F456502

General Info

Members Datasets Scaffolds Average Seq Length
506 308 448 161

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10191276|Ga0075369_101912762
Length 180
Sequence VSQVTTSQVTTSNDSYRFREYSGGCQCGAVRWHATELRDNPHVCYCRMCQKASGNFFADLVGIRHEHLTWTRGKPSEFNSSDVAARGFCRDCGTPLYYRSLGGPHVSMTIGSFDTPHLVPILYEMGLEGRHPSLRPVPGAEQIGTTEEGDGVEAVARVRASNHQHPDHDTDKWVMGGADG

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
3 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
4 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
5 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
6 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
7 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
8 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
9 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
10 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
11 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
12 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
13 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
14 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
15 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
16 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
17 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
18 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
19 2643221629 Devosia sp. Root105 Isolate Unclassified
20 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
21 2643221662 Devosia sp. Root413D1 Isolate Unclassified
22 2643221718 Rhizobium sp. Root268 Isolate Unclassified
23 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
24 2718217927 Rhizobium sp. N324 Isolate Nodule
25 2718218423 Rhizobium sp. N941 Isolate Nodule
26 2721755809 Rhizobium sp. N541 Isolate Nodule
27 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
28 2791355267 Rhizobium sp. L18 Isolate Nodule
29 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
30 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
31 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
32 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
33 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
34 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
35 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
36 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
37 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
38 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
39 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
40 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
41 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
42 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
43 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
44 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
45 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
46 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
47 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
48 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
49 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
50 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
51 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
52 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
53 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
54 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
55 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
56 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
57 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
58 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
59 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
60 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
63 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
119 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
123 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
124 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
127 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
128 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
170 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
171 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
191 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
203 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
204 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
205 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
274 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
280 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
281 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
282 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
283 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
284 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
285 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
286 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
287 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
288 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
289 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
290 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
291 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
292 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
293 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
297 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
298 8005275841 Rhizobium sp. N4311 Isolate Nodule
299 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
300 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
301 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
302 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
303 8018176218 Rhizobium sp. N122 Isolate Nodule
304 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
305 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
306 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
307 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
308 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.93
Metatranscriptomes 0
Isolates 11.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.43
Nodule 5.14
Rhizoplane 1.58
Rhizosphere 66.6
Stem 0
Stem Tuber 0
Unclassified 12.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000032 3300002704 Bacteria 105511
2 JGI25156J39149_1000153 3300002705 Bacteria 50769
3 JGI25162J39368_1000442 3300002737 Bacteria 32936
4 JGI25162J39368_1001722 3300002737 Bacteria 10557
5 JGI25154J39366_1000152 3300002738 Bacteria 53779
6 JGI25157J39369_1000061 3300002741 Bacteria 105511
7 JGI25159J45721_1003928 3300002987 Bacteria 5077
8 JGI25165J46597_1000639 3300003214 Bacteria 29032
9 JGI25165J46597_1001009 3300003214 Bacteria 18657
10 JGI25165J46597_1011001 3300003214 Bacteria 1303
11 JGI25165J46597_1015833 3300003214 Bacteria 1014
12 JGI25165J46597_1025441 3300003214 Bacteria 767
13 rootH2_10037901 3300003320 Bacteria 1704
14 rootH2_10044307 3300003320 Bacteria 2391
15 rootH2_10067834 3300003320 Bacteria 1976
16 rootH2_10120970 3300003320 Bacteria 1288
17 rootH1_10050700 3300003323 Bacteria 1860
18 rootH1_10099566 3300003323 Bacteria 2153
19 rootH1_10241800 3300003323 Bacteria 1421
20 JGI25160J50197_1000052 3300003354 Bacteria 127795
21 JGI25161J50226_1000005 3300003374 Bacteria 292548
22 JGI25161J50226_1000113 3300003374 Bacteria 63092
23 Ga0055540_1001764 3300003792 Bacteria 12339
24 Ga0055543_1000035 3300004625 Bacteria 127833
25 Ga0065165_1000253 3300005262 Bacteria 92969
