga0495670_0023131_259_1158 298
455 3300046692 Ga0495671_0003897 Ga0495671_0003897_6720_7619 298
456 3300047321 Ga0495676_0005231 Ga0495676_0005231_6743_7639 298
457 3300048089 Ga0495614_0008452 Ga0495614_0008452_1866_2762 298
458 3300048903 Ga0496100_0427430 Ga0496100_0427430_43_939 298
459 3300048919 Ga0496116_0173516 Ga0496116_0173516_181_1080 298
460 3300048919 Ga0496116_0177166 Ga0496116_0177166_31_927 298
461 3300048920 Ga0496117_0022799 Ga0496117_0022799_2366_3265 298
462 3300048920 Ga0496117_0171154 Ga0496117_0171154_158_1054 298
463 3300048924 Ga0496121_0139927 Ga0496121_0139927_578_1474 298
464 3300048925 Ga0496122_0001063 Ga0496122_0001063_21805_22716 298
465 3300048925 Ga0496122_0098331 Ga0496122_0098331_33_929 298
466 3300048926 Ga0496123_0000246 Ga0496123_0000246_61426_62337 298
467 3300048927 Ga0496124_0035302 Ga0496124_0035302_1921_2832 298
468 3300048927 Ga0496124_0065223 Ga0496124_0065223_636_1535 298
469 3300048928 Ga0496125_0046020 Ga0496125_0046020_1003_1902 298
470 3300048928 Ga0496125_0178884 Ga0496125_0178884_245_1141 298
471 3300049663 Ga0501223_035495 Ga0501223_035495_51_950 298
472 3300049679 Ga0501249_001227 Ga0501249_001227_4464_5363 298
473 3300049759 Ga0501262_000085 Ga0501262_000085_4339_5238 298
474 3300050489 nmdc:mga03683_13018_c1 nmdc:mga03683_13018_c1_1414_2322 298
475 3300050489 nmdc:mga03683_3582_c1 nmdc:mga03683_3582_c1_3355_4254 298
476 3300050490 nmdc:mga03n38_15837_c1 nmdc:mga03n38_15837_c1_591_1490 298
477 3300050490 nmdc:mga03n38_35105_c1 nmdc:mga03n38_35105_c1_527_1426 298
478 3300050491 nmdc:mga00v17_9638_c1 nmdc:mga00v17_9638_c1_54_962 298
479 3300050492 nmdc:mga0yw44_10228_c1 nmdc:mga0yw44_10228_c1_3558_4457 298
480 3300050493 nmdc:mga0k408_42474_c1 nmdc:mga0k408_42474_c1_997_1896 298
481 3300050493 nmdc:mga0k408_5785_c1 nmdc:mga0k408_5785_c1_1434_2333 298
482 3300050494 nmdc:mga06z11_113495_c1 nmdc:mga06z11_113495_c1_84_983 298
483 3300050494 nmdc:mga06z11_46838_c1 nmdc:mga06z11_46838_c1_771_1670 298
484 3300050496 nmdc:mga07m45_185497_c1 nmdc:mga07m45_185497_c1_126_1025 298
485 3300050496 nmdc:mga07m45_477_c1 nmdc:mga07m45_477_c1_13989_14888 298
486 3300053079 Ga0500610_0014943 Ga0500610_0014943_1282_2181 298
487 3300053090 Ga0500646_0017187 Ga0500646_0017187_516_1427 298
488 3300053093 Ga0500651_0000107 Ga0500651_0000107_47242_48138 298
489 3300053110 Ga0500571_000836 Ga0500571_000836_5916_6812 298
490 3300053117 Ga0500593_000288 Ga0500593_000288_1615_2514 298
491 3300053121 Ga0500607_003871 Ga0500607_003871_6332_7231 298
492 3300053121 Ga0500607_015342 Ga0500607_015342_1068_1964 298
493 3300053133 Ga0500655_000799 Ga0500655_000799_1917_2813 298
494 3300053134 Ga0500658_0000554 Ga0500658_0000554_8684_9580 298
495 3300053136 Ga0500559_0000783 Ga0500559_0000783_8013_8924 298
496 3300053136 Ga0500559_0003895 Ga0500559_0003895_5747_6643 298
497 3300053136 Ga0500559_0006920 Ga0500559_0006920_3814_4725 298
498 3300053138 Ga0500564_013092 Ga0500564_013092_2182_3078 298
499 3300053139 Ga0500568_0002458 Ga0500568_0002458_5439_6335 298
500 3300053140 Ga0500573_0104437 Ga0500573_0104437_178_1089 298
501 3300053141 Ga0500574_001493 Ga0500574_001493_1016_1912 298
502 3300053156 Ga0500622_0173185 Ga0500622_0173185_61_972 298
503 3300053157 Ga0500624_002853 Ga0500624_002853_1124_2020 298
504 3300053158 Ga0500627_0001255 Ga0500627_0001255_4639_5538 298
505 3300053161 Ga0500634_0093612 Ga0500634_0093612_322_1221 298
506 3300053162 Ga0500638_003444 Ga0500638_003444_377_1273 298
507 3300053735 Ga0500596_011673 Ga0500596_011673_224_1120 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

85

311

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.9739 57 293
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.9539 57 293
1din-assembly1.cif.gz_A dienelactone hydrolase at 2.8 angstroms 0.882 62 293
1zi6-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s) mutant- 1.7 a 0.8806 62 293
4u2b-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (c123s) at 1.70 a resolution 0.8771 62 295
ID Description Score Start End Superfamily
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9612 57 293 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9413 57 293 3.40.50.1820
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8724 62 293 3.40.50.1820
af_A0A0P0Y160_2_157_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8671 145 293 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8647 60 292 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A257P1I4-F1-model_v4 Carboxymethylenebutenolidase 0.9933 80 297 GO:0016787
AF-A0A3A8HD05-F1-model_v4 Dienelactone hydrolase family protein 0.9924 78 227 GO:0016787
AF-A0A7W8WRI0-F1-model_v4 Carboxymethylenebutenolidase (EC 3.1.1.45) 0.991 91 298 GO:0008806
AF-A0A542LNT6-F1-model_v4 Carboxymethylenebutenolidase 0.9903 49 298 GO:0016787
AF-A0A259PF19-F1-model_v4 Carboxymethylenebutenolidase 0.9897 102 298 GO:0016787

Feature Viewer

pLDDT pTM Quality
87 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map