F456374
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 505 | 266 | 464 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300026116|Ga0207674_10256941|Ga0207674_102569412 |
| Length | 293 |
| Sequence | VADEVLVEYADRVAVMTINRPQARNAVNHAVSALMAEALDELDRRDDLTVGIITGAGGTFSSGMDLKAFLAGENVAIEGRGFAGLTQAPPRKPLIAAVEGWALAGGCEVALACDLIVAANDAKFGIPEVKRGLVAGAGGLIRLPRRIPAGIAMELALTGDPLPAVDAHRLGLVNALTEPGGALDGARALAARIAANGPLAVATTKQIIAQQHDWDMAEAWAQQQPMLQPVFRSSPACMIASVETQTRQWSTHGTSCTSWWRISGPLWVISGPSASSCRQRRTSSACHEWVPSV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 2 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 3 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 4 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 5 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 6 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 7 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 8 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 9 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 10 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 11 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 12 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 13 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 14 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 15 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 16 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 17 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 18 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 19 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 20 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 21 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 22 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 23 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 24 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 25 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 26 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 27 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 28 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 29 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 30 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 31 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 32 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 33 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 34 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 100 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 144 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 145 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 147 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 148 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 149 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 150 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 151 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 157 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 160 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 161 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 163 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 164 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 165 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 166 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 167 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 168 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 169 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 170 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 171 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 172 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 173 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 174 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 175 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 176 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 198 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 199 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 200 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 201 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 202 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 203 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 206 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 207 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 208 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 209 