26 Ga0070658_10003333 3300005327 Bacteria 13260
27 Ga0070658_10066909 3300005327 Bacteria 2935
28 Ga0070658_10310195 3300005327 Bacteria 1346
29 Ga0070676_10101375 3300005328 Bacteria 1779
30 Ga0070676_10171423 3300005328 Bacteria 1404
31 Ga0070683_100346380 3300005329 Bacteria 1415
32 Ga0068868_100924641 3300005338 Bacteria 794
33 Ga0070660_100012650 3300005339 Bacteria 6031
34 Ga0070660_100149030 3300005339 Bacteria 1880
35 Ga0070660_100420435 3300005339 Bacteria 1107
36 Ga0070661_100002175 3300005344 Bacteria 13495
37 Ga0070661_100044743 3300005344 Bacteria 3235
38 Ga0070661_100172034 3300005344 Bacteria 1645
39 Ga0070661_100901948 3300005344 Bacteria 730
40 Ga0070668_100342702 3300005347 Bacteria 1263
41 Ga0070674_100013689 3300005356 Bacteria 5020
42 Ga0070674_100147161 3300005356 Bacteria 1774
43 Ga0070674_101642039 3300005356 Bacteria 580
44 Ga0070673_100035107 3300005364 Bacteria 3800
45 Ga0070659_100006686 3300005366 Bacteria 8336
46 Ga0070663_100356172 3300005455 Bacteria 1186
47 Ga0070678_100839209 3300005456 Bacteria 836
48 Ga0070662_100300456 3300005457 Bacteria 1304
49 Ga0068867_100267246 3300005459 Bacteria 1397
50 Ga0070679_100933114 3300005530 Bacteria 812
51 Ga0068853_100000752 3300005539 Bacteria 22475
52 Ga0068853_100003754 3300005539 Bacteria 11652
53 Ga0068853_100049258 3300005539 Bacteria 3620
54 Ga0068853_100138386 3300005539 Bacteria 2184
55 Ga0070672_100148695 3300005543 Bacteria 1937
56 Ga0070672_100551001 3300005543 Bacteria 1001
57 Ga0070686_100005599 3300005544 Bacteria 6959
58 Ga0070665_100426028 3300005548 Bacteria 1336
59 Ga0070665_100755218 3300005548 Bacteria 986
60 Ga0070665_100926658 3300005548 Bacteria 884
61 Ga0068855_100042614 3300005563 Bacteria 5377
62 Ga0068855_100297210 3300005563 Bacteria 1789
63 Ga0068855_100559816 3300005563 Bacteria 1237
64 Ga0070664_100167601 3300005564 Bacteria 1947
65 Ga0070664_101368858 3300005564 Bacteria 669
66 Ga0068857_100117628 3300005577 Bacteria 2392
67 Ga0068857_100259347 3300005577 Bacteria 1595
68 Ga0068857_100340723 3300005577 Bacteria 1387
69 Ga0068857_101299990 3300005577 Bacteria 706
70 Ga0068854_100012747 3300005578 Bacteria 5504
71 Ga0068854_100176163 3300005578 Bacteria 1667
72 Ga0068854_101127644 3300005578 Bacteria 700
73 Ga0068856_100013451 3300005614 Bacteria 7920
74 Ga0068856_100042150 3300005614 Bacteria 4490
75 Ga0068856_100071587 3300005614 Bacteria 3432
76 Ga0068856_100099984 3300005614 Bacteria 2892
77 Ga0068856_100213533 3300005614 Bacteria 1945
78 Ga0068852_100013606 3300005616 Bacteria 6229
79 Ga0068852_100031137 3300005616 Bacteria 4398
80 Ga0068852_100067077 3300005616 Bacteria 3136
81 Ga0068852_100187857 3300005616 Bacteria 1947
82 Ga0068852_100548375 3300005616 Bacteria 1156
83 Ga0068851_10003875 3300005834 Bacteria 6697
84 Ga0068851_10046556 3300005834 Bacteria 2194
85 Ga0068851_10072832 3300005834 Bacteria 1781
86 Ga0068863_100589873 3300005841 Bacteria 1099
87 Ga0081455_10111954 3300005937 Bacteria 2168
88 Ga0081538_10025268 3300005981 Bacteria 4194
89 Ga0075365_10213639 3300006038 Bacteria 1353
90 Ga0075365_10416546 3300006038 Bacteria 948
91 Ga0075368_10008514 3300006042 Bacteria 3656
92 Ga0075368_10041467 3300006042 Bacteria 1808
93 Ga0075363_100133666 3300006048 Bacteria 1393
94 Ga0075364_10050243 3300006051 Bacteria 2722
95 Ga0075367_10036164 3300006178 Bacteria 2862
96 Ga0075367_10042984 3300006178 Bacteria 2646
97 Ga0075367_10222234 3300006178 Bacteria 1182
98 Ga0075369_10151421 3300006186 Bacteria 1061
99 Ga0075369_10191276 3300006186 Bacteria 943
100 Ga0075369_10223398 3300006186 Bacteria 872
101 Ga0075366_10156478 3300006195 Bacteria 1380
102 Ga0075366_10175758 3300006195 Bacteria 1300
103 Ga0075370_10171222 3300006353 Bacteria 1276
104 Ga0075430_100324334 3300006846 Bacteria 1273
105 Ga0099826_10005187 3300006948 Bacteria 9285
106 Ga0075435_101808863 3300007076 Bacteria 536
107 Ga0105240_10000032 3300009093 Bacteria 283907
108 Ga0105240_10150610 3300009093 Bacteria 2771
109 Ga0105240_10309167 3300009093 Bacteria 1805
110 Ga0105240_12112226 3300009093 Bacteria 585
111 Ga0111539_10866809 3300009094 Bacteria 1050
112 Ga0105245_10600524 3300009098 Bacteria 1127
113 Ga0114129_11589138 3300009147 Bacteria 801
114 Ga0105243_10105644 3300009148 Bacteria 2346
115 Ga0105241_10075358 3300009174 Bacteria 2629
116 Ga0105242_10949197 3300009176 Bacteria 864
117 Ga0105237_10039537 3300009545 Bacteria 4761
118 Ga0105237_10586660 3300009545 Bacteria 1121
119 Ga0105237_11274909 3300009545 Bacteria 741
120 Ga0105238_10096952 3300009551 Bacteria 2935
121 Ga0105238_10135087 3300009551 Bacteria 2444
122 Ga0105028_104029 3300009993 Bacteria 1533
123 Ga0105239_10007520 3300010375 Bacteria 12494
124 Ga0105239_10065377 3300010375 Bacteria 3994
125 Ga0105239_10318554 3300010375 Bacteria 1753
126 Ga0105239_10404281 3300010375 Bacteria 1545
127 Ga0105246_10496654 3300011119 Bacteria 1035
128 Ga0105246_11891084 3300011119 Bacteria 573
129 Ga0157371_10009137 3300013102 Bacteria 7830
130 Ga0157370_10000986 3300013104 Bacteria 35999
131 Ga0157370_11043653 3300013104 Bacteria 739
132 Ga0157369_10311720 3300013105 Bacteria 1636
133 Ga0157369_10353330 3300013105 Bacteria 1526
134 Ga0157369_10389073 3300013105 Bacteria 1447
135 Ga0163162_12149941 3300013306 Bacteria 640
136 Ga0157372_10290413 3300013307 Bacteria 1902
137 Ga0157377_10529365 3300014745 Bacteria 829
138 Ga0182007_10001216 3300015262 Bacteria 13977
139 Ga0182007_10130020 3300015262 Bacteria 846
140 Ga0182005_1007200 3300015265 Bacteria 3352
141 Ga0163161_10997576 3300017792 Bacteria 715
142 Ga0209435_100042 3300025206 Bacteria 105563
143 Ga0209760_109870 3300025207 Bacteria 636
144 Ga0209672_113207 3300025228 Bacteria 998
145 Ga0209437_100033 3300025233 Bacteria 512520
146 Ga0209437_100075 3300025233 Bacteria 297202
147 Ga0209646_1000145 3300025246 Bacteria 105563
148 Ga0209646_1036541 3300025246 Bacteria 636
149 Ga0209026_1000160 3300025250 Bacteria 105563
150 Ga0209677_109167 3300025253 Bacteria 1812
151 Ga0209148_1002908 3300025254 Bacteria 5217
152 Ga0209759_1000177 3300025256 Bacteria 105563
153 Ga0209233_1000056 3300025261 Bacteria 438104
154 Ga0209233_1000064 3300025261 Bacteria 392156
155 Ga0209233_1000209 3300025261 Bacteria 115124
156 Ga0209455_1011152 3300025272 Bacteria 2231
157 Ga0209673_1001371 3300025273 Bacteria 23980
158 Ga0209130_1000018 3300025284 Bacteria 388301
159 Ga0209676_1033493 3300025292 Bacteria 1529
160 Ga0209050_1006882 3300025298 Bacteria 6594
161 Ga0207426_1000044 3300025302 Bacteria 428043
162 Ga0209051_1000514 3300025303 Bacteria 48877
163 Ga0209257_1003433 3300025304 Bacteria 13603
164 Ga0207656_10001464 3300025321 Bacteria 7825
165 Ga0207656_10106089 3300025321 Bacteria 1293
166 Ga0207645_10041069 3300025907 Bacteria 2962
167 Ga0207705_10369218 3300025909 Bacteria 1107
168 Ga0207654_10677641 3300025911 Bacteria 740
169 Ga0207695_10000024 3300025913 Bacteria 632311
170 Ga0207695_10516580 3300025913 Bacteria 1076
171 Ga0207671_10000548 3300025914 Bacteria 50646
172 Ga0207657_10021947 3300025919 Bacteria 5994
173 Ga0207657_10026978 3300025919 Bacteria 5267
174 Ga0207649_10003100 3300025920 Bacteria 9118
175 Ga0207649_10038038 3300025920 Bacteria 2911
176 Ga0207649_10232126 3300025920 Bacteria 1320
177 Ga0207690_10227503 3300025932 Bacteria 1430
178 Ga0207690_10458381 3300025932 Bacteria 1026
179 Ga0207706_10656947 3300025933 Bacteria 898
180 Ga0207670_10851107 3300025936 Bacteria 762
