F456567

General Info

Members Datasets Scaffolds Average Seq Length
506 285 1012 161

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0020873|Ga0495580_0020873_4218_4736
Length 172
Sequence MSPVPILPPPLPGGRIWRFGDNVDTDQMAPGIHMKGGVEEIARHCLAGLRPEFPATVRPGDLLVAGRNFGAGSSREQAPQALRQLGLAAVIAPSFAGLFYRNAINLGLPVLTCPDTTRLVDGGLARLELERACLLLPDGSQVVCEPIPDFLRALLRAGGLVPHLKTRLAAQR

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
147 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
176 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
177 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
178 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
179 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
180 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
181 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
182 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
223 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
224 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
270 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
271 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
272 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
273 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
274 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
275 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
276 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
277 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
278 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
279 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
285 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.56
Nodule 0
Rhizoplane 0.2
Rhizosphere 95.06
Stem 0
Stem Tuber 0
Unclassified 1.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0020873 3300046472 Bacteria 4839
2 JGI25406J46586_10066155 3300003203 Bacteria 1149
3 Ga0065704_10218873 3300005289 Bacteria 1081
4 Ga0065707_10041759 3300005295 Bacteria 1180
5 Ga0065707_10115005 3300005295 Bacteria 2280
6 Ga0065707_10210247 3300005295 Bacteria 1269
7 Ga0070676_10115103 3300005328 Bacteria 1680
8 Ga0070690_100002104 3300005330 Bacteria 10633
9 Ga0070677_10067668 3300005333 Bacteria 1493
10 Ga0068869_100002357 3300005334 Bacteria 11374
11 Ga0068869_100053019 3300005334 Bacteria 2947
12 Ga0068869_100803102 3300005334 Bacteria 809
13 Ga0070666_10090074 3300005335 Bacteria 2106
14 Ga0070680_100002939 3300005336 Bacteria 12667
15 Ga0070680_100016119 3300005336 Bacteria 5873
16 Ga0070680_100463726 3300005336 Bacteria 1082
17 Ga0070680_100808209 3300005336 Bacteria 808
18 Ga0070682_100018254 3300005337 Bacteria 4098
19 Ga0068868_100005738 3300005338 Bacteria 8736
20 Ga0070689_100000134 3300005340 Bacteria 43133
21 Ga0070691_10000337 3300005341 Bacteria 16652
22 Ga0070691_10065878 3300005341 Bacteria 1750
23 Ga0070687_100001326 3300005343 Bacteria 8647
24 Ga0070692_10000812 3300005345 Bacteria 10392
25 Ga0070692_10009493 3300005345 Bacteria 4390
26 Ga0070692_10626404 3300005345 Bacteria 715
27 Ga0070668_100078573 3300005347 Bacteria 2581
28 Ga0070669_100019998 3300005353 Bacteria 4781
29 Ga0070669_100920927 3300005353 Bacteria 747
30 Ga0070675_100063415 3300005354 Bacteria 3055
31 Ga0070675_100141475 3300005354 Bacteria 2057
32 Ga0070674_100179432 3300005356 Bacteria 1621
33 Ga0070673_100039196 3300005364 Bacteria 3624
34 Ga0070673_100040916 3300005364 Bacteria 3559
35 Ga0070673_100145642 3300005364 Bacteria 2002
36 Ga0070673_101439837 3300005364 Unclassified 649
37 Ga0070688_100083765 3300005365 Bacteria 2070
38 Ga0070703_10002493 3300005406 Bacteria 5294
39 Ga0070714_100407750 3300005435 Bacteria 1286
40 Ga0070701_10000024 3300005438 Bacteria 39082
41 Ga0070705_100000966 3300005440 Bacteria 16102
42 Ga0070705_100009190 3300005440 Bacteria 4907
43 Ga0070705_100051594 3300005440 Bacteria 2399
44 Ga0070705_100557822 3300005440 Bacteria 879
45 Ga0070700_100009660 3300005441 Bacteria 5301
46 Ga0070700_100411984 3300005441 Bacteria 1019
47 Ga0070694_100000724 3300005444 Bacteria 18406
48 Ga0070694_100028260 3300005444 Bacteria 3647
49 Ga0070694_100160810 3300005444 Bacteria 1648
50 Ga0070663_100433385 3300005455 Bacteria 1080
51 Ga0070681_11063308 3300005458 Bacteria 730
52 Ga0068867_100000450 3300005459 Bacteria 27286
53 Ga0068867_100033515 3300005459 Bacteria 3720
54 Ga0068867_100536907 3300005459 Bacteria 1011
55 Ga0070706_100723038 3300005467 Bacteria 923
56 Ga0070707_101631121 3300005468 Bacteria 612
57 Ga0070699_100042884 3300005518 Bacteria 3916
58 Ga0070699_100269356 3300005518 Bacteria 1524
59 Ga0070699_100737194 3300005518 Bacteria 901
60 Ga0070679_100006488 3300005530 Bacteria 10907
61 Ga0070679_100075112 3300005530 Bacteria 3370
62 Ga0070697_100010966 3300005536 Bacteria 7082
63 Ga0070697_100742212 3300005536 Bacteria 867
64 Ga0070697_101086492 3300005536 Bacteria 712
65 Ga0068853_100105103 3300005539 Bacteria 2501
66 Ga0068853_100447336 3300005539 Bacteria 1215
67 Ga0070672_100633523 3300005543 Bacteria 933