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 210 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 211 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 212 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 213 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 214 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 215 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 216 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 217 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 218 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 219 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 220 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 221 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 222 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 244 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 245 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 246 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 254 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 255 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 256 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 257 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 258 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 259 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 260 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 261 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 262 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 263 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 264 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 265 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 266 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.09 |
| Metatranscriptomes | 0.79 |
| Isolates | 8.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.75 |
| Nodule | 2.38 |
| Rhizoplane | 9.7 |
| Rhizosphere | 64.95 |
| Stem | 0 |
| Stem Tuber | 0.2 |
| Unclassified | 18.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10027390 | 3300001990 | Bacteria | 1797 |
| 2 | JGI25151J46595_10001424 | 3300003187 | Bacteria | 16345 |
| 3 | JGI25151J46595_10022718 | 3300003187 | Bacteria | 2598 |
| 4 | JGI25165J46597_1000038 | 3300003214 | Bacteria | 283664 |
| 5 | Ga0055540_1000102 | 3300003792 | Bacteria | 95294 |
| 6 | Ga0070658_10103876 | 3300005327 | Bacteria | 2350 |
| 7 | Ga0070683_100047848 | 3300005329 | Bacteria | 3953 |
| 8 | Ga0070683_100063434 | 3300005329 | Bacteria | 3437 |
| 9 | Ga0070683_100139557 | 3300005329 | Bacteria | 2296 |
| 10 | Ga0070683_100296588 | 3300005329 | Bacteria | 1538 |
| 11 | Ga0070683_100469672 | 3300005329 | Bacteria | 1201 |
| 12 | Ga0070670_100044717 | 3300005331 | Bacteria | 3807 |
| 13 | Ga0070666_10065583 | 3300005335 | Bacteria | 2464 |
| 14 | Ga0070666_10065669 | 3300005335 | Bacteria | 2462 |
| 15 | Ga0070666_10141809 | 3300005335 | Bacteria | 1674 |
| 16 | Ga0070680_100003872 | 3300005336 | Bacteria | 11189 |
| 17 | Ga0070680_100275486 | 3300005336 | Bacteria | 1425 |
| 18 | Ga0070660_100006063 | 3300005339 | Bacteria | 8358 |
| 19 | Ga0070661_100060445 | 3300005344 | Bacteria | 2781 |
| 20 | Ga0070669_100000494 | 3300005353 | Bacteria | 29775 |
| 21 | Ga0070671_100001125 | 3300005355 | Bacteria | 19843 |
| 22 | Ga0070659_100012617 | 3300005366 | Bacteria | 6266 |
| 23 | Ga0070667_100000313 | 3300005367 | Bacteria | 54181 |
| 24 | Ga0070667_100007148 | 3300005367 | Bacteria | 9278 |
| 25 | Ga0070667_100110363 | 3300005367 | Bacteria | 2385 |
| 26 | Ga0070709_10011965 | 3300005434 | Bacteria | 4850 |
| 27 | Ga0070714_100018744 | 3300005435 | Bacteria | 5629 |
| 28 | Ga0070714_100026592 | 3300005435 | Bacteria | 4784 |
| 29 | Ga0070714_100145613 | 3300005435 | Bacteria | 2131 |
| 30 | Ga0070714_100221569 | 3300005435 | Bacteria | 1739 |
| 31 | Ga0070713_100077749 | 3300005436 | Bacteria | 2822 |
| 32 | Ga0070713_100303906 | 3300005436 | Bacteria | 1469 |
| 33 | Ga0070708_100009136 | 3300005445 | Bacteria | 7993 |
| 34 | Ga0070708_100235451 | 3300005445 | Bacteria | 1719 |
| 35 | Ga0070663_100068731 | 3300005455 | Bacteria | 2572 |
| 36 | Ga0070678_100583515 | 3300005456 | Bacteria | 996 |
| 37 | Ga0070662_100003140 | 3300005457 | Bacteria | 10265 |
| 38 | Ga0070681_10000022 | 3300005458 | Bacteria | 116402 |
| 39 | Ga0070681_10133474 | 3300005458 | Bacteria | 2414 |
| 40 | Ga0070681_10150480 | 3300005458 | Bacteria | 2254 |
| 41 | Ga0070681_10498441 | 3300005458 | Bacteria | 1131 |