181 Ga0207669_10560577 3300025937 Bacteria 923
182 Ga0207669_11474941 3300025937 Bacteria 580
183 Ga0207704_10121566 3300025938 Bacteria 1788
184 Ga0207704_10575076 3300025938 Bacteria 919
185 Ga0207691_10949539 3300025940 Bacteria 719
186 Ga0207679_11491354 3300025945 Bacteria 620
187 Ga0207667_10585032 3300025949 Bacteria 1126
188 Ga0207667_10966489 3300025949 Bacteria 840
189 Ga0207651_10862448 3300025960 Bacteria 805
190 Ga0207668_10386918 3300025972 Bacteria 1179
191 Ga0207640_10009219 3300025981 Bacteria 5518
192 Ga0207640_10204161 3300025981 Bacteria 1500
193 Ga0207640_10226325 3300025981 Bacteria 1435
194 Ga0207677_10265064 3300026023 Bacteria 1402
195 Ga0207677_11120675 3300026023 Bacteria 718
196 Ga0207639_10000897 3300026041 Bacteria 20194
197 Ga0207639_10005546 3300026041 Bacteria 8532
198 Ga0207639_10175819 3300026041 Bacteria 1817
199 Ga0207678_10090746 3300026067 Bacteria 2611
200 Ga0207702_10047089 3300026078 Bacteria 3632
201 Ga0207702_10367053 3300026078 Bacteria 1381
202 Ga0207641_12038616 3300026088 Bacteria 575
203 Ga0207648_10114266 3300026089 Bacteria 2372
204 Ga0207674_10003842 3300026116 Bacteria 18310
205 Ga0207674_10332972 3300026116 Bacteria 1468
206 Ga0207674_10480731 3300026116 Bacteria 1201
207 Ga0207683_10751736 3300026121 Bacteria 905
208 Ga0207698_10019025 3300026142 Bacteria 4691
209 Ga0207698_10071975 3300026142 Bacteria 2746
210 Ga0207698_10195038 3300026142 Bacteria 1808
211 Ga0209371_1006525 3300027312 Bacteria 4299
212 Ga0209974_10075760 3300027876 Bacteria 1152
213 Ga0268266_10483489 3300028379 Bacteria 1181
214 Ga0268265_11591857 3300028380 Bacteria 658
215 Ga0307515_10035625 3300028794 Bacteria 8086
216 Ga0307515_10117469 3300028794 Bacteria 3044
217 Ga0268256_1022574 3300030500 Bacteria 1647
218 Ga0316181_1269488 3300030744 Bacteria 4214
219 Ga0265328_10095552 3300031239 Bacteria 1099
220 Ga0307513_10188946 3300031456 Bacteria 1914
221 Ga0307516_10129543 3300031730 Bacteria 2304
222 Ga0307405_10464329 3300031731 Bacteria 1007
223 Ga0307410_11714686 3300031852 Bacteria 557
224 Ga0307416_101331781 3300032002 Bacteria 824
225 Ga0307416_102030921 3300032002 Bacteria 677
226 Ga0307414_10017936 3300032004 Bacteria 4342
227 Ga0307414_10871538 3300032004 Bacteria 824
228 Ga0307414_11436604 3300032004 Bacteria 641
229 Ga0307411_10494598 3300032005 Bacteria 1033
230 Ga0373939_0127794 3300035114 Bacteria 904
231 Ga0373946_0069517 3300035171 Bacteria 1517
232 Ga0373927_0000258 3300035695 Bacteria 41757
233 Ga0373947_0450345 3300035725 Bacteria 872
234 Ga0373925_0007934 3300037068 Bacteria 7731
235 Ga0395899_0026755 3300037312 Bacteria 4352
236 Ga0395899_0059121 3300037312 Bacteria 2825
237 Ga0395900_0179313 3300037418 Bacteria 2153
238 Ga0395900_0300896 3300037418 Bacteria 1590
239 Ga0395900_1702489 3300037418 Bacteria 541
240 Ga0395898_0217146 3300037466 Bacteria 1824
241 Ga0395898_0908482 3300037466 Bacteria 818
242 Ga0395905_0000711 3300037471 Bacteria 44086
243 Ga0395905_0031019 3300037471 Bacteria 5034
244 Ga0395905_0287634 3300037471 Bacteria 1530
245 Ga0395901_0132730 3300038443 Bacteria 2616
246 Ga0395901_0319153 3300038443 Bacteria 1608
247 Ga0395901_0366973 3300038443 Bacteria 1483
248 Ga0395901_0819044 3300038443 Bacteria 918
249 Ga0395901_0998189 3300038443 Bacteria 813
250 Ga0439465_0023455 3300041413 Bacteria 1942
251 Ga0439465_0030175 3300041413 Bacteria 1724
252 Ga0439465_0119546 3300041413 Bacteria 923
253 Ga0439432_074229 3300042006 Bacteria 1035
254 Ga0450901_003202 3300042533 Bacteria 1717
255 Ga0466966_0084793 3300044684 Bacteria 1970
256 Ga0466963_0090414 3300044694 Bacteria 2084
257 Ga0466970_0017342 3300044765 Bacteria 3720
258 Ga0466959_0131540 3300045049 Bacteria 1773
259 Ga0451576_0255127 3300045051 Bacteria 1833
260 Ga0466967_0357624 3300045976 Bacteria 1414
261 Ga0466967_0991189 3300045976 Bacteria 837
262 Ga0495638_0000353 3300046460 Bacteria 57451
263 Ga0495638_0028176 3300046460 Bacteria 3629
264 Ga0495638_0250416 3300046460 Bacteria 977
265 Ga0495605_0007427 3300046474 Bacteria 6219
266 Ga0495662_0071406 3300046476 Bacteria 1682
267 Ga0495585_0006433 3300046492 Bacteria 7289
268 Ga0495607_0117518 3300046501 Bacteria 1401
269 Ga0495616_0048406 3300046513 Bacteria 2136
270 Ga0495620_0126082 3300046515 Bacteria 1007
271 Ga0495632_0048475 3300046519 Bacteria 2103
272 Ga0495643_0048443 3300046522 Bacteria 2297
273 Ga0495652_0193514 3300046529 Bacteria 1550
274 Ga0495640_0228747 3300046533 Bacteria 1170
275 Ga0495609_0018530 3300046538 Bacteria 3225
276 Ga0495633_0012154 3300046558 Bacteria 4593
277 Ga0495668_0012552 3300046616 Bacteria 5023
278 Ga0495634_0119420 3300046642 Bacteria 1689
279 Ga0495611_0017639 3300046648 Bacteria 3056
280 Ga0495625_0001623 3300046660 Bacteria 26508
281 Ga0495625_0347891 3300046660 Bacteria 938
282 Ga0495657_0358220 3300046675 Bacteria 862
283 Ga0495658_0244119 3300046683 Bacteria 1128
284 Ga0495670_0129337 3300046691 Bacteria 1316
285 Ga0495600_0044014 3300046809 Bacteria 2912
286 Ga0495660_0033898 3300046810 Bacteria 2860
287 Ga0495660_0096574 3300046810 Bacteria 1527
288 Ga0495604_0168308 3300047317 Bacteria 1543
289 Ga0495672_0011740 3300047320 Bacteria 6160
290 Ga0495681_0226891 3300047470 Bacteria 747
291 Ga0495686_0177868 3300047472 Bacteria 1234
292 Ga0495626_0129124 3300048091 Bacteria 1081
293 Ga0496100_0141968 3300048903 Bacteria 1703
294 Ga0496101_0033649 3300048904 Bacteria 3616
295 Ga0496101_0585820 3300048904 Bacteria 882
296 Ga0496102_0137185 3300048905 Bacteria 2292
297 Ga0496103_0382553 3300048906 Bacteria 904
298 Ga0496110_0909504 3300048913 Bacteria 786
299 Ga0496115_0008714 3300048918 Bacteria 7518
300 Ga0496116_0007220 3300048919 Bacteria 9912
301 Ga0496116_0017175 3300048919 Bacteria 5629
302 Ga0496116_0054584 3300048919 Bacteria 2631
303 Ga0496117_0061050 3300048920 Bacteria 2593
304 Ga0496117_0108356 3300048920 Bacteria 1738
305 Ga0496118_0046838 3300048921 Bacteria 3358
306 Ga0496119_0063712 3300048922 Bacteria 2191
307 Ga0496119_0381403 3300048922 Bacteria 676
308 Ga0496120_0038012 3300048923 Bacteria 2851
309 Ga0496120_0105546 3300048923 Bacteria 1481
310 Ga0496121_0001632 3300048924 Bacteria 37117
311 Ga0496121_0069860 3300048924 Bacteria 2832
312 Ga0496121_0119176 3300048924 Bacteria 1996
313 Ga0496121_0135130 3300048924 Bacteria 1839
314 Ga0496121_0413976 3300048924 Bacteria 879
315 Ga0496122_0032451 3300048925 Bacteria 4318
316 Ga0496122_0039080 3300048925 Bacteria 3789
317 Ga0496122_0045097 3300048925 Bacteria 3431
318 Ga0496122_0257488 3300048925 Bacteria 971
319 Ga0496123_0030918 3300048926 Bacteria 3909
320 Ga0496123_0060922 3300048926 Bacteria 2429
321 Ga0496123_0419162 3300048926 Bacteria 604
322 Ga0496124_0035244 3300048927 Bacteria 4380
323 Ga0496124_0098897 3300048927 Bacteria 2366
324 Ga0496124_0316877 3300048927 Bacteria 1119
325 Ga0496125_0000719 3300048928 Bacteria 54794
326 Ga0496125_0248126 3300048928 Bacteria 1125
327 Ga0496126_0042355 3300048929 Bacteria 4206
328 Ga0496126_0186128 3300048929 Bacteria 1761
329 Ga0495682_0234137 3300049460 Bacteria 650
330 Ga0501031_0046500 3300049568 Bacteria 2830
331 Ga0501031_0047506 3300049568 Bacteria 2798
332 Ga0501032_0058134 3300049569 Bacteria 2596
333 Ga0501032_0120304 3300049569 Bacteria 1736
334 Ga0501032_0141492 3300049569 Bacteria 1584
335 Ga0501033_0000145 3300049570 Bacteria 68524
336 Ga0501033_0062783 3300049570 Bacteria 2735