68 Ga0070686_100000135 3300005544 Bacteria 51065
69 Ga0070695_100000056 3300005545 Bacteria 45852
70 Ga0070695_100036034 3300005545 Bacteria 3112
71 Ga0070695_100036167 3300005545 Bacteria 3106
72 Ga0070695_100407227 3300005545 Bacteria 1032
73 Ga0070695_100653990 3300005545 Bacteria 830
74 Ga0070696_100000119 3300005546 Bacteria 41152
75 Ga0070696_100048668 3300005546 Bacteria 2943
76 Ga0070693_100000064 3300005547 Bacteria 42802
77 Ga0070693_101008219 3300005547 Bacteria 630
78 Ga0070704_100002067 3300005549 Bacteria 11146
79 Ga0070704_100027751 3300005549 Bacteria 3759
80 Ga0070704_100049683 3300005549 Bacteria 2944
81 Ga0070704_100226443 3300005549 Bacteria 1523
82 Ga0068855_100008429 3300005563 Bacteria 12468
83 Ga0068855_100757209 3300005563 Bacteria 1035
84 Ga0068856_100015018 3300005614 Bacteria 7480
85 Ga0070702_100000459 3300005615 Bacteria 14527
86 Ga0070702_100032883 3300005615 Bacteria 2849
87 Ga0068859_100011300 3300005617 Bacteria 8985
88 Ga0068859_100070656 3300005617 Bacteria 3527
89 Ga0068864_100049272 3300005618 Bacteria 3624
90 Ga0068866_10001072 3300005718 Bacteria 12057
91 Ga0068866_10088492 3300005718 Bacteria 1681
92 Ga0068861_100000310 3300005719 Bacteria 27242
93 Ga0068861_100002109 3300005719 Bacteria 12895
94 Ga0068870_10051915 3300005840 Bacteria 2172
95 Ga0068870_10128820 3300005840 Bacteria 1467
96 Ga0068863_100085311 3300005841 Bacteria 2993
97 Ga0068858_100005167 3300005842 Bacteria 12783
98 Ga0068858_100592445 3300005842 Bacteria 1075
99 Ga0068860_100010977 3300005843 Bacteria 8929
100 Ga0068860_100043234 3300005843 Bacteria 4300
101 Ga0068862_100004942 3300005844 Bacteria 11225
102 Ga0068862_100122391 3300005844 Bacteria 2294
103 Ga0068862_100157331 3300005844 Bacteria 2026
104 Ga0081539_10000496 3300005985 Bacteria 82338
105 Ga0075365_10005108 3300006038 Bacteria 7045
106 Ga0075362_10081447 3300006177 Bacteria 1492
107 Ga0097621_100001384 3300006237 Bacteria 16682
108 Ga0068871_100009776 3300006358 Bacteria 6961
109 Ga0075428_100008791 3300006844 Bacteria 11210
110 Ga0075428_100244293 3300006844 Bacteria 1936
111 Ga0075428_100248046 3300006844 Bacteria 1919
112 Ga0075430_100001729 3300006846 Bacteria 17823
113 Ga0075430_100063799 3300006846 Bacteria 3094
114 Ga0075430_100373274 3300006846 Bacteria 1177
115 Ga0075430_101311900 3300006846 Unclassified 595
116 Ga0075431_100043588 3300006847 Bacteria 4628
117 Ga0075431_100194687 3300006847 Bacteria 2076
118 Ga0075431_100199979 3300006847 Bacteria 2045
119 Ga0075431_100548481 3300006847 Bacteria 1144
120 Ga0075433_10000276 3300006852 Bacteria 30320
121 Ga0075433_10179736 3300006852 Bacteria 1882
122 Ga0075433_10298082 3300006852 Bacteria 1428
123 Ga0075433_10335256 3300006852 Bacteria 1337
124 Ga0075434_100000597 3300006871 Bacteria 27906
125 Ga0075434_100004482 3300006871 Bacteria 12607
126 Ga0075434_100172817 3300006871 Bacteria 2181
127 Ga0075434_100977687 3300006871 Bacteria 860
128 Ga0075429_100000794 3300006880 Bacteria 24824
129 Ga0075429_100101603 3300006880 Bacteria 2510
130 Ga0075429_100232620 3300006880 Bacteria 1614
131 Ga0075429_100834195 3300006880 Bacteria 807
132 Ga0068865_100000333 3300006881 Bacteria 26103
133 Ga0068865_100002198 3300006881 Bacteria 11500
134 Ga0075436_100000552 3300006914 Bacteria 24436
135 Ga0075436_100001007 3300006914 Bacteria 18941
136 Ga0075436_100014342 3300006914 Bacteria 5426
137 Ga0075436_100107167 3300006914 Bacteria 1949
138 Ga0075436_100116969 3300006914 Bacteria 1863
139 Ga0075436_100360570 3300006914 Bacteria 1049
140 Ga0097620_100011300 3300006931 Bacteria 8985
141 Ga0097620_100070658 3300006931 Bacteria 3527
142 Ga0075435_100000328 3300007076 Bacteria 29254
143 Ga0075435_100007498 3300007076 Bacteria 7782
144 Ga0075435_100092107 3300007076 Bacteria 2502
145 Ga0075435_100195895 3300007076 Bacteria 1711
146 Ga0075435_100653048 3300007076 Unclassified 913
147 Ga0075435_100769226 3300007076 Bacteria 838
148 Ga0075435_101179749 3300007076 Bacteria 670
149 Ga0105240_10743161 3300009093 Bacteria 1067
150 Ga0111539_10036343 3300009094 Bacteria 5957
151 Ga0111539_10053483 3300009094 Bacteria 4806
152 Ga0111539_10236055 3300009094 Bacteria 2129
153 Ga0111539_10274868 3300009094 Bacteria 1960
154 Ga0111539_10785061 3300009094 Bacteria 1108
155 Ga0111539_12523402 3300009094 Bacteria 596
156 Ga0105245_10000247 3300009098 Bacteria 51408
157 Ga0114129_10007727 3300009147 Bacteria 15296
158 Ga0114129_10061138 3300009147 Bacteria 5265
159 Ga0114129_10320408 3300009147 Bacteria 2061
160 Ga0105243_10000949 3300009148 Bacteria 27088
161 Ga0105243_10011963 3300009148 Bacteria 6560
162 Ga0105241_10178594 3300009174 Bacteria 1759
163 Ga0105242_10003655 3300009176 Bacteria 11968
164 Ga0105242_12840535 3300009176 Bacteria 535
165 Ga0105248_10251916 3300009177 Bacteria 1987
166 Ga0105249_10003815 3300009553 Bacteria 13009
167 Ga0105249_10035132 3300009553 Bacteria 4544
168 Ga0105239_10029193 3300010375 Bacteria 6064
169 Ga0105246_10376398 3300011119 Bacteria 1172