| 42 | Ga0070706_100010812 | 3300005467 | Bacteria | 8472 |
| 43 | Ga0070707_100094179 | 3300005468 | Bacteria | 2900 |
| 44 | Ga0070698_100001029 | 3300005471 | Bacteria | 30680 |
| 45 | Ga0070698_100005870 | 3300005471 | Bacteria | 13417 |
| 46 | Ga0070699_100046766 | 3300005518 | Bacteria | 3745 |
| 47 | Ga0070699_100266237 | 3300005518 | Bacteria | 1533 |
| 48 | Ga0070679_100000004 | 3300005530 | Bacteria | 263662 |
| 49 | Ga0070679_100108378 | 3300005530 | Bacteria | 2763 |
| 50 | Ga0070679_100127139 | 3300005530 | Bacteria | 2530 |
| 51 | Ga0070684_100045717 | 3300005535 | Bacteria | 3791 |
| 52 | Ga0070684_100228282 | 3300005535 | Bacteria | 1699 |
| 53 | Ga0070684_100319105 | 3300005535 | Bacteria | 1427 |
| 54 | Ga0070697_100029590 | 3300005536 | Bacteria | 4393 |
| 55 | Ga0070697_100075606 | 3300005536 | Bacteria | 2769 |
| 56 | Ga0070665_100002036 | 3300005548 | Bacteria | 22749 |
| 57 | Ga0070665_100006283 | 3300005548 | Bacteria | 12140 |
| 58 | Ga0068855_101018652 | 3300005563 | Bacteria | 869 |
| 59 | Ga0070664_100003085 | 3300005564 | Bacteria | 13467 |
| 60 | Ga0070664_100039423 | 3300005564 | Bacteria | 3981 |
| 61 | Ga0068857_100043813 | 3300005577 | Bacteria | 3969 |
| 62 | Ga0068857_100046439 | 3300005577 | Bacteria | 3854 |
| 63 | Ga0068857_100333855 | 3300005577 | Bacteria | 1401 |
| 64 | Ga0068857_100345145 | 3300005577 | Bacteria | 1378 |
| 65 | Ga0068859_100000081 | 3300005617 | Bacteria | 87606 |
| 66 | Ga0068859_100002435 | 3300005617 | Bacteria | 18946 |
| 67 | Ga0068859_100012548 | 3300005617 | Bacteria | 8526 |
| 68 | Ga0068859_100042851 | 3300005617 | Bacteria | 4547 |
| 69 | Ga0068864_100017914 | 3300005618 | Bacteria | 5909 |
| 70 | Ga0068864_100124957 | 3300005618 | Unclassified | 2304 |
| 71 | Ga0068864_100323525 | 3300005618 | Bacteria | 1449 |
| 72 | Ga0068863_100000419 | 3300005841 | Bacteria | 43150 |
| 73 | Ga0068863_100009985 | 3300005841 | Bacteria | 9242 |
| 74 | Ga0068863_100012171 | 3300005841 | Bacteria | 8309 |
| 75 | Ga0068858_100000789 | 3300005842 | Bacteria | 33040 |
| 76 | Ga0068858_100009809 | 3300005842 | Bacteria | 9115 |
| 77 | Ga0068858_100022009 | 3300005842 | Bacteria | 5953 |
| 78 | Ga0068858_100510939 | 3300005842 | Bacteria | 1161 |
| 79 | Ga0068860_100000227 | 3300005843 | Bacteria | 87278 |
| 80 | Ga0068860_100006385 | 3300005843 | Bacteria | 11834 |
| 81 | Ga0068860_100028059 | 3300005843 | Bacteria | 5420 |
| 82 | Ga0068862_100000547 | 3300005844 | Bacteria | 39415 |
| 83 | Ga0081455_10000365 | 3300005937 | Bacteria | 59750 |
| 84 | Ga0081455_10000906 | 3300005937 | Bacteria | 38128 |
| 85 | Ga0081455_10145213 | 3300005937 | Bacteria | 1836 |
| 86 | Ga0081455_10273362 | 3300005937 | Bacteria | 1224 |
| 87 | Ga0081455_10381412 | 3300005937 | Bacteria | 984 |
| 88 | Ga0081539_10006295 | 3300005985 | Bacteria | 11470 |
| 89 | Ga0070717_10176478 | 3300006028 | Bacteria | 1860 |
| 90 | Ga0075368_10003241 | 3300006042 | Bacteria | 5418 |
| 91 | Ga0075364_10024584 | 3300006051 | Bacteria | 3826 |
| 92 | Ga0075364_10046044 | 3300006051 | Bacteria | 2839 |
| 93 | Ga0075367_10000446 | 3300006178 | Bacteria | 15351 |
| 94 | Ga0075428_100040062 | 3300006844 | Bacteria | 5156 |
| 95 | Ga0075431_100012752 | 3300006847 | Bacteria | 8485 |
| 96 | Ga0075431_100366397 | 3300006847 | Bacteria | 1447 |
| 97 | Ga0075433_10064036 | 3300006852 | Bacteria | 3222 |
| 98 | Ga0075429_100009455 | 3300006880 | Bacteria | 8460 |
| 99 | Ga0075429_100662217 | 3300006880 | Bacteria | 915 |
| 100 | Ga0097620_100000081 | 3300006931 | Bacteria | 87606 |
| 101 | Ga0097620_100002435 | 3300006931 | Bacteria | 18946 |
| 102 | Ga0097620_100012548 | 3300006931 | Bacteria | 8526 |
| 103 | Ga0097620_100042851 | 3300006931 | Bacteria | 4547 |
| 104 | Ga0075435_100005272 | 3300007076 | Bacteria | 9003 |
| 105 | Ga0105240_10582810 | 3300009093 | Bacteria | 1234 |
| 106 | Ga0111539_10524963 | 3300009094 | Bacteria | 1379 |
| 107 | Ga0111539_10703407 | 3300009094 | Bacteria | 1176 |
| 108 | Ga0105245_10054334 | 3300009098 | Bacteria | 3597 |
| 109 | Ga0105245_10324633 | 3300009098 | Bacteria | 1517 |
| 110 | Ga0105247_10000209 | 3300009101 | Bacteria | 56848 |
| 111 | Ga0105247_10001558 | 3300009101 | Bacteria | 16340 |
| 112 | Ga0114129_10427639 | 3300009147 | Bacteria | 1740 |
| 113 | Ga0114129_11311161 | 3300009147 | Bacteria | 897 |
| 114 | Ga0105248_10000884 | 3300009177 | Bacteria | 33587 |