337 Ga0501033_0171940 3300049570 Bacteria 1556
338 Ga0501033_0340955 3300049570 Bacteria 1051
339 Ga0501034_0044043 3300049571 Bacteria 4514
340 Ga0501034_0051140 3300049571 Bacteria 4166
341 Ga0501034_0056712 3300049571 Bacteria 3940
342 Ga0501034_0177251 3300049571 Bacteria 2097
343 Ga0501034_0220711 3300049571 Bacteria 1848
344 Ga0501034_0344377 3300049571 Bacteria 1420
345 Ga0501034_0349307 3300049571 Bacteria 1407
346 Ga0501036_0038779 3300049572 Bacteria 4033
347 Ga0501036_0058851 3300049572 Bacteria 3256
348 Ga0501036_0079947 3300049572 Bacteria 2764
349 Ga0501036_0446064 3300049572 Bacteria 1078
350 Ga0501037_0043998 3300049573 Bacteria 3281
351 Ga0501038_0054399 3300049574 Bacteria 3443
352 Ga0501038_0068064 3300049574 Bacteria 3028
353 Ga0501038_0130419 3300049574 Bacteria 2064
354 Ga0501038_0513893 3300049574 Bacteria 915
355 Ga0501039_0056906 3300049575 Bacteria 3029
356 Ga0501039_0654032 3300049575 Bacteria 823
357 Ga0501039_1006091 3300049575 Bacteria 648
358 Ga0501040_0009924 3300049576 Bacteria 6215
359 Ga0501040_0481754 3300049576 Bacteria 894
360 Ga0501041_0012713 3300049577 Bacteria 4988
361 Ga0501042_0154562 3300049578 Bacteria 1655
362 Ga0501042_0217968 3300049578 Bacteria 1376
363 Ga0501043_0052724 3300049579 Bacteria 3194
364 Ga0501043_0228192 3300049579 Bacteria 1439
365 Ga0501043_0281328 3300049579 Bacteria 1275
366 Ga0501046_0015296 3300049580 Bacteria 6452
367 Ga0501046_0178320 3300049580 Bacteria 1590
368 Ga0501046_0328644 3300049580 Bacteria 1113
369 Ga0501047_0116801 3300049581 Bacteria 2549
370 Ga0501047_0316608 3300049581 Bacteria 1401
371 Ga0501048_0070754 3300049582 Bacteria 2463
372 Ga0501068_0015830 3300049584 Bacteria 4341
373 Ga0501070_0116928 3300049586 Bacteria 2202
374 Ga0501070_0352389 3300049586 Bacteria 1194
375 Ga0501070_1198520 3300049586 Bacteria 583
376 Ga0501071_0021489 3300049587 Bacteria 4495
377 Ga0501071_0309847 3300049587 Bacteria 1198
378 Ga0501071_0563446 3300049587 Bacteria 875
379 Ga0501072_0054171 3300049588 Bacteria 3159
380 Ga0501072_0351424 3300049588 Bacteria 1170
381 Ga0501074_0324365 3300049590 Bacteria 1093
382 Ga0501075_0129761 3300049591 Bacteria 1920
383 Ga0501075_0491637 3300049591 Bacteria 936
384 Ga0501075_0616908 3300049591 Bacteria 827
385 Ga0501076_0174051 3300049592 Bacteria 1754
386 Ga0501076_0623641 3300049592 Bacteria 890
387 Ga0501076_0796355 3300049592 Bacteria 780
388 Ga0501076_1108196 3300049592 Bacteria 652
389 Ga0501077_0028065 3300049593 Bacteria 3577
390 Ga0501077_0321716 3300049593 Bacteria 986
391 Ga0501077_0503202 3300049593 Bacteria 777
392 Ga0501077_0898084 3300049593 Bacteria 570
393 Ga0501079_0024990 3300049741 Bacteria 4583
394 Ga0501079_0663627 3300049741 Bacteria 821
395 Ga0501080_0029353 3300049742 Bacteria 5120
396 Ga0501080_0114993 3300049742 Bacteria 2495
397 Ga0501080_0589817 3300049742 Bacteria 987
398 Ga0501081_0054416 3300049743 Bacteria 2765
399 Ga0501083_0660837 3300049744 Bacteria 680
400 Ga0501035_0001613 3300049822 Bacteria 22812
401 Ga0501035_0015022 3300049822 Bacteria 7146
402 Ga0501035_0192437 3300049822 Bacteria 1753
403 Ga0501044_0059220 3300049823 Bacteria 3925
404 Ga0501044_0293447 3300049823 Bacteria 1557
405 Ga0501044_0394348 3300049823 Bacteria 1297
406 Ga0501044_0778541 3300049823 Bacteria 837
407 Ga0501045_0022189 3300049824 Bacteria 4543
408 Ga0501045_0104574 3300049824 Bacteria 2098
409 Ga0501045_0204317 3300049824 Bacteria 1472
410 Ga0501045_0732537 3300049824 Bacteria 729
411 Ga0501045_0908199 3300049824 Bacteria 647
412 nmdc:mga03683_126143_c1 3300050489 Bacteria 1142
413 nmdc:mga00v17_465201_c1 3300050491 Bacteria 821
414 nmdc:mga00v17_556296_c1 3300050491 Bacteria 742
415 nmdc:mga0k408_248048_c1 3300050493 Bacteria 1063
416 nmdc:mga06z11_204002_c1 3300050494 Bacteria 1149
417 nmdc:mga07m45_218968_c1 3300050496 Bacteria 1107
418 nmdc:mga07m45_71036_c1 3300050496 Bacteria 1981
419 nmdc:mga0rr50_1010881_c1 3300050513 Bacteria 708
420 Ga0500610_0064332 3300053079 Bacteria 1913
421 Ga0500578_0126314 3300053086 Bacteria 1606
422 Ga0500646_0232394 3300053090 Bacteria 643
423 Ga0500557_014653 3300053105 Bacteria 2098
424 Ga0500594_0016441 3300053118 Bacteria 1797
425 Ga0500594_0096314 3300053118 Bacteria 905
426 Ga0500595_038600 3300053119 Bacteria 1551
427 Ga0500614_022466 3300053123 Bacteria 1473
428 Ga0500559_0012903 3300053136 Bacteria 3544
429 Ga0500568_0006791 3300053139 Bacteria 5703
430 Ga0500588_0014542 3300053146 Bacteria 1997
431 Ga0500616_0000982 3300053153 Bacteria 30793
432 Ga0500616_0009948 3300053153 Bacteria 5722
433 Ga0500616_0340764 3300053153 Bacteria 612
434 Ga0500622_0089271 3300053156 Bacteria 1532
435 Ga0500634_0000030 3300053161 Bacteria 76925
436 Ga0500634_0102928 3300053161 Bacteria 1425
437 Ga0500636_0131573 3300053177 Bacteria 1393
438 Ga0500599_064326 3300053736 Bacteria 601
439 Ga0501084_0031303 3300054114 Bacteria 4449
440 Ga0501084_0288528 3300054114 Bacteria 1386
441 Ga0501084_0323469 3300054114 Bacteria 1303
442 Ga0501084_1297805 3300054114 Bacteria 610
443 Ga0501082_0044583 3300060353 Bacteria 3825
444 Ga0501082_0067585 3300060353 Bacteria 3078
445 Ga0501082_0533951 3300060353 Bacteria 1026
446 Ga0501082_0610541 3300060353 Bacteria 954
447 Ga0530510_0132587 3300061734 Bacteria 1834
448 Ga0530510_0199301 3300061734 Bacteria 1486

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_12112226 Ga0105240_121122261 125
2 3300053153 Ga0500616_0340764 Ga0500616_0340764_17_418 125
3 3300035171 Ga0373946_0069517 Ga0373946_0069517_296_697 127
4 3300035695 Ga0373927_0000258 Ga0373927_0000258_7021_7422 127
5 3300035725 Ga0373947_0450345 Ga0373947_0450345_187_588 127
6 3300037068 Ga0373925_0007934 Ga0373925_0007934_5234_5635 127
7 3300053118 Ga0500594_0096314 Ga0500594_0096314_12_413 128
8 3300048924 Ga0496121_0413976 Ga0496121_0413976_423_845 129
9 3300049592 Ga0501076_0796355 Ga0501076_0796355_278_706 135
10 3300054114 Ga0501084_1297805 Ga0501084_1297805_131_559 135
11 3300049593 Ga0501077_0898084 Ga0501077_0898084_26_442 136
12 3300049741 Ga0501079_0663627 Ga0501079_0663627_20_436 136
13 3300009093 Ga0105240_10000032 Ga0105240_10000032231 142
14 3300010375 Ga0105239_10404281 Ga0105239_104042812 142
15 3300013104 Ga0157370_10000986 Ga0157370_100009862 142
16 3300048903 Ga0496100_0141968 Ga0496100_0141968_203_631 142
17 3300048904 Ga0496101_0585820 Ga0496101_0585820_145_573 142
18 3300048905 Ga0496102_0137185 Ga0496102_0137185_1773_2201 142
19 3300048906 Ga0496103_0382553 Ga0496103_0382553_424_852 142
20 3300048919 Ga0496116_0017175 Ga0496116_0017175_4514_4942 142
21 3300048922 Ga0496119_0063712 Ga0496119_0063712_44_472 142
22 3300048923 Ga0496120_0038012 Ga0496120_0038012_995_1423 142
23 3300048924 Ga0496121_0001632 Ga0496121_0001632_34000_34428 142
24 3300048925 Ga0496122_0039080 Ga0496122_0039080_2936_3364 142
25 3300048926 Ga0496123_0060922 Ga0496123_0060922_1720_2148 142
26 3300048927 Ga0496124_0098897 Ga0496124_0098897_315_743 142
27 3300005530 Ga0070679_100933114 Ga0070679_1009331141 144
28 3300025938 Ga0207704_10575076 Ga0207704_105750762 144
29 3300049586 Ga0501070_1198520 Ga0501070_1198520_133_573 144
30 3300049591 Ga0501075_0616908 Ga0501075_0616908_370_810 144
31 3300026088 Ga0207641_12038616 Ga0207641_120386161 145
32 3300007076 Ga0075435_101808863 Ga0075435_1018088631 146
33 3300037418 Ga0395900_1702489 Ga0395900_1702489_35_496 146
34 3300050513 nmdc:mga0rr50_1010881_c1 nmdc:mga0rr50_1010881_c1_43_501 146