170 Ga0157370_10741339 3300013104 Bacteria 895
171 Ga0157369_10704186 3300013105 Bacteria 1040
172 Ga0157378_10000934 3300013297 Bacteria 26912
173 Ga0157378_11674588 3300013297 Bacteria 683
174 Ga0163162_10250769 3300013306 Bacteria 1902
175 Ga0157372_10176160 3300013307 Bacteria 2475
176 Ga0157380_10033381 3300014326 Bacteria 3962
177 Ga0157380_10065098 3300014326 Bacteria 2928
178 Ga0157380_11453526 3300014326 Bacteria 737
179 Ga0157377_10018804 3300014745 Bacteria 3598
180 Ga0157376_10013757 3300014969 Bacteria 6051
181 Ga0157376_12156274 3300014969 Bacteria 596
182 Ga0207653_10002947 3300025885 Bacteria 5402
183 Ga0207642_10003222 3300025899 Bacteria 5122
184 Ga0207642_10009863 3300025899 Bacteria 3341
185 Ga0207688_10042188 3300025901 Bacteria 2540
186 Ga0207699_10909337 3300025906 Bacteria 649
187 Ga0207643_10027960 3300025908 Bacteria 3129
188 Ga0207643_10058836 3300025908 Bacteria 2191
189 Ga0207654_10023194 3300025911 Bacteria 3320
190 Ga0207707_10000670 3300025912 Bacteria 33986
191 Ga0207707_10321810 3300025912 Bacteria 1335
192 Ga0207695_10601804 3300025913 Bacteria 980
193 Ga0207660_10010274 3300025917 Bacteria 6070
194 Ga0207660_10042484 3300025917 Bacteria 3192
195 Ga0207660_10043513 3300025917 Bacteria 3156
196 Ga0207660_10701294 3300025917 Bacteria 826
197 Ga0207662_10004917 3300025918 Bacteria 7063
198 Ga0207662_10151661 3300025918 Bacteria 1474
199 Ga0207652_10008828 3300025921 Bacteria 8117
200 Ga0207652_10271356 3300025921 Bacteria 1530
201 Ga0207646_10695906 3300025922 Bacteria 909
202 Ga0207681_10010703 3300025923 Bacteria 5628
203 Ga0207659_10116368 3300025926 Bacteria 2041
204 Ga0207659_10153051 3300025926 Bacteria 1803
205 Ga0207687_10000805 3300025927 Bacteria 21189
206 Ga0207686_10003413 3300025934 Bacteria 8526
207 Ga0207709_10000658 3300025935 Bacteria 28033
208 Ga0207709_10006889 3300025935 Bacteria 6361
209 Ga0207670_10021795 3300025936 Bacteria 3958
210 Ga0207704_10002661 3300025938 Bacteria 8063
211 Ga0207689_10001521 3300025942 Bacteria 22070
212 Ga0207689_10018041 3300025942 Bacteria 5959
213 Ga0207689_10399160 3300025942 Bacteria 1146
214 Ga0207667_10007602 3300025949 Bacteria 12997
215 Ga0207651_10069258 3300025960 Bacteria 2491
216 Ga0207651_11124509 3300025960 Unclassified 704
217 Ga0207712_10004118 3300025961 Bacteria 9182
218 Ga0207712_10046152 3300025961 Bacteria 3019
219 Ga0207668_10209407 3300025972 Bacteria 1558
220 Ga0207640_10004429 3300025981 Bacteria 7620
221 Ga0207677_10008094 3300026023 Bacteria 5853
222 Ga0207703_10022512 3300026035 Bacteria 4944
223 Ga0207639_10026947 3300026041 Bacteria 4181
224 Ga0207678_10170991 3300026067 Bacteria 1855
225 Ga0207708_10001169 3300026075 Bacteria 19748
226 Ga0207708_10003317 3300026075 Bacteria 11849
227 Ga0207708_10158460 3300026075 Bacteria 1786
228 Ga0207708_10167276 3300026075 Bacteria 1739
229 Ga0207702_10053561 3300026078 Bacteria 3416
230 Ga0207702_10325053 3300026078 Bacteria 1466
231 Ga0207641_10091842 3300026088 Bacteria 2658
232 Ga0207641_10157138 3300026088 Bacteria 2064
233 Ga0207648_10000337 3300026089 Bacteria 51505
234 Ga0207648_10030721 3300026089 Bacteria 4754
235 Ga0207676_10050869 3300026095 Bacteria 3233
236 Ga0207674_11528046 3300026116 Bacteria 637
237 Ga0207675_100000972 3300026118 Bacteria 28481
238 Ga0207675_100001042 3300026118 Bacteria 27455
239 Ga0207675_101703429 3300026118 Bacteria 650
240 Ga0209969_1069561 3300027360 Bacteria 559
241 Ga0209967_1007679 3300027364 Bacteria 1478
242 Ga0209981_1013427 3300027378 Bacteria 1139
243 Ga0210000_1008220 3300027462 Bacteria 1529
244 Ga0210000_1019710 3300027462 Bacteria 1027
245 Ga0210000_1025650 3300027462 Bacteria 912
246 Ga0209999_1021407 3300027543 Bacteria 1187
247 Ga0209966_1026601 3300027695 Bacteria 1153
248 Ga0209813_10014355 3300027866 Bacteria 2132
249 Ga0207428_10003026 3300027907 Bacteria 16549
250 Ga0207428_10132354 3300027907 Bacteria 1907
251 Ga0207428_10215598 3300027907 Bacteria 1441
252 Ga0268265_10011243 3300028380 Bacteria 6050
253 Ga0268265_10016524 3300028380 Bacteria 5072
254 Ga0268265_10105027 3300028380 Bacteria 2291
255 Ga0268264_10007575 3300028381 Bacteria 9053
256 Ga0307515_10089315 3300028794 Bacteria 3881
257 Ga0307511_10000086 3300030521 Bacteria 77931
258 Ga0307513_10173437 3300031456 Bacteria 2031
259 Ga0307509_10450609 3300031507 Bacteria 981
260 Ga0307509_10468076 3300031507 Bacteria 951
261 Ga0307408_100800882 3300031548 Bacteria 855
262 Ga0307408_101063449 3300031548 Bacteria 749
263 Ga0307408_101208624 3300031548 Bacteria 705
264 Ga0316579_10054877 3300031691 Bacteria 1868
265 Ga0316579_10090418 3300031691 Bacteria 1462
266 Ga0307405_11724325 3300031731 Unclassified 555
267 Ga0307407_10265912 3300031903 Bacteria 1182
268 Ga0307416_100307372 3300032002 Bacteria 1580
269 Ga0307416_100368768 3300032002 Bacteria 1461
270 Ga0307416_100463143 3300032002 Bacteria 1323
271 Ga0307416_101594687 3300032002 Bacteria 758
272 Ga0307416_101709798 3300032002 Bacteria 734
273 Ga0307411_11432319 3300032005 Unclassified 633