| 115 | Ga0105248_10011070 | 3300009177 | Bacteria | 9949 |
| 116 | Ga0105237_10003621 | 3300009545 | Bacteria | 18248 |
| 117 | Ga0105238_10718197 | 3300009551 | Bacteria | 1012 |
| 118 | Ga0105249_10018007 | 3300009553 | Bacteria | 6278 |
| 119 | Ga0105249_10065869 | 3300009553 | Bacteria | 3334 |
| 120 | Ga0105239_10092619 | 3300010375 | Bacteria | 3336 |
| 121 | Ga0105239_10141702 | 3300010375 | Bacteria | 2679 |
| 122 | Ga0157369_10058214 | 3300013105 | Bacteria | 4168 |
| 123 | Ga0157375_10479037 | 3300013308 | Bacteria | 1409 |
| 124 | Ga0163163_10002291 | 3300014325 | Bacteria | 16160 |
| 125 | Ga0163163_10388917 | 3300014325 | Bacteria | 1452 |
| 126 | Ga0157379_10007178 | 3300014968 | Bacteria | 9640 |
| 127 | Ga0206354_10171698 | 3300020081 | Bacteria | 1329 |
| 128 | Ga0206353_11320048 | 3300020082 | Bacteria | 3068 |
| 129 | Ga0213875_10003862 | 3300021388 | Bacteria | 8403 |
| 130 | Ga0213875_10004667 | 3300021388 | Bacteria | 7465 |
| 131 | Ga0213875_10011430 | 3300021388 | Bacteria | 4417 |
| 132 | Ga0224712_10210136 | 3300022467 | Bacteria | 887 |
| 133 | Ga0209437_102273 | 3300025233 | Bacteria | 3789 |
| 134 | Ga0209233_1000042 | 3300025261 | Bacteria | 510519 |
| 135 | Ga0209676_1008552 | 3300025292 | Bacteria | 4543 |
| 136 | Ga0209025_1000055 | 3300025294 | Bacteria | 316748 |
| 137 | Ga0209025_1000115 | 3300025294 | Bacteria | 218871 |
| 138 | Ga0209050_1008588 | 3300025298 | Bacteria | 5412 |
| 139 | Ga0209051_1000116 | 3300025303 | Bacteria | 150182 |
| 140 | Ga0209051_1051012 | 3300025303 | Bacteria | 1380 |
| 141 | Ga0207692_10094969 | 3300025898 | Bacteria | 1625 |
| 142 | Ga0207710_10000449 | 3300025900 | Bacteria | 26704 |
| 143 | Ga0207710_10001674 | 3300025900 | Bacteria | 10775 |
| 144 | Ga0207710_10005821 | 3300025900 | Bacteria | 5287 |
| 145 | Ga0207710_10007284 | 3300025900 | Bacteria | 4689 |
| 146 | Ga0207680_10004127 | 3300025903 | Bacteria | 6871 |
| 147 | Ga0207680_10048779 | 3300025903 | Bacteria | 2517 |
| 148 | Ga0207699_10036944 | 3300025906 | Bacteria | 2788 |
| 149 | Ga0207684_10023622 | 3300025910 | Bacteria | 5249 |
| 150 | Ga0207707_10000029 | 3300025912 | Bacteria | 162223 |
| 151 | Ga0207707_10109009 | 3300025912 | Bacteria | 2421 |
| 152 | Ga0207707_10236245 | 3300025912 | Bacteria | 1590 |
| 153 | Ga0207707_10325320 | 3300025912 | Bacteria | 1327 |
| 154 | Ga0207695_10465481 | 3300025913 | Bacteria | 1147 |
| 155 | Ga0207671_10003961 | 3300025914 | Bacteria | 14403 |
| 156 | Ga0207660_10001708 | 3300025917 | Bacteria | 14721 |
| 157 | Ga0207657_10007152 | 3300025919 | Bacteria | 11463 |
| 158 | Ga0207649_10040470 | 3300025920 | Bacteria | 2833 |
| 159 | Ga0207652_10000655 | 3300025921 | Bacteria | 34027 |
| 160 | Ga0207652_10150298 | 3300025921 | Bacteria | 2085 |
| 161 | Ga0207652_10213366 | 3300025921 | Bacteria | 1739 |
| 162 | Ga0207652_10641653 | 3300025921 | Bacteria | 950 |
| 163 | Ga0207646_10081545 | 3300025922 | Bacteria | 2892 |
| 164 | Ga0207646_10226259 | 3300025922 | Bacteria | 1690 |
| 165 | Ga0207700_10105032 | 3300025928 | Bacteria | 2261 |
| 166 | Ga0207700_10360041 | 3300025928 | Bacteria | 1268 |
| 167 | Ga0207700_10751161 | 3300025928 | Bacteria | 872 |
| 168 | Ga0207664_10008501 | 3300025929 | Bacteria | 7166 |
| 169 | Ga0207664_10041176 | 3300025929 | Bacteria | 3598 |
| 170 | Ga0207664_10101770 | 3300025929 | Bacteria | 2375 |
| 171 | Ga0207644_10008910 | 3300025931 | Bacteria | 6573 |
| 172 | Ga0207706_10002746 | 3300025933 | Bacteria | 17108 |
| 173 | Ga0207709_10318270 | 3300025935 | Bacteria | 1163 |
| 174 | Ga0207704_10292695 | 3300025938 | Bacteria | 1243 |
| 175 | Ga0207711_10000264 | 3300025941 | Bacteria | 57029 |
| 176 | Ga0207711_10000284 | 3300025941 | Bacteria | 54200 |
| 177 | Ga0207661_10071523 | 3300025944 | Bacteria | 2835 |
| 178 | Ga0207661_10094623 | 3300025944 | Bacteria | 2496 |
| 179 | Ga0207661_10135061 | 3300025944 | Bacteria | 2118 |
| 180 | Ga0207661_10381073 | 3300025944 | Bacteria | 1276 |
| 181 | Ga0207679_10025688 | 3300025945 | Bacteria | 4054 |
| 182 | Ga0207679_10040623 | 3300025945 | Bacteria | 3331 |
| 183 | Ga0207679_10136072 | 3300025945 | Bacteria | 1979 |
| 184 | Ga0207667_10228032 | 3300025949 | Bacteria | 1908 |
| 185 | Ga0207712_10002517 | 3300025961 | Bacteria | 11793 |
| 186 | Ga0207712_10381652 | 3300025961 | Bacteria | 1180 |
| 187 | Ga0207668_10302030 | 3300025972 | Bacteria | 1321 |
| 188 | Ga0207658_10000206 | 3300025986 | Bacteria | 61427 |