35 3300025933 Ga0207706_10656947 Ga0207706_106569472 147
36 3300025936 Ga0207670_10851107 Ga0207670_108511071 147
37 3300005356 Ga0070674_100147161 Ga0070674_1001471611 148
38 3300005356 Ga0070674_101642039 Ga0070674_1016420391 148
39 3300005456 Ga0070678_100839209 Ga0070678_1008392092 148
40 3300005543 Ga0070672_100551001 Ga0070672_1005510012 148
41 3300005564 Ga0070664_101368858 Ga0070664_1013688581 148
42 3300006846 Ga0075430_100324334 Ga0075430_1003243341 148
43 3300009094 Ga0111539_10866809 Ga0111539_108668091 148
44 3300009147 Ga0114129_11589138 Ga0114129_115891382 148
45 3300013306 Ga0163162_12149941 Ga0163162_121499411 148
46 3300014745 Ga0157377_10529365 Ga0157377_105293651 148
47 3300017792 Ga0163161_10997576 Ga0163161_109975762 148
48 3300025937 Ga0207669_10560577 Ga0207669_105605771 148
49 3300025937 Ga0207669_11474941 Ga0207669_114749411 148
50 3300025940 Ga0207691_10949539 Ga0207691_109495391 148
51 3300025945 Ga0207679_11491354 Ga0207679_114913541 148
52 3300026121 Ga0207683_10751736 Ga0207683_107517361 148
53 3300028380 Ga0268265_11591857 Ga0268265_115918571 148
54 3300032002 Ga0307416_101331781 Ga0307416_1013317812 148
55 3300032002 Ga0307416_102030921 Ga0307416_1020309211 148
56 3300037418 Ga0395900_0300896 Ga0395900_0300896_985_1449 148
57 3300037466 Ga0395898_0217146 Ga0395898_0217146_1191_1655 148
58 3300037471 Ga0395905_0031019 Ga0395905_0031019_3377_3841 148
59 3300046460 Ga0495638_0250416 Ga0495638_0250416_59_550 148
60 3300047470 Ga0495681_0226891 Ga0495681_0226891_200_691 148
61 3300048904 Ga0496101_0033649 Ga0496101_0033649_27_497 148
62 3300048919 Ga0496116_0007220 Ga0496116_0007220_3665_4135 148
63 3300048920 Ga0496117_0061050 Ga0496117_0061050_177_647 148
64 3300048921 Ga0496118_0046838 Ga0496118_0046838_552_1022 148
65 3300048925 Ga0496122_0032451 Ga0496122_0032451_2204_2674 148
66 3300048926 Ga0496123_0030918 Ga0496123_0030918_1235_1705 148
67 3300048927 Ga0496124_0035244 Ga0496124_0035244_2232_2702 148
68 3300049568 Ga0501031_0046500 Ga0501031_0046500_1772_2236 148
69 3300049569 Ga0501032_0120304 Ga0501032_0120304_764_1228 148
70 3300049570 Ga0501033_0340955 Ga0501033_0340955_366_830 148
71 3300049572 Ga0501036_0038779 Ga0501036_0038779_1337_1801 148
72 3300049572 Ga0501036_0058851 Ga0501036_0058851_342_806 148
73 3300049574 Ga0501038_0054399 Ga0501038_0054399_615_1079 148
74 3300049575 Ga0501039_0654032 Ga0501039_0654032_210_674 148
75 3300049576 Ga0501040_0009924 Ga0501040_0009924_2731_3195 148
76 3300049576 Ga0501040_0481754 Ga0501040_0481754_193_657 148
77 3300049577 Ga0501041_0012713 Ga0501041_0012713_2033_2497 148
78 3300049578 Ga0501042_0154562 Ga0501042_0154562_576_1040 148
79 3300049578 Ga0501042_0217968 Ga0501042_0217968_115_579 148
80 3300049579 Ga0501043_0228192 Ga0501043_0228192_727_1191 148
81 3300049580 Ga0501046_0015296 Ga0501046_0015296_5086_5550 148
82 3300049580 Ga0501046_0178320 Ga0501046_0178320_82_546 148
83 3300049582 Ga0501048_0070754 Ga0501048_0070754_1885_2349 148
84 3300049584 Ga0501068_0015830 Ga0501068_0015830_2702_3166 148
85 3300049587 Ga0501071_0021489 Ga0501071_0021489_3100_3564 148
86 3300049588 Ga0501072_0054171 Ga0501072_0054171_890_1354 148
87 3300049588 Ga0501072_0351424 Ga0501072_0351424_557_1021 148
88 3300049590 Ga0501074_0324365 Ga0501074_0324365_11_475 148
89 3300049591 Ga0501075_0129761 Ga0501075_0129761_568_1032 148
90 3300049592 Ga0501076_0174051 Ga0501076_0174051_600_1064 148
91 3300049593 Ga0501077_0028065 Ga0501077_0028065_2769_3233 148
92 3300049593 Ga0501077_0503202 Ga0501077_0503202_76_540 148
93 3300049741 Ga0501079_0024990 Ga0501079_0024990_2193_2657 148
94 3300049742 Ga0501080_0114993 Ga0501080_0114993_1874_2338 148
95 3300049743 Ga0501081_0054416 Ga0501081_0054416_1713_2177 148
96 3300049824 Ga0501045_0022189 Ga0501045_0022189_1828_2292 148
97 3300049824 Ga0501045_0104574 Ga0501045_0104574_472_936 148
98 3300054114 Ga0501084_0031303 Ga0501084_0031303_766_1230 148
99 3300054114 Ga0501084_0323469 Ga0501084_0323469_81_545 148
100 3300060353 Ga0501082_0044583 Ga0501082_0044583_785_1249 148
101 3300060353 Ga0501082_0067585 Ga0501082_0067585_1069_1533 148
102 3300061734 Ga0530510_0199301 Ga0530510_0199301_880_1344 148
103 3300005981 Ga0081538_10025268 Ga0081538_100252685 149
104 3300009993 Ga0105028_104029 Ga0105028_1040292 149
105 3300046810 Ga0495660_0096574 Ga0495660_0096574_734_1261 149
106 3300048929 Ga0496126_0186128 Ga0496126_0186128_1152_1622 149
107 3300049575 Ga0501039_1006091 Ga0501039_1006091_94_564 150
108 3300049587 Ga0501071_0309847 Ga0501071_0309847_80_550 150
109 3300049591 Ga0501075_0491637 Ga0501075_0491637_397_870 150
110 3300049592 Ga0501076_0623641 Ga0501076_0623641_171_641 150
111 3300049824 Ga0501045_0204317 Ga0501045_0204317_745_1215 150
112 3300060353 Ga0501082_0533951 Ga0501082_0533951_209_682 150
113 iso_pu_bacteria 2585427530 2585554867 150
114 iso_pu_bacteria 2818991453 2819639266 150
115 3300002737 JGI25162J39368_1001722 JGI25162J39368_10017227 151
116 3300003214 JGI25165J46597_1011001 JGI25165J46597_10110011 151
117 3300031731 Ga0307405_10464329 Ga0307405_104643292 151
118 3300032004 Ga0307414_10017936 Ga0307414_100179366 151
119 3300032004 Ga0307414_11436604 Ga0307414_114366041 151
120 3300048922 Ga0496119_0381403 Ga0496119_0381403_89_598 151
121 3300003320 rootH2_10120970 rootH2_101209702 152
122 3300006038 Ga0075365_10213639 Ga0075365_102136392 152
123 3300006042 Ga0075368_10008514 Ga0075368_100085144 152
124 3300006048 Ga0075363_100133666 Ga0075363_1001336663 152
125 3300006051 Ga0075364_10050243 Ga0075364_100502432 152
126 3300006178 Ga0075367_10042984 Ga0075367_100429843 152
127 3300006186 Ga0075369_10223398 Ga0075369_102233982 152
128 3300006195 Ga0075366_10156478 Ga0075366_101564782 152
129 3300006353 Ga0075370_10171222 Ga0075370_101712222 152
130 3300027876 Ga0209974_10075760 Ga0209974_100757602 152
131 3300049571 Ga0501034_0051140 Ga0501034_0051140_249_752 152
132 3300049571 Ga0501034_0177251 Ga0501034_0177251_113_616 152
133 3300050489 nmdc:mga03683_126143_c1 nmdc:mga03683_126143_c1_153_659 152
134 3300050491 nmdc:mga00v17_556296_c1 nmdc:mga00v17_556296_c1_213_719 152
135 3300050496 nmdc:mga07m45_71036_c1 nmdc:mga07m45_71036_c1_476_982 152
136 3300053161 Ga0500634_0000030 Ga0500634_0000030_70521_71009 152
137 3300053161 Ga0500634_0102928 Ga0500634_0102928_782_1270 152
138 3300003320 rootH2_10067834 rootH2_100678342 153
139 3300003323 rootH1_10050700 rootH1_100507002 153
140 3300005327 Ga0070658_10003333 Ga0070658_1000333310 153
141 3300005327 Ga0070658_10066909 Ga0070658_100669093 153
142 3300005328 Ga0070676_10171423 Ga0070676_101714233 153
143 3300005329 Ga0070683_100346380 Ga0070683_1003463802 153
144 3300005339 Ga0070660_100012650 Ga0070660_1000126505 153
145 3300005339 Ga0070660_100149030 Ga0070660_1001490303 153
146 3300005344 Ga0070661_100002175 Ga0070661_1000021756 153
147 3300005344 Ga0070661_100044743 Ga0070661_1000447434 153
148 3300005344 Ga0070661_100172034 Ga0070661_1001720342 153
149 3300005344 Ga0070661_100901948 Ga0070661_1009019481 153
150 3300005366 Ga0070659_100006686 Ga0070659_1000066863 153
151 3300005457 Ga0070662_100300456 Ga0070662_1003004562 153
152 3300005459 Ga0068867_100267246 Ga0068867_1002672462 153
153 3300005539 Ga0068853_100000752 Ga0068853_10000075210 153
154 3300005539 Ga0068853_100049258 Ga0068853_1000492586 153
155 3300005539 Ga0068853_100138386 Ga0068853_1001383863 153