274 Ga0307507_10087797 3300033179 Bacteria 2687
275 Ga0373959_0100516 3300034820 Bacteria 688
276 Ga0373926_0006630 3300035083 Bacteria 3843
277 Ga0373928_0003909 3300035084 Bacteria 2842
278 Ga0373940_0004509 3300035088 Bacteria 2946
279 Ga0373944_0011545 3300035089 Bacteria 2421
280 Ga0373952_0073556 3300035092 Bacteria 859
281 Ga0373923_0005862 3300035111 Bacteria 4197
282 Ga0373932_0001082 3300035112 Bacteria 7843
283 Ga0373936_0008690 3300035113 Bacteria 3824
284 Ga0373939_0023083 3300035114 Bacteria 1720
285 Ga0373939_0199902 3300035114 Bacteria 755
286 Ga0373941_0025468 3300035115 Bacteria 1709
287 Ga0373945_0007339 3300035116 Bacteria 3573
288 Ga0373953_0168270 3300035117 Bacteria 943
289 Ga0373960_0054703 3300035121 Bacteria 1194
290 Ga0373943_0010711 3300035170 Bacteria 4113
291 Ga0373946_0001407 3300035171 Bacteria 8340
292 Ga0373961_0002311 3300035241 Bacteria 4980
293 Ga0373962_0014415 3300035242 Bacteria 2015
294 Ga0373962_0145457 3300035242 Bacteria 773
295 Ga0316574_0256954 3300035398 Bacteria 1116
296 Ga0373924_0019729 3300035410 Bacteria 2614
297 Ga0373931_0001625 3300035691 Bacteria 9728
298 Ga0373931_0008446 3300035691 Bacteria 4885
299 Ga0373935_0006025 3300035692 Bacteria 7202
300 Ga0373927_0047344 3300035695 Bacteria 2781
301 Ga0373947_0234509 3300035725 Bacteria 1209
302 Ga0373937_0080225 3300036401 Bacteria 3017
303 Ga0316582_0084677 3300036647 Bacteria 2076
304 Ga0373925_0062387 3300037068 Bacteria 2802
305 Ga0395900_1029129 3300037418 Bacteria 743
306 Ga0316581_0005355 3300037588 Bacteria 3337
307 Ga0316581_0075114 3300037588 Bacteria 1038
308 Ga0439461_0016117 3300041410 Bacteria 1439
309 Ga0439441_007692 3300042001 Bacteria 1744
310 Ga0439441_079773 3300042001 Bacteria 711
311 Ga0439443_008296 3300042003 Bacteria 1464
312 Ga0450911_001060 3300042115 Bacteria 6970
313 Ga0439446_0011635 3300042156 Bacteria 2392
314 Ga0439435_0005969 3300042436 Bacteria 2712
315 Ga0439435_0016092 3300042436 Bacteria 1870
316 Ga0439435_0032771 3300042436 Bacteria 1419
317 Ga0439444_0002221 3300042437 Bacteria 2630
318 Ga0439460_0001310 3300042461 Bacteria 5843
319 Ga0439460_0021426 3300042461 Bacteria 1766
320 Ga0451577_0446401 3300042876 Bacteria 1175
321 Ga0451576_0024974 3300045051 Bacteria 6444
322 Ga0451576_0051341 3300045051 Bacteria 4323
323 Ga0451576_0334944 3300045051 Bacteria 1584
324 Ga0466967_0003775 3300045976 Bacteria 10001
325 Ga0495592_0001914 3300046454 Bacteria 14676
326 Ga0495603_0039463 3300046455 Bacteria 2828
327 Ga0495629_0744315 3300046459 Bacteria 649
328 Ga0495651_0545637 3300046462 Bacteria 737
329 Ga0495580_0011659 3300046472 Bacteria 6795
330 Ga0495582_0072532 3300046473 Bacteria 1906
331 Ga0495639_0004218 3300046475 Bacteria 6166
332 Ga0495664_0339741 3300046477 Bacteria 905
333 Ga0495584_0236936 3300046491 Bacteria 928
334 Ga0495608_0014961 3300046511 Bacteria 5384
335 Ga0495618_0139579 3300046514 Bacteria 1550
336 Ga0495628_0139630 3300046516 Bacteria 1849
337 Ga0495630_0039474 3300046517 Bacteria 3529
338 Ga0495630_0120360 3300046517 Bacteria 1991
339 Ga0495644_0132492 3300046523 Bacteria 950
340 Ga0495666_0007361 3300046526 Bacteria 5517
341 Ga0495666_0022272 3300046526 Bacteria 3137
342 Ga0495666_0038012 3300046526 Bacteria 2341
343 Ga0495642_0227597 3300046528 Bacteria 814
344 Ga0495665_0011538 3300046531 Bacteria 4784
345 Ga0495640_0021210 3300046533 Bacteria 4771
346 Ga0495586_0004286 3300046535 Bacteria 7624
347 Ga0495586_0008691 3300046535 Bacteria 5407
348 Ga0495587_0025781 3300046536 Bacteria 3591
349 Ga0495609_0302097 3300046538 Bacteria 652
350 Ga0495667_0006736 3300046559 Bacteria 7795
351 Ga0495656_0117076 3300046615 Bacteria 1253
352 Ga0495634_0054021 3300046642 Bacteria 2689
353 Ga0495588_0014413 3300046674 Bacteria 3784
354 Ga0495588_0286362 3300046674 Bacteria 868
355 Ga0495599_0130233 3300046678 Bacteria 1562
356 Ga0495647_0000514 3300046681 Bacteria 11309
357 Ga0495658_0034101 3300046683 Bacteria 2791
358 Ga0495613_0025426 3300046689 Bacteria 4411
359 Ga0495624_0045349 3300046690 Bacteria 2799
360 Ga0495624_0583621 3300046690 Bacteria 667
361 Ga0495600_0007093 3300046809 Bacteria 6848
362 Ga0495604_0005995 3300047317 Bacteria 9649
363 Ga0495604_0006438 3300047317 Bacteria 9315
364 Ga0495676_0010978 3300047321 Bacteria 8191
365 Ga0495680_0002650 3300047322 Bacteria 18119
366 Ga0495684_0108807 3300047471 Bacteria 2093
367 Ga0496106_0525403 3300048909 Bacteria 950
368 Ga0501291_041231 3300049514 Bacteria 813
369 Ga0501297_009962 3300049520 Bacteria 1070
370 Ga0501299_022144 3300049522 Bacteria 1171
371 Ga0501032_0001254 3300049569 Bacteria 20380
372 Ga0501033_0000609 3300049570 Bacteria 33226
373 Ga0501033_0160265 3300049570 Bacteria 1620
374 Ga0501036_0036057 3300049572 Bacteria 4185
375 Ga0501036_0040869 3300049572 Bacteria 3924
376 Ga0501036_0119550 3300049572 Bacteria 2225
377 Ga0501037_0000053 3300049573 Bacteria 110672
378 Ga0501037_0449794 3300049573 Bacteria 879
379 Ga0501038_0095060 3300049574 Bacteria 2490