| 189 | Ga0207658_10000952 | 3300025986 | Bacteria | 23914 |
| 190 | Ga0207658_10001006 | 3300025986 | Bacteria | 23090 |
| 191 | Ga0207658_10027677 | 3300025986 | Bacteria | 3986 |
| 192 | Ga0207658_10269766 | 3300025986 | Bacteria | 1454 |
| 193 | Ga0207703_10000015 | 3300026035 | Bacteria | 287079 |
| 194 | Ga0207703_10023177 | 3300026035 | Bacteria | 4876 |
| 195 | Ga0207703_10024826 | 3300026035 | Bacteria | 4715 |
| 196 | Ga0207703_10089465 | 3300026035 | Bacteria | 2586 |
| 197 | Ga0207703_10320393 | 3300026035 | Bacteria | 1419 |
| 198 | Ga0207678_10003869 | 3300026067 | Bacteria | 13462 |
| 199 | Ga0207678_10044265 | 3300026067 | Bacteria | 3850 |
| 200 | Ga0207641_10002933 | 3300026088 | Bacteria | 15422 |
| 201 | Ga0207641_10007528 | 3300026088 | Bacteria | 9060 |
| 202 | Ga0207641_10008125 | 3300026088 | Bacteria | 8689 |
| 203 | Ga0207676_10147698 | 3300026095 | Bacteria | 2021 |
| 204 | Ga0207676_10408669 | 3300026095 | Bacteria | 1270 |
| 205 | Ga0207674_10059221 | 3300026116 | Bacteria | 3876 |
| 206 | Ga0207674_10156265 | 3300026116 | Bacteria | 2236 |
| 207 | Ga0207674_10256941 | 3300026116 | Bacteria | 1694 |
| 208 | Ga0207674_10316867 | 3300026116 | Bacteria | 1509 |
| 209 | Ga0207674_10360879 | 3300026116 | Bacteria | 1404 |
| 210 | Ga0207674_10407868 | 3300026116 | Bacteria | 1313 |
| 211 | Ga0207698_10220495 | 3300026142 | Bacteria | 1713 |
| 212 | Ga0209813_10003017 | 3300027866 | Bacteria | 3907 |
| 213 | Ga0268266_10000492 | 3300028379 | Bacteria | 56439 |
| 214 | Ga0268266_10002209 | 3300028379 | Bacteria | 21278 |
| 215 | Ga0268266_10003465 | 3300028379 | Bacteria | 15738 |
| 216 | Ga0268265_10000518 | 3300028380 | Bacteria | 39429 |
| 217 | Ga0268264_10000152 | 3300028381 | Bacteria | 157374 |
| 218 | Ga0268264_10000220 | 3300028381 | Bacteria | 111692 |
| 219 | Ga0268264_10019875 | 3300028381 | Bacteria | 5487 |
| 220 | Ga0268264_10316750 | 3300028381 | Bacteria | 1474 |
| 221 | Ga0307515_10048867 | 3300028794 | Bacteria | 6386 |
| 222 | Ga0268256_1008888 | 3300030500 | Bacteria | 3397 |
| 223 | Ga0265327_10001906 | 3300031251 | Bacteria | 24090 |
| 224 | Ga0307513_10008448 | 3300031456 | Bacteria | 13175 |
| 225 | Ga0307509_10006450 | 3300031507 | Bacteria | 15794 |
| 226 | Ga0307514_10042700 | 3300031649 | Bacteria | 3564 |
| 227 | Ga0307405_10015411 | 3300031731 | Bacteria | 4141 |
| 228 | Ga0307413_10316514 | 3300031824 | Bacteria | 1190 |
| 229 | Ga0307518_10020698 | 3300031838 | Bacteria | 4727 |
| 230 | Ga0307518_10105941 | 3300031838 | Bacteria | 2008 |
| 231 | Ga0307410_10085175 | 3300031852 | Bacteria | 2230 |
| 232 | Ga0307412_10036713 | 3300031911 | Bacteria | 3142 |
| 233 | Ga0307412_10079297 | 3300031911 | Bacteria | 2265 |
| 234 | Ga0307409_100027582 | 3300031995 | Bacteria | 4027 |
| 235 | Ga0307409_100287315 | 3300031995 | Bacteria | 1523 |
| 236 | Ga0307409_100307875 | 3300031995 | Bacteria | 1477 |
| 237 | Ga0307409_100491446 | 3300031995 | Bacteria | 1193 |
| 238 | Ga0307416_100360459 | 3300032002 | Bacteria | 1476 |
| 239 | Ga0307414_10495113 | 3300032004 | Bacteria | 1080 |
| 240 | Ga0307411_10060765 | 3300032005 | Bacteria | 2512 |
| 241 | Ga0307411_10598483 | 3300032005 | Bacteria | 948 |
| 242 | Ga0307415_100033772 | 3300032126 | Bacteria | 3322 |
| 243 | Ga0307415_100047905 | 3300032126 | Bacteria | 2880 |
| 244 | Ga0307507_10222388 | 3300033179 | Bacteria | 1267 |
| 245 | Ga0307510_10001944 | 3300033180 | Bacteria | 23245 |
| 246 | Ga0373937_0205767 | 3300036401 | Bacteria | 1851 |
| 247 | Ga0372808_002056 | 3300036459 | Bacteria | 2245 |
| 248 | Ga0395905_0164302 | 3300037471 | Bacteria | 2086 |
| 249 | Ga0436364_0248241 | 3300037853 | Bacteria | 6107 |
| 250 | Ga0436364_0299324 | 3300037853 | Bacteria | 18043 |
| 251 | Ga0436364_0712624 | 3300037853 | Bacteria | 17074 |
| 252 | Ga0436364_1299779 | 3300037853 | Bacteria | 159755 |
| 253 | Ga0436364_1545113 | 3300037853 | Bacteria | 8846 |
| 254 | Ga0439436_0051496 | 3300041404 | Bacteria | 1163 |
| 255 | Ga0439466_0011680 | 3300041411 | Bacteria | 3244 |
| 256 | Ga0439464_0012717 | 3300042439 | Bacteria | 2245 |
| 257 | Ga0466972_0071207 | 3300044658 | Bacteria | 1659 |
| 258 | Ga0466972_0080721 | 3300044658 | Bacteria | 1549 |
| 259 | Ga0466961_0028079 | 3300044693 | Bacteria | 3619 |
| 260 | Ga0466963_0045891 | 3300044694 | Bacteria | 2879 |
| 261 | Ga0466963_0362322 | 3300044694 | Bacteria | 1021 |