156 3300005563 Ga0068855_100042614 Ga0068855_1000426146 153
157 3300005564 Ga0070664_100167601 Ga0070664_1001676012 153
158 3300005577 Ga0068857_100259347 Ga0068857_1002593473 153
159 3300005577 Ga0068857_100340723 Ga0068857_1003407232 153
160 3300005578 Ga0068854_100012747 Ga0068854_1000127476 153
161 3300005578 Ga0068854_100176163 Ga0068854_1001761633 153
162 3300005578 Ga0068854_101127644 Ga0068854_1011276442 153
163 3300005614 Ga0068856_100013451 Ga0068856_1000134515 153
164 3300005614 Ga0068856_100042150 Ga0068856_1000421502 153
165 3300005614 Ga0068856_100099984 Ga0068856_1000999843 153
166 3300005614 Ga0068856_100213533 Ga0068856_1002135332 153
167 3300005616 Ga0068852_100013606 Ga0068852_1000136062 153
168 3300005616 Ga0068852_100031137 Ga0068852_1000311374 153
169 3300005616 Ga0068852_100067077 Ga0068852_1000670772 153
170 3300005616 Ga0068852_100187857 Ga0068852_1001878572 153
171 3300005834 Ga0068851_10003875 Ga0068851_100038752 153
172 3300005834 Ga0068851_10046556 Ga0068851_100465565 153
173 3300009093 Ga0105240_10150610 Ga0105240_101506105 153
174 3300009093 Ga0105240_10309167 Ga0105240_103091672 153
175 3300009174 Ga0105241_10075358 Ga0105241_100753583 153
176 3300009176 Ga0105242_10949197 Ga0105242_109491972 153
177 3300009551 Ga0105238_10096952 Ga0105238_100969522 153
178 3300009551 Ga0105238_10135087 Ga0105238_101350873 153
179 3300010375 Ga0105239_10007520 Ga0105239_100075206 153
180 3300010375 Ga0105239_10065377 Ga0105239_100653772 153
181 3300011119 Ga0105246_10496654 Ga0105246_104966541 153
182 3300013102 Ga0157371_10009137 Ga0157371_100091376 153
183 3300013104 Ga0157370_11043653 Ga0157370_110436531 153
184 3300013105 Ga0157369_10311720 Ga0157369_103117203 153
185 3300013105 Ga0157369_10353330 Ga0157369_103533302 153
186 3300013307 Ga0157372_10290413 Ga0157372_102904132 153
187 3300025321 Ga0207656_10001464 Ga0207656_1000146410 153
188 3300025911 Ga0207654_10677641 Ga0207654_106776412 153
189 3300025913 Ga0207695_10516580 Ga0207695_105165802 153
190 3300025919 Ga0207657_10021947 Ga0207657_100219474 153
191 3300025919 Ga0207657_10026978 Ga0207657_100269782 153
192 3300025920 Ga0207649_10003100 Ga0207649_100031003 153
193 3300025920 Ga0207649_10038038 Ga0207649_100380384 153
194 3300025920 Ga0207649_10232126 Ga0207649_102321262 153
195 3300025932 Ga0207690_10227503 Ga0207690_102275032 153
196 3300025949 Ga0207667_10966489 Ga0207667_109664891 153
197 3300025981 Ga0207640_10009219 Ga0207640_100092193 153
198 3300025981 Ga0207640_10204161 Ga0207640_102041612 153
199 3300025981 Ga0207640_10226325 Ga0207640_102263253 153
200 3300026023 Ga0207677_10265064 Ga0207677_102650642 153
201 3300026041 Ga0207639_10005546 Ga0207639_100055464 153
202 3300026041 Ga0207639_10175819 Ga0207639_101758194 153
203 3300026078 Ga0207702_10047089 Ga0207702_100470893 153
204 3300026078 Ga0207702_10367053 Ga0207702_103670533 153
205 3300026089 Ga0207648_10114266 Ga0207648_101142663 153
206 3300026116 Ga0207674_10003842 Ga0207674_1000384215 153
207 3300026116 Ga0207674_10332972 Ga0207674_103329723 153
208 3300026142 Ga0207698_10019025 Ga0207698_100190257 153
209 3300026142 Ga0207698_10195038 Ga0207698_101950382 153
210 3300035114 Ga0373939_0127794 Ga0373939_0127794_104_616 153
211 3300037312 Ga0395899_0059121 Ga0395899_0059121_660_1172 153
212 3300037418 Ga0395900_0179313 Ga0395900_0179313_1307_1819 153
213 3300037466 Ga0395898_0908482 Ga0395898_0908482_77_589 153
214 3300038443 Ga0395901_0132730 Ga0395901_0132730_1100_1612 153
215 3300049568 Ga0501031_0047506 Ga0501031_0047506_1678_2193 153
216 3300049569 Ga0501032_0058134 Ga0501032_0058134_1606_2121 153
217 3300049570 Ga0501033_0062783 Ga0501033_0062783_434_949 153
218 3300049571 Ga0501034_0349307 Ga0501034_0349307_723_1238 153
219 3300049572 Ga0501036_0079947 Ga0501036_0079947_698_1213 153
220 3300049572 Ga0501036_0446064 Ga0501036_0446064_436_930 153
221 3300049574 Ga0501038_0130419 Ga0501038_0130419_890_1405 153
222 3300049575 Ga0501039_0056906 Ga0501039_0056906_1540_2055 153
223 3300049579 Ga0501043_0052724 Ga0501043_0052724_351_866 153
224 3300049580 Ga0501046_0328644 Ga0501046_0328644_402_917 153
225 3300049581 Ga0501047_0116801 Ga0501047_0116801_1638_2153 153
226 3300049586 Ga0501070_0352389 Ga0501070_0352389_301_816 153
227 3300049587 Ga0501071_0563446 Ga0501071_0563446_302_817 153
228 3300049822 Ga0501035_0192437 Ga0501035_0192437_349_864 153
229 3300049823 Ga0501044_0293447 Ga0501044_0293447_1038_1502 153
230 3300049823 Ga0501044_0394348 Ga0501044_0394348_744_1259 153
231 3300049824 Ga0501045_0908199 Ga0501045_0908199_13_528 153
232 3300053119 Ga0500595_038600 Ga0500595_038600_903_1415 153
233 iso_pu_bacteria 2989349275 2989354193 153
234 iso_pu_bacteria 8054558443 8054562118 153
235 3300005328 Ga0070676_10101375 Ga0070676_101013752 154
236 3300005338 Ga0068868_100924641 Ga0068868_1009246411 154
237 3300005339 Ga0070660_100420435 Ga0070660_1004204352 154
238 3300005347 Ga0070668_100342702 Ga0070668_1003427022 154
239 3300005356 Ga0070674_100013689 Ga0070674_1000136891 154
240 3300005364 Ga0070673_100035107 Ga0070673_1000351072 154
241 3300005543 Ga0070672_100148695 Ga0070672_1001486953 154
242 3300005548 Ga0070665_100755218 Ga0070665_1007552182 154
243 3300005563 Ga0068855_100297210 Ga0068855_1002972102 154
244 3300005563 Ga0068855_100559816 Ga0068855_1005598163 154
245 3300005577 Ga0068857_100117628 Ga0068857_1001176283 154
246 3300005841 Ga0068863_100589873 Ga0068863_1005898732 154
247 3300009098 Ga0105245_10600524 Ga0105245_106005242 154
248 3300009148 Ga0105243_10105644 Ga0105243_101056443 154
249 3300009545 Ga0105237_11274909 Ga0105237_112749091 154
250 3300011119 Ga0105246_11891084 Ga0105246_118910841 154
251 3300025907 Ga0207645_10041069 Ga0207645_100410693 154
252 3300025932 Ga0207690_10458381 Ga0207690_104583811 154
253 3300025938 Ga0207704_10121566 Ga0207704_101215662 154
254 3300025960 Ga0207651_10862448 Ga0207651_108624482 154
255 3300025972 Ga0207668_10386918 Ga0207668_103869183 154
256 3300026023 Ga0207677_11120675 Ga0207677_111206752 154
257 3300026067 Ga0207678_10090746 Ga0207678_100907463 154
258 3300026116 Ga0207674_10480731 Ga0207674_104807312 154
259 3300028379 Ga0268266_10483489 Ga0268266_104834892 154
260 3300031239 Ga0265328_10095552 Ga0265328_100955522 154
261 3300045051 Ga0451576_0255127 Ga0451576_0255127_30_512 154
262 3300048924 Ga0496121_0069860 Ga0496121_0069860_403_906 154
263 3300048924 Ga0496121_0135130 Ga0496121_0135130_370_882 154
264 3300048929 Ga0496126_0042355 Ga0496126_0042355_1374_1877 154
265 3300049570 Ga0501033_0000145 Ga0501033_0000145_31072_31554 154
266 3300049571 Ga0501034_0044043 Ga0501034_0044043_1580_2095 154
267 3300049574 Ga0501038_0513893 Ga0501038_0513893_178_690 154
268 3300049822 Ga0501035_0001613 Ga0501035_0001613_1888_2370 154
269 3300054114 Ga0501084_0288528 Ga0501084_0288528_559_1074 154
270 iso_pu_bacteria 2509276021 2509387731 154
271 iso_pu_bacteria 2529292951 2530643908 154
272 iso_pu_bacteria 2643221637 2644206224 154
273 iso_pu_bacteria 2643221718 2644649871 154
274 iso_pu_bacteria 2718217927 2719384845 154
275 iso_pu_bacteria 2718218423 2721398564 154
276 iso_pu_bacteria 2721755809 2724037377 154
277 iso_pu_bacteria 2791355267 2793367834 154
278 iso_pu_bacteria 2841864319 2841865492 154
279 iso_pu_bacteria 2842341865 2842343612 154
280 iso_pu_bacteria 2842363717 2842365232 154
281 iso_pu_bacteria 2842395702 2842398283 154