380 Ga0501038_0275148 3300049574 Bacteria 1327
381 Ga0501038_0297613 3300049574 Bacteria 1267
382 Ga0501038_1157719 3300049574 Bacteria 563
383 Ga0501039_0003312 3300049575 Bacteria 12047
384 Ga0501039_0055739 3300049575 Bacteria 3062
385 Ga0501040_0119116 3300049576 Bacteria 1851
386 Ga0501040_0220489 3300049576 Bacteria 1349
387 Ga0501041_0025705 3300049577 Bacteria 3539
388 Ga0501041_0111351 3300049577 Bacteria 1698
389 Ga0501041_0126522 3300049577 Bacteria 1591
390 Ga0501042_0066871 3300049578 Bacteria 2569
391 Ga0501043_0000008 3300049579 Bacteria 223654
392 Ga0501043_0690175 3300049579 Bacteria 747
393 Ga0501046_0449554 3300049580 Bacteria 927
394 Ga0501046_0954538 3300049580 Bacteria 596
395 Ga0501048_0179030 3300049582 Bacteria 1503
396 Ga0501048_0181710 3300049582 Bacteria 1491
397 Ga0501068_0254650 3300049584 Bacteria 1119
398 Ga0501069_0000004 3300049585 Bacteria 192353
399 Ga0501069_0076385 3300049585 Bacteria 1883
400 Ga0501069_0516332 3300049585 Bacteria 713
401 Ga0501070_0000148 3300049586 Bacteria 64874
402 Ga0501070_0020583 3300049586 Bacteria 5533
403 Ga0501070_0419698 3300049586 Bacteria 1081
404 Ga0501070_0469390 3300049586 Bacteria 1013
405 Ga0501071_0011726 3300049587 Bacteria 5916
406 Ga0501071_0015819 3300049587 Bacteria 5183
407 Ga0501071_0737786 3300049587 Bacteria 759
408 Ga0501072_0004891 3300049588 Bacteria 10190
409 Ga0501072_0024236 3300049588 Bacteria 4719
410 Ga0501072_0287975 3300049588 Bacteria 1306
411 Ga0501072_0462156 3300049588 Bacteria 1005
412 Ga0501073_0055967 3300049589 Bacteria 2759
413 Ga0501074_0000126 3300049590 Bacteria 38822
414 Ga0501074_0270374 3300049590 Bacteria 1208
415 Ga0501075_0000357 3300049591 Bacteria 26072
416 Ga0501075_0052958 3300049591 Bacteria 3052
417 Ga0501076_0001418 3300049592 Bacteria 16060
418 Ga0501077_0031588 3300049593 Bacteria 3370
419 Ga0501077_0047684 3300049593 Bacteria 2722
420 Ga0501077_0412881 3300049593 Bacteria 863
421 Ga0501079_0012715 3300049741 Bacteria 6430
422 Ga0501079_0092958 3300049741 Bacteria 2337
423 Ga0501079_0238311 3300049741 Bacteria 1421
424 Ga0501080_0000637 3300049742 Bacteria 27798
425 Ga0501080_0003824 3300049742 Bacteria 13306
426 Ga0501080_0347739 3300049742 Bacteria 1339
427 Ga0501081_0004440 3300049743 Bacteria 8992
428 Ga0501081_0384770 3300049743 Bacteria 1037
429 Ga0501081_0860331 3300049743 Bacteria 683
430 Ga0501083_0000066 3300049744 Bacteria 71496
431 Ga0501083_0020767 3300049744 Bacteria 4566
432 Ga0501083_0203123 3300049744 Bacteria 1292
433 Ga0501035_0000011 3300049822 Bacteria 305794
434 Ga0501035_0001917 3300049822 Bacteria 20867
435 Ga0501044_0000041 3300049823 Bacteria 154183
436 Ga0501044_0140146 3300049823 Bacteria 2407
437 Ga0501045_0005947 3300049824 Bacteria 8438
438 Ga0501045_0080099 3300049824 Bacteria 2408
439 Ga0501045_1021608 3300049824 Bacteria 606
440 nmdc:mga0yw44_39062_c1 3300050492 Bacteria 2812
441 nmdc:mga0k408_153856_c1 3300050493 Bacteria 1038
442 nmdc:mga06z11_72617_c1 3300050494 Bacteria 1825
443 nmdc:mga04h51_65720_c1 3300050495 Bacteria 1255
444 nmdc:mga05p37_10141_c1 3300050507 Bacteria 11183
445 nmdc:mga05p37_1039428_c1 3300050507 Bacteria 865
446 nmdc:mga09592_1525_c1 3300050508 Bacteria 18665
447 nmdc:mga09592_485199_c1 3300050508 Bacteria 1065
448 nmdc:mga09592_498875_c1 3300050508 Bacteria 1048
449 nmdc:mga09592_686704_c1 3300050508 Bacteria 872
450 nmdc:mga09592_956796_c1 3300050508 Bacteria 718
451 nmdc:mga0qj67_1164260_c1 3300050509 Unclassified 601
452 nmdc:mga0qj67_268_c1 3300050509 Bacteria 35906
453 nmdc:mga0qj67_317282_c1 3300050509 Bacteria 1262
454 nmdc:mga0qj67_70110_c1 3300050509 Bacteria 2796
455 nmdc:mga0qj67_7185_c1 3300050509 Bacteria 8219
456 nmdc:mga0qj67_79730_c1 3300050509 Bacteria 2623
457 nmdc:mga06r32_1360622_c1 3300050510 Bacteria 653
458 nmdc:mga06r32_236221_c1 3300050510 Bacteria 1815
459 nmdc:mga06r32_292645_c1 3300050510 Bacteria 1615
460 nmdc:mga06r32_408832_c1 3300050510 Bacteria 1339
461 nmdc:mga06r32_47577_c1 3300050510 Bacteria 4097
462 nmdc:mga06r32_556110_c1 3300050510 Bacteria 1121
463 nmdc:mga06r32_642451_c1 3300050510 Bacteria 1030
464 nmdc:mga08y16_1196_c1 3300050511 Bacteria 25597
465 nmdc:mga08y16_166785_c1 3300050511 Bacteria 2288
466 nmdc:mga08y16_39181_c1 3300050511 Bacteria 4972
467 nmdc:mga08y16_42925_c1 3300050511 Bacteria 4737
468 nmdc:mga0n895_2422_c1 3300050512 Bacteria 14549
469 nmdc:mga0n895_4906_c1 3300050512 Bacteria 11088
470 nmdc:mga0n895_496274_c1 3300050512 Bacteria 1230
471 nmdc:mga0n895_67704_c1 3300050512 Bacteria 3537
472 nmdc:mga0rr50_12611_c1 3300050513 Bacteria 5471
473 nmdc:mga0rr50_1691_c1 3300050513 Bacteria 12186
474 nmdc:mga0rr50_607992_c1 3300050513 Unclassified 932
475 nmdc:mga08x19_137011_c1 3300050514 Bacteria 1651
476 nmdc:mga08x19_23004_c1 3300050514 Bacteria 3864
477 nmdc:mga08x19_279296_c1 3300050514 Bacteria 1157
478 nmdc:mga08x19_36648_c1 3300050514 Bacteria 3107
479 nmdc:mga08x19_369638_c1 3300050514 Bacteria 1003
480 nmdc:mga08x19_550_c1 3300050514 Bacteria 24591