| 262 | Ga0466971_0050322 | 3300044719 | Bacteria | 1875 |
| 263 | Ga0466957_0032687 | 3300044842 | Bacteria | 3116 |
| 264 | Ga0466960_0005889 | 3300044901 | Bacteria | 4886 |
| 265 | Ga0466960_0036245 | 3300044901 | Bacteria | 2309 |
| 266 | Ga0466960_0173506 | 3300044901 | Bacteria | 1165 |
| 267 | Ga0466958_0057298 | 3300045836 | Bacteria | 2368 |
| 268 | Ga0466958_0351080 | 3300045836 | Bacteria | 949 |
| 269 | Ga0466967_0037608 | 3300045976 | Bacteria | 4143 |
| 270 | Ga0466967_0042605 | 3300045976 | Bacteria | 3924 |
| 271 | Ga0466967_0046127 | 3300045976 | Bacteria | 3792 |
| 272 | Ga0466967_0124070 | 3300045976 | Bacteria | 2390 |
| 273 | Ga0466967_0180793 | 3300045976 | Bacteria | 1989 |
| 274 | Ga0466967_0222982 | 3300045976 | Bacteria | 1792 |
| 275 | Ga0466967_0496016 | 3300045976 | Bacteria | 1198 |
| 276 | Ga0466967_0764688 | 3300045976 | Bacteria | 958 |
| 277 | Ga0466967_0864498 | 3300045976 | Bacteria | 899 |
| 278 | Ga0495603_0010835 | 3300046455 | Bacteria | 5531 |
| 279 | Ga0495603_0174115 | 3300046455 | Bacteria | 1246 |
| 280 | Ga0495603_0264464 | 3300046455 | Bacteria | 990 |
| 281 | Ga0495582_0079800 | 3300046473 | Bacteria | 1817 |
| 282 | Ga0495584_0124925 | 3300046491 | Bacteria | 1304 |
| 283 | Ga0495585_0010443 | 3300046492 | Bacteria | 5525 |
| 284 | Ga0495594_0003695 | 3300046499 | Bacteria | 7855 |
| 285 | Ga0495607_0046393 | 3300046501 | Bacteria | 2552 |
| 286 | Ga0495606_0021321 | 3300046507 | Bacteria | 4747 |
| 287 | Ga0495666_0002396 | 3300046526 | Bacteria | 9333 |
| 288 | Ga0495640_0088348 | 3300046533 | Bacteria | 2049 |
| 289 | Ga0495633_0001542 | 3300046558 | Bacteria | 17688 |
| 290 | Ga0495668_0005584 | 3300046616 | Bacteria | 8457 |
| 291 | Ga0495669_0001592 | 3300046684 | Bacteria | 9325 |
| 292 | Ga0495624_0033151 | 3300046690 | Bacteria | 3346 |
| 293 | Ga0495589_0053952 | 3300046794 | Bacteria | 1983 |
| 294 | Ga0495676_0021262 | 3300047321 | Bacteria | 5669 |
| 295 | Ga0495676_0176152 | 3300047321 | Bacteria | 1502 |
| 296 | Ga0495683_0007957 | 3300047323 | Bacteria | 5690 |
| 297 | Ga0495687_005501 | 3300047443 | Bacteria | 8048 |
| 298 | Ga0495687_035492 | 3300047443 | Bacteria | 2241 |
| 299 | Ga0495685_004610 | 3300047447 | Bacteria | 4465 |
| 300 | Ga0495614_0016005 | 3300048089 | Bacteria | 3266 |
| 301 | Ga0496100_0000095 | 3300048903 | Bacteria | 50413 |
| 302 | Ga0496100_0002953 | 3300048903 | Bacteria | 8745 |
| 303 | Ga0496100_0009066 | 3300048903 | Bacteria | 5576 |
| 304 | Ga0496100_0382638 | 3300048903 | Bacteria | 1069 |
| 305 | Ga0496100_0496309 | 3300048903 | Bacteria | 940 |
| 306 | Ga0496101_0000027 | 3300048904 | Bacteria | 199664 |
| 307 | Ga0496101_0018977 | 3300048904 | Bacteria | 4686 |
| 308 | Ga0496101_0137186 | 3300048904 | Bacteria | 1862 |
| 309 | Ga0496101_0423733 | 3300048904 | Bacteria | 1049 |
| 310 | Ga0496102_0000020 | 3300048905 | Bacteria | 260823 |
| 311 | Ga0496102_0000111 | 3300048905 | Bacteria | 117001 |
| 312 | Ga0496102_0000171 | 3300048905 | Bacteria | 87903 |
| 313 | Ga0496102_0000190 | 3300048905 | Bacteria | 83444 |
| 314 | Ga0496102_0003706 | 3300048905 | Bacteria | 12918 |
| 315 | Ga0496102_0392090 | 3300048905 | Bacteria | 1306 |
| 316 | Ga0496102_0507361 | 3300048905 | Bacteria | 1128 |
| 317 | Ga0496103_0000030 | 3300048906 | Bacteria | 211729 |
| 318 | Ga0496103_0000088 | 3300048906 | Bacteria | 104382 |
| 319 | Ga0496103_0000125 | 3300048906 | Bacteria | 83408 |
| 320 | Ga0496103_0000226 | 3300048906 | Bacteria | 54762 |
| 321 | Ga0496103_0000871 | 3300048906 | Bacteria | 21931 |
| 322 | Ga0496104_0025984 | 3300048907 | Bacteria | 5400 |
| 323 | Ga0496104_0040259 | 3300048907 | Bacteria | 4380 |
| 324 | Ga0496104_0387229 | 3300048907 | Bacteria | 1310 |
| 325 | Ga0496104_0474473 | 3300048907 | Bacteria | 1162 |
| 326 | Ga0496105_0121420 | 3300048908 | Bacteria | 2154 |
| 327 | Ga0496105_0183050 | 3300048908 | Bacteria | 1715 |
| 328 | Ga0496106_0000413 | 3300048909 | Bacteria | 30337 |
| 329 | Ga0496106_0344036 | 3300048909 | Bacteria | 1198 |
| 330 | Ga0496107_0000304 | 3300048910 | Bacteria | 26272 |
| 331 | Ga0496107_0013929 | 3300048910 | Bacteria | 5625 |
| 332 | Ga0496107_0032123 | 3300048910 | Bacteria | 3751 |
| 333 | Ga0496108_0004308 | 3300048911 | Bacteria | 11444 |
| 334 | Ga0496108_0115454 | 3300048911 | Bacteria | 2299 |
| 335 | Ga0496109_0000407 | 3300048912 | Bacteria | 38371 |
| 336 | Ga0496109_0576754 | 3300048912 | Bacteria | 1060 |