282 iso_pu_bacteria 8005275841 8005279564 154
283 iso_pu_bacteria 8005695170 8005698808 154
284 iso_pu_bacteria 8018176218 8018177261 154
285 iso_pu_bacteria 8056375014 8056380714 154
286 3300003320 rootH2_10044307 rootH2_100443075 155
287 3300010375 Ga0105239_10318554 Ga0105239_103185542 155
288 3300031852 Ga0307410_11714686 Ga0307410_117146861 155
289 3300032005 Ga0307411_10494598 Ga0307411_104945982 155
290 3300037471 Ga0395905_0000711 Ga0395905_0000711_11555_12049 155
291 3300037471 Ga0395905_0287634 Ga0395905_0287634_678_1172 155
292 3300038443 Ga0395901_0319153 Ga0395901_0319153_1023_1517 155
293 3300048918 Ga0496115_0008714 Ga0496115_0008714_2641_3111 155
294 3300053136 Ga0500559_0012903 Ga0500559_0012903_2798_3292 155
295 iso_pu_bacteria 2510917022 2511133506 155
296 iso_pu_bacteria 2582581307 2585273276 155
297 iso_pu_bacteria 2582581308 2585278891 155
298 iso_pu_bacteria 2582581316 2585329651 155
299 iso_pu_bacteria 2585427527 2585530688 155
300 iso_pu_bacteria 2585427530 2585554868 155
301 iso_pu_bacteria 2585427531 2585559424 155
302 iso_pu_bacteria 2585427609 2585905200 155
303 iso_pu_bacteria 2585428125 2587979685 155
304 iso_pu_bacteria 2615840626 2616305836 155
305 iso_pu_bacteria 2791355253 2793282284 155
306 iso_pu_bacteria 2818991453 2819639265 155
307 iso_pu_bacteria 2842482326 2842482837 155
308 iso_pu_bacteria 2842509118 2842509709 155
309 3300003323 rootH1_10241800 rootH1_102418002 156
310 3300005544 Ga0070686_100005599 Ga0070686_10000559910 156
311 3300031730 Ga0307516_10129543 Ga0307516_101295432 156
312 3300041413 Ga0439465_0030175 Ga0439465_0030175_16_519 156
313 3300042006 Ga0439432_074229 Ga0439432_074229_101_604 156
314 3300048913 Ga0496110_0909504 Ga0496110_0909504_208_708 156
315 3300048919 Ga0496116_0054584 Ga0496116_0054584_837_1337 156
316 3300048925 Ga0496122_0257488 Ga0496122_0257488_139_639 156
317 3300048926 Ga0496123_0419162 Ga0496123_0419162_77_577 156
318 3300048928 Ga0496125_0000719 Ga0496125_0000719_48446_48946 156
319 3300049570 Ga0501033_0171940 Ga0501033_0171940_990_1493 156
320 3300049571 Ga0501034_0220711 Ga0501034_0220711_324_842 156
321 3300049579 Ga0501043_0281328 Ga0501043_0281328_475_978 156
322 3300049581 Ga0501047_0316608 Ga0501047_0316608_202_705 156
323 3300049592 Ga0501076_1108196 Ga0501076_1108196_42_551 156
324 3300049824 Ga0501045_0732537 Ga0501045_0732537_44_553 156
325 3300050491 nmdc:mga00v17_465201_c1 nmdc:mga00v17_465201_c1_44_565 156
326 3300050496 nmdc:mga07m45_218968_c1 nmdc:mga07m45_218968_c1_447_968 156
327 3300061734 Ga0530510_0132587 Ga0530510_0132587_677_1186 156
328 iso_pu_bacteria 2582581315 2585325496 156
329 iso_pu_bacteria 2585427608 2585902094 156
330 iso_pu_bacteria 2667528174 2671115330 156
331 iso_pu_bacteria 2838029111 2838031402 156
332 iso_pu_bacteria 2842475841 2842478003 156
333 iso_pu_bacteria 2842502639 2842504812 156
334 iso_pu_bacteria 2852387548 2852389052 156
335 iso_pu_bacteria 2919408235 2919409285 156
336 iso_pu_bacteria 3005416602 3005417126 156
337 iso_pu_bacteria 8005314921 8005315187 156
338 iso_pu_bacteria 8005484373 8005485645 156
339 iso_pu_bacteria 8005682033 8005684592 156
340 iso_pu_bacteria 8046767195 8046767661 156
341 3300005539 Ga0068853_100003754 Ga0068853_1000037547 157
342 3300006178 Ga0075367_10036164 Ga0075367_100361643 157
343 3300006186 Ga0075369_10151421 Ga0075369_101514212 157
344 3300006186 Ga0075369_10191276 Ga0075369_101912762 157
345 3300006948 Ga0099826_10005187 Ga0099826_100051877 157
346 3300009545 Ga0105237_10586660 Ga0105237_105866602 157
347 3300026041 Ga0207639_10000897 Ga0207639_100008977 157
348 3300030744 Ga0316181_1269488 Ga0316181_12694885 157
349 3300041413 Ga0439465_0023455 Ga0439465_0023455_164_676 157
350 3300041413 Ga0439465_0119546 Ga0439465_0119546_122_634 157
351 3300048920 Ga0496117_0108356 Ga0496117_0108356_78_551 157
352 3300048923 Ga0496120_0105546 Ga0496120_0105546_733_1206 157
353 3300048924 Ga0496121_0119176 Ga0496121_0119176_934_1407 157
354 3300049571 Ga0501034_0056712 Ga0501034_0056712_1440_1967 157
355 3300049742 Ga0501080_0589817 Ga0501080_0589817_15_497 157
356 3300053153 Ga0500616_0009948 Ga0500616_0009948_2584_3099 157
357 iso_pu_bacteria 2615840698 2616553921 157
358 iso_pu_bacteria 2643221629 2644166736 157
359 iso_pu_bacteria 2643221662 2644347692 157
360 iso_pu_bacteria 8024486573 8024489769 157
361 iso_pu_bacteria 8057575449 8057582219 157
362 3300002737 JGI25162J39368_1000442 JGI25162J39368_100044230 158
363 3300003214 JGI25165J46597_1000639 JGI25165J46597_10006398 158
364 3300003792 Ga0055540_1001764 Ga0055540_10017648 158
365 3300005548 Ga0070665_100426028 Ga0070665_1004260282 158
366 3300006048 Ga0075363_100133666 Ga0075363_1001336662 158
367 3300006178 Ga0075367_10222234 Ga0075367_102222342 158
368 3300015262 Ga0182007_10130020 Ga0182007_101300202 158
369 3300025261 Ga0209233_1000056 Ga0209233_100005679 158
370 3300025272 Ga0209455_1011152 Ga0209455_10111522 158
371 3300025273 Ga0209673_1001371 Ga0209673_10013716 158
372 3300025292 Ga0209676_1033493 Ga0209676_10334932 158
373 3300025298 Ga0209050_1006882 Ga0209050_10068823 158
374 3300025303 Ga0209051_1000514 Ga0209051_100051421 158
375 3300025304 Ga0209257_1003433 Ga0209257_10034339 158
376 3300028794 Ga0307515_10117469 Ga0307515_101174693 158
377 3300046460 Ga0495638_0000353 Ga0495638_0000353_5752_6228 158
378 3300046474 Ga0495605_0007427 Ga0495605_0007427_2960_3436 158
379 3300046492 Ga0495585_0006433 Ga0495585_0006433_2224_2700 158
380 3300046501 Ga0495607_0117518 Ga0495607_0117518_805_1281 158
381 3300046513 Ga0495616_0048406 Ga0495616_0048406_926_1402 158
382 3300046515 Ga0495620_0126082 Ga0495620_0126082_459_935 158
383 3300046519 Ga0495632_0048475 Ga0495632_0048475_310_786 158
384 3300046522 Ga0495643_0048443 Ga0495643_0048443_744_1220 158
385 3300046538 Ga0495609_0018530 Ga0495609_0018530_2733_3209 158
386 3300046616 Ga0495668_0012552 Ga0495668_0012552_1250_1726 158
387 3300046648 Ga0495611_0017639 Ga0495611_0017639_464_940 158
388 3300046660 Ga0495625_0001623 Ga0495625_0001623_12508_12984 158
389 3300046691 Ga0495670_0129337 Ga0495670_0129337_763_1239 158
390 3300046810 Ga0495660_0033898 Ga0495660_0033898_214_690 158
391 3300047320 Ga0495672_0011740 Ga0495672_0011740_1338_1814 158
392 3300048091 Ga0495626_0129124 Ga0495626_0129124_196_672 158
393 3300048925 Ga0496122_0045097 Ga0496122_0045097_1598_2074 158
394 3300048927 Ga0496124_0316877 Ga0496124_0316877_85_561 158
395 3300048928 Ga0496125_0248126 Ga0496125_0248126_66_542 158
396 3300049460 Ga0495682_0234137 Ga0495682_0234137_86_562 158
397 3300050494 nmdc:mga06z11_204002_c1 nmdc:mga06z11_204002_c1_163_639 158
398 3300053079 Ga0500610_0064332 Ga0500610_0064332_63_539 158
399 3300053086 Ga0500578_0126314 Ga0500578_0126314_622_1098 158
400 3300053090 Ga0500646_0232394 Ga0500646_0232394_148_624 158
401 3300053105 Ga0500557_014653 Ga0500557_014653_506_982 158
402 3300053118 Ga0500594_0016441 Ga0500594_0016441_723_1199 158
403 3300053139 Ga0500568_0006791 Ga0500568_0006791_2823_3299 158
404 3300053146 Ga0500588_0014542 Ga0500588_0014542_1476_1952 158
405 3300053153 Ga0500616_0000982 Ga0500616_0000982_29682_30158 158
406 3300053736 Ga0500599_064326 Ga0500599_064326_81_557 158
407 3300002987 JGI25159J45721_1003928 JGI25159J45721_10039285 159
408 3300003214 JGI25165J46597_1001009 JGI25165J46597_100100918 159
409 3300003214 JGI25165J46597_1025441 JGI25165J46597_10254411 159