481 nmdc:mga08x19_580_c1 3300050514 Bacteria 23825
482 nmdc:mga0a205_142439_c1 3300050515 Bacteria 2297
483 nmdc:mga0a205_153311_c1 3300050515 Bacteria 2203
484 nmdc:mga0a205_301975_c1 3300050515 Bacteria 1474
485 nmdc:mga0a205_584_c1 3300050515 Bacteria 28859
486 Ga0495601_0032840 3300053077 Bacteria 3232
487 Ga0495619_0210040 3300053085 Bacteria 1348
488 Ga0500644_0328762 3300053088 Bacteria 658
489 Ga0500646_0000193 3300053090 Bacteria 18346
490 Ga0500566_0267361 3300053094 Bacteria 822
491 Ga0500650_0071896 3300053098 Bacteria 1617
492 Ga0500562_003529 3300053108 Bacteria 3920
493 Ga0500594_0002953 3300053118 Bacteria 3717
494 Ga0500642_0062875 3300053130 Bacteria 1672
495 Ga0500568_0054445 3300053139 Bacteria 1565
496 Ga0500586_036953 3300053145 Bacteria 1640
497 Ga0500604_0003634 3300053151 Bacteria 4149
498 Ga0500637_0334731 3300053178 Bacteria 812
499 Ga0501084_1054933 3300054114 Bacteria 683
500 Ga0590077_032694 3300059426 Bacteria 1140
501 Ga0501082_0022502 3300060353 Bacteria 5429
502 Ga0501082_0085867 3300060353 Bacteria 2714
503 Ga0466962_0237183 3300061719 Bacteria 895
504 Ga0530510_0000056 3300061734 Bacteria 54243
505 Ga0530510_0831130 3300061734 Unclassified 705
506 8003405122 8003400568 Bacteria 5535898
507 Ga0495580_0020873
508 JGI25406J46586_10066155
509 Ga0065704_10218873
510 Ga0065707_10041759
511 Ga0065707_10115005
512 Ga0065707_10210247
513 Ga0070676_10115103
514 Ga0070690_100002104
515 Ga0070677_10067668
516 Ga0068869_100002357
517 Ga0068869_100053019
518 Ga0068869_100803102
519 Ga0070666_10090074
520 Ga0070680_100002939
521 Ga0070680_100016119
522 Ga0070680_100463726
523 Ga0070680_100808209
524 Ga0070682_100018254
525 Ga0068868_100005738
526 Ga0070689_100000134
527 Ga0070691_10000337
528 Ga0070691_10065878
529 Ga0070687_100001326
530 Ga0070692_10000812
531 Ga0070692_10009493
532 Ga0070692_10626404
533 Ga0070668_100078573
534 Ga0070669_100019998
535 Ga0070669_100920927
536 Ga0070675_100063415
537 Ga0070675_100141475
538 Ga0070674_100179432
539 Ga0070673_100039196
540 Ga0070673_100040916
541 Ga0070673_100145642
542 Ga0070673_101439837
543 Ga0070688_100083765
544 Ga0070703_10002493
545 Ga0070714_100407750
546 Ga0070701_10000024
547 Ga0070705_100000966
548 Ga0070705_100009190
549 Ga0070705_100051594
550 Ga0070705_100557822
551 Ga0070700_100009660
552 Ga0070700_100411984
553 Ga0070694_100000724
554 Ga0070694_100028260
555 Ga0070694_100160810
556 Ga0070663_100433385
557 Ga0070681_11063308
558 Ga0068867_100000450
559 Ga0068867_100033515
560 Ga0068867_100536907
561 Ga0070706_100723038
562 Ga0070707_101631121
563 Ga0070699_100042884
564 Ga0070699_100269356
565 Ga0070699_100737194
566 Ga0070679_100006488
567 Ga0070679_100075112
568 Ga0070697_100010966
569 Ga0070697_100742212
570 Ga0070697_101086492
571 Ga0068853_100105103
572 Ga0068853_100447336
573 Ga0070672_100633523
574 Ga0070686_100000135
575 Ga0070695_100000056
576 Ga0070695_100036034
577 Ga0070695_100036167
578 Ga0070695_100407227
579 Ga0070695_100653990
580 Ga0070696_100000119
581 Ga0070696_100048668
582 Ga0070693_100000064
583 Ga0070693_101008219
584 Ga0070704_100002067
585 Ga0070704_100027751
586 Ga0070704_100049683
587 Ga0070704_100226443
588 Ga0068855_100008429
589 Ga0068855_100757209
590 Ga0068856_100015018
591 Ga0070702_100000459
592 Ga0070702_100032883
593 Ga0068859_100011300
594 Ga0068859_100070656
595 Ga0068864_100049272
596 Ga0068866_10001072
597 Ga0068866_10088492
598 Ga0068861_100000310
599 Ga0068861_100002109
600 Ga0068870_10051915
601 Ga0068870_10128820
602 Ga0068863_100085311
603 Ga0068858_100005167
604 Ga0068858_100592445
605 Ga0068860_100010977
606 Ga0068860_100043234
607 Ga0068862_100004942
608 Ga0068862_100122391
609 Ga0068862_100157331
610 Ga0081539_10000496
611 Ga0075365_10005108
612 Ga0075362_10081447
613 Ga0097621_100001384
614 Ga0068871_100009776
615 Ga0075428_100008791
616 Ga0075428_100244293
617 Ga0075428_100248046
618 Ga0075430_100001729
619 Ga0075430_100063799
620 Ga0075430_100373274
621 Ga0075430_101311900
622 Ga0075431_100043588
623 Ga0075431_100194687
624 Ga0075431_100199979
625 Ga0075431_100548481
626 Ga0075433_10000276
627 Ga0075433_10179736
628 Ga0075433_10298082
629 Ga0075433_10335256
630 Ga0075434_100000597
631 Ga0075434_100004482
632 Ga0075434_100172817
633 Ga0075434_100977687
634 Ga0075429_100000794
635 Ga0075429_100101603
636 Ga0075429_100232620
637 Ga0075429_100834195
638 Ga0068865_100000333
639 Ga0068865_100002198
640 Ga0075436_100000552
641 Ga0075436_100001007
642 Ga0075436_100014342
643 Ga0075436_100107167
644 Ga0075436_100116969
645 Ga0075436_100360570
646 Ga0097620_100011300
647 Ga0097620_100070658
648 Ga0075435_100000328
649 Ga0075435_100007498
650 Ga0075435_100092107
651 Ga0075435_100195895
652 Ga0075435_100653048
653 Ga0075435_100769226
654 Ga0075435_101179749
655 Ga0105240_10743161
656 Ga0111539_10036343
657 Ga0111539_10053483
658 Ga0111539_10236055
659 Ga0111539_10274868
660 Ga0111539_10785061
661 Ga0111539_12523402
662 Ga0105245_10000247