| 337 | Ga0496110_0003553 | 3300048913 | Bacteria | 11972 |
| 338 | Ga0496110_0031115 | 3300048913 | Bacteria | 4603 |
| 339 | Ga0496110_0079377 | 3300048913 | Bacteria | 2922 |
| 340 | Ga0496110_0138986 | 3300048913 | Bacteria | 2196 |
| 341 | Ga0496111_0008490 | 3300048914 | Bacteria | 6802 |
| 342 | Ga0496112_0204888 | 3300048915 | Bacteria | 1931 |
| 343 | Ga0496112_0215096 | 3300048915 | Bacteria | 1878 |
| 344 | Ga0496113_0038582 | 3300048916 | Bacteria | 3513 |
| 345 | Ga0496114_0000282 | 3300048917 | Bacteria | 37014 |
| 346 | Ga0496114_0477272 | 3300048917 | Bacteria | 1103 |
| 347 | Ga0496115_0014824 | 3300048918 | Bacteria | 5912 |
| 348 | Ga0496115_0059617 | 3300048918 | Bacteria | 3074 |
| 349 | Ga0496116_0000067 | 3300048919 | Bacteria | 260793 |
| 350 | Ga0496116_0000337 | 3300048919 | Bacteria | 75447 |
| 351 | Ga0496116_0002036 | 3300048919 | Bacteria | 21684 |
| 352 | Ga0496116_0004224 | 3300048919 | Bacteria | 13805 |
| 353 | Ga0496117_0000149 | 3300048920 | Bacteria | 149137 |
| 354 | Ga0496117_0000170 | 3300048920 | Bacteria | 136272 |
| 355 | Ga0496117_0000313 | 3300048920 | Bacteria | 84841 |
| 356 | Ga0496117_0005400 | 3300048920 | Bacteria | 13447 |
| 357 | Ga0496118_0000049 | 3300048921 | Bacteria | 251875 |
| 358 | Ga0496118_0000308 | 3300048921 | Bacteria | 84829 |
| 359 | Ga0496118_0000337 | 3300048921 | Bacteria | 80147 |
| 360 | Ga0496118_0018942 | 3300048921 | Bacteria | 6172 |
| 361 | Ga0496118_0019586 | 3300048921 | Bacteria | 6041 |
| 362 | Ga0496118_0044396 | 3300048921 | Bacteria | 3481 |
| 363 | Ga0496118_0051972 | 3300048921 | Bacteria | 3131 |
| 364 | Ga0496119_0001985 | 3300048922 | Bacteria | 23212 |
| 365 | Ga0496119_0004562 | 3300048922 | Bacteria | 13703 |
| 366 | Ga0496119_0008598 | 3300048922 | Bacteria | 8941 |
| 367 | Ga0496119_0011159 | 3300048922 | Bacteria | 7481 |
| 368 | Ga0496119_0025811 | 3300048922 | Bacteria | 4093 |
| 369 | Ga0496119_0042601 | 3300048922 | Bacteria | 2877 |
| 370 | Ga0496120_0004741 | 3300048923 | Bacteria | 11165 |
| 371 | Ga0496120_0008130 | 3300048923 | Bacteria | 7695 |
| 372 | Ga0496120_0009211 | 3300048923 | Bacteria | 7031 |
| 373 | Ga0496120_0062871 | 3300048923 | Bacteria | 2067 |
| 374 | Ga0496121_0000004 | 3300048924 | Bacteria | 1139011 |
| 375 | Ga0496121_0001602 | 3300048924 | Bacteria | 37551 |
| 376 | Ga0496121_0012251 | 3300048924 | Bacteria | 9390 |
| 377 | Ga0496121_0021330 | 3300048924 | Bacteria | 6351 |
| 378 | Ga0496121_0030413 | 3300048924 | Bacteria | 4959 |
| 379 | Ga0496121_0038895 | 3300048924 | Bacteria | 4202 |
| 380 | Ga0496121_0041540 | 3300048924 | Bacteria | 4017 |
| 381 | Ga0496122_0000763 | 3300048925 | Bacteria | 62213 |
| 382 | Ga0496122_0159958 | 3300048925 | Bacteria | 1375 |
| 383 | Ga0496122_0289244 | 3300048925 | Bacteria | 891 |
| 384 | Ga0496123_0019687 | 3300048926 | Bacteria | 5313 |
| 385 | Ga0496123_0086287 | 3300048926 | Bacteria | 1884 |
| 386 | Ga0496124_0000030 | 3300048927 | Bacteria | 351350 |
| 387 | Ga0496124_0000330 | 3300048927 | Bacteria | 87622 |
| 388 | Ga0496124_0029837 | 3300048927 | Bacteria | 4851 |
| 389 | Ga0496124_0051701 | 3300048927 | Bacteria | 3494 |
| 390 | Ga0496125_0000003 | 3300048928 | Bacteria | 1189767 |
| 391 | Ga0496125_0015580 | 3300048928 | Bacteria | 7341 |
| 392 | Ga0496125_0021713 | 3300048928 | Bacteria | 5976 |
| 393 | Ga0496126_0000001 | 3300048929 | Bacteria | 1139011 |
| 394 | Ga0496126_0000006 | 3300048929 | Bacteria | 798804 |
| 395 | Ga0496126_0000080 | 3300048929 | Bacteria | 221672 |
| 396 | Ga0496126_0000514 | 3300048929 | Bacteria | 75337 |
| 397 | Ga0496126_0000999 | 3300048929 | Bacteria | 48191 |
| 398 | Ga0496126_0013957 | 3300048929 | Bacteria | 8146 |
| 399 | Ga0496126_0157000 | 3300048929 | Bacteria | 1946 |
| 400 | Ga0496126_0255822 | 3300048929 | Bacteria | 1458 |
| 401 | Ga0496126_0338289 | 3300048929 | Bacteria | 1233 |
| 402 | Ga0501031_0000531 | 3300049568 | Bacteria | 22307 |
| 403 | Ga0501032_0002291 | 3300049569 | Bacteria | 15023 |
| 404 | Ga0501032_0035594 | 3300049569 | Bacteria | 3402 |
| 405 | Ga0501033_0001475 | 3300049570 | Bacteria | 20815 |
| 406 | Ga0501033_0017275 | 3300049570 | Bacteria | 5452 |
| 407 | Ga0501034_0000335 | 3300049571 | Bacteria | 82157 |
| 408 | Ga0501034_0153988 | 3300049571 | Bacteria | 2273 |
| 409 | Ga0501036_0013995 | 3300049572 | Bacteria | 6667 |
| 410 | Ga0501037_0000892 | 3300049573 | Bacteria | 22278 |