410 3300003354 JGI25160J50197_1000052 JGI25160J50197_1000052106 159
411 3300003374 JGI25161J50226_1000005 JGI25161J50226_1000005255 159
412 3300003374 JGI25161J50226_1000113 JGI25161J50226_100011350 159
413 3300004625 Ga0055543_1000035 Ga0055543_100003515 159
414 3300005262 Ga0065165_1000253 Ga0065165_100025380 159
415 3300005327 Ga0070658_10310195 Ga0070658_103101953 159
416 3300005455 Ga0070663_100356172 Ga0070663_1003561722 159
417 3300005614 Ga0068856_100071587 Ga0068856_1000715875 159
418 3300005616 Ga0068852_100548375 Ga0068852_1005483752 159
419 3300005834 Ga0068851_10072832 Ga0068851_100728322 159
420 3300005937 Ga0081455_10111954 Ga0081455_101119542 159
421 3300009545 Ga0105237_10039537 Ga0105237_100395375 159
422 3300013105 Ga0157369_10389073 Ga0157369_103890733 159
423 3300015262 Ga0182007_10001216 Ga0182007_1000121610 159
424 3300015265 Ga0182005_1007200 Ga0182005_10072003 159
425 3300025207 Ga0209760_109870 Ga0209760_1098701 159
426 3300025233 Ga0209437_100033 Ga0209437_100033261 159
427 3300025253 Ga0209677_109167 Ga0209677_1091673 159
428 3300025261 Ga0209233_1000064 Ga0209233_1000064161 159
429 3300025261 Ga0209233_1000209 Ga0209233_100020948 159
430 3300025284 Ga0209130_1000018 Ga0209130_1000018284 159
431 3300025302 Ga0207426_1000044 Ga0207426_1000044105 159
432 3300025321 Ga0207656_10106089 Ga0207656_101060892 159
433 3300025909 Ga0207705_10369218 Ga0207705_103692181 159
434 3300025913 Ga0207695_10000024 Ga0207695_10000024232 159
435 3300025914 Ga0207671_10000548 Ga0207671_100005488 159
436 3300025949 Ga0207667_10585032 Ga0207667_105850322 159
437 3300026142 Ga0207698_10071975 Ga0207698_100719754 159
438 3300028794 Ga0307515_10035625 Ga0307515_100356254 159
439 3300031456 Ga0307513_10188946 Ga0307513_101889462 159
440 3300037312 Ga0395899_0026755 Ga0395899_0026755_65_571 159
441 3300038443 Ga0395901_0366973 Ga0395901_0366973_947_1453 159
442 3300038443 Ga0395901_0819044 Ga0395901_0819044_204_710 159
443 3300042533 Ga0450901_003202 Ga0450901_003202_971_1453 159
444 3300046558 Ga0495633_0012154 Ga0495633_0012154_470_952 159
445 3300047472 Ga0495686_0177868 Ga0495686_0177868_399_887 159
446 3300049569 Ga0501032_0141492 Ga0501032_0141492_624_1130 159
447 3300049573 Ga0501037_0043998 Ga0501037_0043998_644_1150 159
448 3300049574 Ga0501038_0068064 Ga0501038_0068064_1789_2295 159
449 3300049586 Ga0501070_0116928 Ga0501070_0116928_972_1478 159
450 3300049593 Ga0501077_0321716 Ga0501077_0321716_459_965 159
451 3300049742 Ga0501080_0029353 Ga0501080_0029353_4382_4888 159
452 3300049744 Ga0501083_0660837 Ga0501083_0660837_52_558 159
453 3300049822 Ga0501035_0015022 Ga0501035_0015022_4046_4552 159
454 3300049823 Ga0501044_0059220 Ga0501044_0059220_2775_3281 159
455 3300053156 Ga0500622_0089271 Ga0500622_0089271_533_1012 159
456 3300060353 Ga0501082_0610541 Ga0501082_0610541_322_828 159
457 iso_pu_bacteria 2582581306 2585266189 159
458 iso_pu_bacteria 2582581865 2585387191 159
459 iso_pu_bacteria 637000159 637079512 159
460 3300003214 JGI25165J46597_1015833 JGI25165J46597_10158332 160
461 3300005548 Ga0070665_100926658 Ga0070665_1009266582 160
462 3300005577 Ga0068857_101299990 Ga0068857_1012999902 160
463 3300006038 Ga0075365_10416546 Ga0075365_104165462 160
464 3300006042 Ga0075368_10041467 Ga0075368_100414673 160
465 3300010375 Ga0105239_10318554 Ga0105239_103185543 160
466 3300025233 Ga0209437_100075 Ga0209437_100075254 160
467 3300025246 Ga0209646_1036541 Ga0209646_10365412 160
468 3300025254 Ga0209148_1002908 Ga0209148_10029085 160
469 3300027312 Ga0209371_1006525 Ga0209371_10065252 160
470 3300030500 Ga0268256_1022574 Ga0268256_10225742 160
471 3300038443 Ga0395901_0998189 Ga0395901_0998189_236_745 160
472 3300045976 Ga0466967_0991189 Ga0466967_0991189_211_693 160
473 3300046460 Ga0495638_0028176 Ga0495638_0028176_69_584 160
474 3300049571 Ga0501034_0344377 Ga0501034_0344377_368_883 160
475 3300053177 Ga0500636_0131573 Ga0500636_0131573_56_538 160
476 3300002704 JGI25155J39150_1000032 JGI25155J39150_100003275 161
477 3300002705 JGI25156J39149_1000153 JGI25156J39149_100015324 161
478 3300002738 JGI25154J39366_1000152 JGI25154J39366_100015227 161
479 3300002741 JGI25157J39369_1000061 JGI25157J39369_100006175 161
480 3300003320 rootH2_10037901 rootH2_100379013 161
481 3300003323 rootH1_10099566 rootH1_100995665 161
482 3300006195 Ga0075366_10175758 Ga0075366_101757582 161
483 3300025206 Ga0209435_100042 Ga0209435_10004276 161
484 3300025228 Ga0209672_113207 Ga0209672_1132071 161
485 3300025246 Ga0209646_1000145 Ga0209646_100014576 161
486 3300025250 Ga0209026_1000160 Ga0209026_100016076 161
487 3300025256 Ga0209759_1000177 Ga0209759_100017776 161
488 3300032004 Ga0307414_10871538 Ga0307414_108715382 161
489 3300044684 Ga0466966_0084793 Ga0466966_0084793_499_984 161
490 3300044694 Ga0466963_0090414 Ga0466963_0090414_455_940 161
491 3300044765 Ga0466970_0017342 Ga0466970_0017342_3206_3691 161
492 3300045049 Ga0466959_0131540 Ga0466959_0131540_84_569 161
493 3300045976 Ga0466967_0357624 Ga0466967_0357624_837_1322 161
494 3300046476 Ga0495662_0071406 Ga0495662_0071406_603_1088 161
495 3300046529 Ga0495652_0193514 Ga0495652_0193514_821_1306 161
496 3300046533 Ga0495640_0228747 Ga0495640_0228747_563_1048 161
497 3300046642 Ga0495634_0119420 Ga0495634_0119420_849_1334 161
498 3300046660 Ga0495625_0347891 Ga0495625_0347891_248_733 161
499 3300046675 Ga0495657_0358220 Ga0495657_0358220_22_507 161
500 3300046683 Ga0495658_0244119 Ga0495658_0244119_288_773 161
501 3300046809 Ga0495600_0044014 Ga0495600_0044014_83_568 161
502 3300047317 Ga0495604_0168308 Ga0495604_0168308_89_574 161
503 3300049823 Ga0501044_0778541 Ga0501044_0778541_47_544 161
504 3300050493 nmdc:mga0k408_248048_c1 nmdc:mga0k408_248048_c1_291_809 161
505 3300053123 Ga0500614_022466 Ga0500614_022466_683_1168 161
506 iso_pu_bacteria 2524023209 2524457886 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

42

127

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p1x-assembly1.cif.gz_AAA tarm(se)_g117r-udp-glucose 0.8691 60 85
4wac-assembly1.cif.gz_A crystal structure of tarm 0.8376 60 85
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8251 1 127
4x7r-assembly1.cif.gz_A crystal structure of s. aureus tarm g117r mutant in complex with fondaparinux, alpha-glcnac-glycerol and udp 0.749 60 85
7qnt-assembly1.cif.gz_AAA tarm(se) native 0.7288 59 85
ID Description Score Start End Superfamily
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8042 4 114 3.90.1590.10
af_Q2FZM7_1_163_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7906 60 85 3.40.50.2000
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.6904 7 107 2.170.150.70
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.6833 4 114 3.90.1590.10
af_Q54EW0_1017_1103_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6645 59 87 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A7W6EJV2-F1-model_v4 deleted 0.9948 17 126
AF-A0A0K2ZKL6-F1-model_v4 CENP-V/GFA domain-containing protein 0.9918 1 92 GO:0016846
GO:0046872
AF-A0A6A8A397-F1-model_v4 GFA family protein 0.9915 1 155 GO:0016846
GO:0046872
AF-A0A5Q8CAK1-F1-model_v4 GFA family protein 0.9869 1 124 GO:0016846
GO:0046872
AF-A0A7W6D9T0-F1-model_v4 CENP-V/GFA domain-containing protein 0.9868 1 161 GO:0016846
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.09 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map