663 Ga0114129_10007727
664 Ga0114129_10061138
665 Ga0114129_10320408
666 Ga0105243_10000949
667 Ga0105243_10011963
668 Ga0105241_10178594
669 Ga0105242_10003655
670 Ga0105242_12840535
671 Ga0105248_10251916
672 Ga0105249_10003815
673 Ga0105249_10035132
674 Ga0105239_10029193
675 Ga0105246_10376398
676 Ga0157370_10741339
677 Ga0157369_10704186
678 Ga0157378_10000934
679 Ga0157378_11674588
680 Ga0163162_10250769
681 Ga0157372_10176160
682 Ga0157380_10033381
683 Ga0157380_10065098
684 Ga0157380_11453526
685 Ga0157377_10018804
686 Ga0157376_10013757
687 Ga0157376_12156274
688 Ga0207653_10002947
689 Ga0207642_10003222
690 Ga0207642_10009863
691 Ga0207688_10042188
692 Ga0207699_10909337
693 Ga0207643_10027960
694 Ga0207643_10058836
695 Ga0207654_10023194
696 Ga0207707_10000670
697 Ga0207707_10321810
698 Ga0207695_10601804
699 Ga0207660_10010274
700 Ga0207660_10042484
701 Ga0207660_10043513
702 Ga0207660_10701294
703 Ga0207662_10004917
704 Ga0207662_10151661
705 Ga0207652_10008828
706 Ga0207652_10271356
707 Ga0207646_10695906
708 Ga0207681_10010703
709 Ga0207659_10116368
710 Ga0207659_10153051
711 Ga0207687_10000805
712 Ga0207686_10003413
713 Ga0207709_10000658
714 Ga0207709_10006889
715 Ga0207670_10021795
716 Ga0207704_10002661
717 Ga0207689_10001521
718 Ga0207689_10018041
719 Ga0207689_10399160
720 Ga0207667_10007602
721 Ga0207651_10069258
722 Ga0207651_11124509
723 Ga0207712_10004118
724 Ga0207712_10046152
725 Ga0207668_10209407
726 Ga0207640_10004429
727 Ga0207677_10008094
728 Ga0207703_10022512
729 Ga0207639_10026947
730 Ga0207678_10170991
731 Ga0207708_10001169
732 Ga0207708_10003317
733 Ga0207708_10158460
734 Ga0207708_10167276
735 Ga0207702_10053561
736 Ga0207702_10325053
737 Ga0207641_10091842
738 Ga0207641_10157138
739 Ga0207648_10000337
740 Ga0207648_10030721
741 Ga0207676_10050869
742 Ga0207674_11528046
743 Ga0207675_100000972
744 Ga0207675_100001042
745 Ga0207675_101703429
746 Ga0209969_1069561
747 Ga0209967_1007679
748 Ga0209981_1013427
749 Ga0210000_1008220
750 Ga0210000_1019710
751 Ga0210000_1025650
752 Ga0209999_1021407
753 Ga0209966_1026601
754 Ga0209813_10014355
755 Ga0207428_10003026
756 Ga0207428_10132354
757 Ga0207428_10215598
758 Ga0268265_10011243
759 Ga0268265_10016524
760 Ga0268265_10105027
761 Ga0268264_10007575
762 Ga0307515_10089315
763 Ga0307511_10000086
764 Ga0307513_10173437
765 Ga0307509_10450609
766 Ga0307509_10468076
767 Ga0307408_100800882
768 Ga0307408_101063449
769 Ga0307408_101208624
770 Ga0316579_10054877
771 Ga0316579_10090418
772 Ga0307405_11724325
773 Ga0307407_10265912
774 Ga0307416_100307372
775 Ga0307416_100368768
776 Ga0307416_100463143
777 Ga0307416_101594687
778 Ga0307416_101709798
779 Ga0307411_11432319
780 Ga0307507_10087797
781 Ga0373959_0100516
782 Ga0373926_0006630
783 Ga0373928_0003909
784 Ga0373940_0004509
785 Ga0373944_0011545
786 Ga0373952_0073556
787 Ga0373923_0005862
788 Ga0373932_0001082
789 Ga0373936_0008690
790 Ga0373939_0023083
791 Ga0373939_0199902
792 Ga0373941_0025468
793 Ga0373945_0007339
794 Ga0373953_0168270
795 Ga0373960_0054703
796 Ga0373943_0010711
797 Ga0373946_0001407
798 Ga0373961_0002311
799 Ga0373962_0014415
800 Ga0373962_0145457
801 Ga0316574_0256954
802 Ga0373924_0019729
803 Ga0373931_0001625
804 Ga0373931_0008446
805 Ga0373935_0006025
806 Ga0373927_0047344
807 Ga0373947_0234509
808 Ga0373937_0080225
809 Ga0316582_0084677
810 Ga0373925_0062387
811 Ga0395900_1029129
812 Ga0316581_0005355
813 Ga0316581_0075114
814 Ga0439461_0016117
815 Ga0439441_007692
816 Ga0439441_079773
817 Ga0439443_008296
818 Ga0450911_001060
819 Ga0439446_0011635
820 Ga0439435_0005969
821 Ga0439435_0016092
822 Ga0439435_0032771
823 Ga0439444_0002221
824 Ga0439460_0001310
825 Ga0439460_0021426
826 Ga0451577_0446401
827 Ga0451576_0024974
828 Ga0451576_0051341
829 Ga0451576_0334944
830 Ga0466967_0003775
831 Ga0495592_0001914
832 Ga0495603_0039463
833 Ga0495629_0744315
834 Ga0495651_0545637
835 Ga0495580_0011659
836 Ga0495582_0072532
837 Ga0495639_0004218
838 Ga0495664_0339741
839 Ga0495584_0236936
840 Ga0495608_0014961
841 Ga0495618_0139579
842 Ga0495628_0139630
843 Ga0495630_0039474
844 Ga0495630_0120360
845 Ga0495644_0132492
846 Ga0495666_0007361
847 Ga0495666_0022272
848 Ga0495666_0038012
849 Ga0495642_0227597
850 Ga0495665_0011538
851 Ga0495640_0021210
852 Ga0495586_0004286
853 Ga0495586_0008691
854 Ga0495587_0025781
855 Ga0495609_0302097
856 Ga0495667_0006736
857 Ga0495656_0117076
858 Ga0495634_0054021
859 Ga0495588_0014413
860 Ga0495588_0286362
861 Ga0495599_0130233
862 Ga0495647_0000514
863 Ga0495658_0034101
864 Ga0495613_0025426
865 Ga0495624_0045349
866 Ga0495624_0583621
867 Ga0495600_0007093
868 Ga0495604_0005995
869 Ga0495604_0006438
870 Ga0495676_0010978
871 Ga0495680_0002650
872 Ga0495684_0108807
873 Ga0496106_0525403
874 Ga0501291_041231
875 Ga0501297_009962
876 Ga0501299_022144
877 Ga0501032_0001254
878 Ga0501033_0000609
879 Ga0501033_0160265
880 Ga0501036_0036057
881 Ga0501036_0040869
882 Ga0501036_0119550
883 Ga0501037_0000053
884 Ga0501037_0449794
885 Ga0501038_0095060
886 Ga0501038_0275148
887 Ga0501038_0297613
888 Ga0501038_1157719
889 Ga0501039_0003312
890 Ga0501039_0055739
891 Ga0501040_0119116
892 Ga0501040_0220489
893 Ga0501041_0025705
894 Ga0501041_0111351
895 Ga0501041_0126522
896 Ga0501042_0066871
897 Ga0501043_0000008
898 Ga0501043_0690175
899 Ga0501046_0449554
900 Ga0501046_0954538
901 Ga0501048_0179030
902 Ga0501048_0181710
903 Ga0501068_0254650
904 Ga0501069_0000004
905 Ga0501069_0076385
906 Ga0501069_0516332
907 Ga0501070_0000148
908 Ga0501070_0020583
909 Ga0501070_0419698
910 Ga0501070_0469390
911 Ga0501071_0011726
912 Ga0501071_0015819
913 Ga0501071_0737786
914 Ga0501072_0004891
915 Ga0501072_0024236
916 Ga0501072_0287975
917 Ga0501072_0462156
918 Ga0501073_0055967
919 Ga0501074_0000126
920 Ga0501074_0270374
921 Ga0501075_0000357
922 Ga0501075_0052958
923 Ga0501076_0001418
924 Ga0501077_0031588
925 Ga0501077_0047684
926 Ga0501077_0412881
927 Ga0501079_0012715
928 Ga0501079_0092958
929 Ga0501079_0238311
930 Ga0501080_0000637
931 Ga0501080_0003824
932 Ga0501080_0347739
933 Ga0501081_0004440
934 Ga0501081_0384770
935 Ga0501081_0860331
936 Ga0501083_0000066
937 Ga0501083_0020767
938 Ga0501083_0203123
939 Ga0501035_0000011
940 Ga0501035_0001917
941 Ga0501044_0000041
942 Ga0501044_0140146
943 Ga0501045_0005947
944 Ga0501045_0080099
945 Ga0501045_1021608
946 nmdc:mga0yw44_39062_c1
947 nmdc:mga0k408_153856_c1
948 nmdc:mga06z11_72617_c1
949 nmdc:mga04h51_65720_c1
950 nmdc:mga05p37_10141_c1
951 nmdc:mga05p37_1039428_c1
952 nmdc:mga09592_1525_c1
953 nmdc:mga09592_485199_c1
954 nmdc:mga09592_498875_c1
955 nmdc:mga09592_686704_c1
956 nmdc:mga09592_956796_c1
957 nmdc:mga0qj67_1164260_c1
958 nmdc:mga0qj67_268_c1
959 nmdc:mga0qj67_317282_c1
960 nmdc:mga0qj67_70110_c1
961 nmdc:mga0qj67_7185_c1
962 nmdc:mga0qj67_79730_c1
963 nmdc:mga06r32_1360622_c1
964 nmdc:mga06r32_236221_c1
965 nmdc:mga06r32_292645_c1
966 nmdc:mga06r32_408832_c1
967 nmdc:mga06r32_47577_c1
968 nmdc:mga06r32_556110_c1
969 nmdc:mga06r32_642451_c1
970 nmdc:mga08y16_1196_c1
971 nmdc:mga08y16_166785_c1
972 nmdc:mga08y16_39181_c1
973 nmdc:mga08y16_42925_c1
974 nmdc:mga0n895_2422_c1
975 nmdc:mga0n895_4906_c1
976 nmdc:mga0n895_496274_c1
977 nmdc:mga0n895_67704_c1
978 nmdc:mga0rr50_12611_c1
979 nmdc:mga0rr50_1691_c1
980 nmdc:mga0rr50_607992_c1
981 nmdc:mga08x19_137011_c1
982 nmdc:mga08x19_23004_c1
983 nmdc:mga08x19_279296_c1
984 nmdc:mga08x19_36648_c1
985 nmdc:mga08x19_369638_c1
986 nmdc:mga08x19_550_c1
987 nmdc:mga08x19_580_c1
988 nmdc:mga0a205_142439_c1
989 nmdc:mga0a205_153311_c1
990 nmdc:mga0a205_301975_c1
991 nmdc:mga0a205_584_c1
992 Ga0495601_0032840
993 Ga0495619_0210040
994 Ga0500644_0328762
995 Ga0500646_0000193
996 Ga0500566_0267361
997 Ga0500650_0071896
998 Ga0500562_003529
999 Ga0500594_0002953
1000 Ga0500642_0062875
1001 Ga0500568_0054445
1002 Ga0500586_036953
1003 Ga0500604_0003634
1004 Ga0500637_0334731
1005 Ga0501084_1054933
1006 Ga0590077_032694
1007 Ga0501082_0022502
1008 Ga0501082_0085867
1009 Ga0466962_0237183
1010 Ga0530510_0000056
1011 Ga0530510_0831130
1012 8003405122

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00694

Aconitase_C

Aconitase C-terminal domain

51

116

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vba-assembly2.cif.gz_D crystal structure of methanogen 3-isopropylmalate isomerase small subunit 0.9572 2 154
2pkp-assembly1.cif.gz_A crystal structure of 3-isopropylmalate dehydratase (leud)from methhanocaldococcus jannaschii dsm2661 (mj1271) 0.9443 2 163
2pkp-assembly1.cif.gz_A crystal structure of 3-isopropylmalate dehydratase (leud)from methhanocaldococcus jannaschii dsm2661 (mj1271) 0.9332 2 163
1v7l-assembly1.cif.gz_B structure of 3-isopropylmalate isomerase small subunit from pyrococcus horikoshii 0.9294 2 159
3h5e-assembly2.cif.gz_B leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.8436 2 133
ID Description Score Start End Superfamily
1v7lB01 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9428 2 154 3.20.19.10
2pkpA01 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9423 2 154 3.20.19.10
2pkpA01 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9026 2 154 3.20.19.10
1v7lB01 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9025 2 154 3.20.19.10
af_I1KVC1_66_241_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.8715 2 155 3.20.19.10
ID Description Score Start End GO Terms
AF-A0A537AAK9-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (IPMI) (Isopropylmalate isomerase) 0.9974 1 159 GO:0003861
GO:0009098
AF-A0A3S8ZSQ1-F1-model_v4 3-isopropylmalate dehydratase 0.9951 2 154 GO:0016836
AF-A0A0K9NBA8-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.995 2 154 GO:0016836
AF-A0A7C7THT0-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (IPMI) (Isopropylmalate isomerase) 0.9927 2 162 GO:0003861
GO:0009098
AF-A0A536Y8E8-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (IPMI) (Isopropylmalate isomerase) 0.992 1 163 GO:0003861
GO:0009098

Map