| 411 | Ga0501037_0047673 | 3300049573 | Bacteria | 3139 |
| 412 | Ga0501038_0006082 | 3300049574 | Bacteria | 11166 |
| 413 | Ga0501038_0496733 | 3300049574 | Bacteria | 933 |
| 414 | Ga0501042_0438070 | 3300049578 | Bacteria | 947 |
| 415 | Ga0501043_0001450 | 3300049579 | Bacteria | 20716 |
| 416 | Ga0501043_0088622 | 3300049579 | Bacteria | 2432 |
| 417 | Ga0501046_0001496 | 3300049580 | Bacteria | 22390 |
| 418 | Ga0501047_0001572 | 3300049581 | Bacteria | 22294 |
| 419 | Ga0501047_0010522 | 3300049581 | Bacteria | 8750 |
| 420 | Ga0501048_0002344 | 3300049582 | Bacteria | 14454 |
| 421 | Ga0501069_0001445 | 3300049585 | Bacteria | 11667 |
| 422 | Ga0501069_0142384 | 3300049585 | Bacteria | 1375 |
| 423 | Ga0501069_0365915 | 3300049585 | Bacteria | 851 |
| 424 | Ga0501070_0000325 | 3300049586 | Bacteria | 43267 |
| 425 | Ga0501070_0001310 | 3300049586 | Bacteria | 22281 |
| 426 | Ga0501070_0006844 | 3300049586 | Bacteria | 9701 |
| 427 | Ga0501070_0009183 | 3300049586 | Bacteria | 8358 |
| 428 | Ga0501070_0013263 | 3300049586 | Bacteria | 6948 |
| 429 | Ga0501070_0168212 | 3300049586 | Bacteria | 1806 |
| 430 | Ga0501073_0024949 | 3300049589 | Bacteria | 4290 |
| 431 | Ga0501073_0033685 | 3300049589 | Bacteria | 3646 |
| 432 | Ga0501074_0030841 | 3300049590 | Bacteria | 3884 |
| 433 | Ga0501074_0032057 | 3300049590 | Bacteria | 3809 |
| 434 | Ga0501079_0001063 | 3300049741 | Bacteria | 19093 |
| 435 | Ga0501079_0001277 | 3300049741 | Bacteria | 17674 |
| 436 | Ga0501080_0000096 | 3300049742 | Bacteria | 59454 |
| 437 | Ga0501080_0019093 | 3300049742 | Bacteria | 6347 |
| 438 | Ga0501080_0272048 | 3300049742 | Bacteria | 1541 |
| 439 | Ga0501080_0354659 | 3300049742 | Bacteria | 1324 |
| 440 | Ga0501083_0010515 | 3300049744 | Bacteria | 6511 |
| 441 | Ga0501035_0001636 | 3300049822 | Bacteria | 22643 |
| 442 | Ga0501035_0147265 | 3300049822 | Bacteria | 2044 |
| 443 | Ga0501044_0000201 | 3300049823 | Bacteria | 75685 |
| 444 | Ga0501044_0002493 | 3300049823 | Bacteria | 21004 |
| 445 | Ga0501044_0002899 | 3300049823 | Bacteria | 19530 |
| 446 | Ga0501044_0065517 | 3300049823 | Bacteria | 3705 |
| 447 | nmdc:mga00v17_155802_c1 | 3300050491 | Bacteria | 1469 |
| 448 | nmdc:mga00v17_49838_c1 | 3300050491 | Bacteria | 2542 |
| 449 | nmdc:mga06z11_1130_c1 | 3300050494 | Bacteria | 9719 |
| 450 | nmdc:mga04h51_3309_c1 | 3300050495 | Bacteria | 3907 |
| 451 | nmdc:mga09592_196719_c1 | 3300050508 | Bacteria | 1745 |
| 452 | nmdc:mga09592_365_c1 | 3300050508 | Bacteria | 33116 |
| 453 | nmdc:mga09592_43503_c1 | 3300050508 | Bacteria | 3780 |
| 454 | nmdc:mga0qj67_231422_c1 | 3300050509 | Bacteria | 1499 |
| 455 | nmdc:mga06r32_415124_c1 | 3300050510 | Bacteria | 1327 |
| 456 | nmdc:mga06r32_88493_c1 | 3300050510 | Bacteria | 3023 |
| 457 | nmdc:mga0n895_55775_c1 | 3300050512 | Bacteria | 3890 |
| 458 | nmdc:mga0rr50_33011_c1 | 3300050513 | Bacteria | 3695 |
| 459 | nmdc:mga08x19_7962_c1 | 3300050514 | Bacteria | 6296 |
| 460 | nmdc:mga0a205_27687_c1 | 3300050515 | Bacteria | 5414 |
| 461 | Ga0500593_000020 | 3300053117 | Bacteria | 54324 |
| 462 | Ga0500568_0000763 | 3300053139 | Bacteria | 22859 |
| 463 | Ga0500616_0000220 | 3300053153 | Bacteria | 89104 |
| 464 | Ga0466962_0161212 | 3300061719 | Bacteria | 1090 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0764688 | Ga0466967_0764688_277_948 | 222 |
| 2 | 3300048929 | Ga0496126_0013957 | Ga0496126_0013957_6578_7342 | 237 |
| 3 | 3300044694 | Ga0466963_0362322 | Ga0466963_0362322_78_842 | 238 |
| 4 | 3300045976 | Ga0466967_0864498 | Ga0466967_0864498_20_784 | 238 |
| 5 | 3300025921 | Ga0207652_10641653 | Ga0207652_106416531 | 239 |
| 6 | 3300028381 | Ga0268264_10316750 | Ga0268264_103167502 | 240 |
| 7 | 3300053117 | Ga0500593_000020 | Ga0500593_000020_52957_53697 | 244 |
| 8 | 3300005536 | Ga0070697_100075606 | Ga0070697_1000756061 | 245 |
| 9 | 3300006844 | Ga0075428_100040062 | Ga0075428_1000400622 | 245 |
| 10 | 3300006847 | Ga0075431_100012752 | Ga0075431_1000127522 | 245 |
| 11 | 3300006852 | Ga0075433_10064036 | Ga0075433_100640362 | 245 |
| 12 | 3300006880 | Ga0075429_100009455 | Ga0075429_1000094554 | 245 |
| 13 | 3300006880 | Ga0075429_100662217 | Ga0075429_1006622171 | 245 |
| 14 | 3300007076 | Ga0075435_100005272 | Ga0075435_1000052726 | 245 |
| 15 | 3300025922 | Ga0207646_10081545 | Ga0207646_100815452 | 245 |
| 16 | 3300028794 | Ga0307515_10048867 | Ga0307515_100488672 | 245 |
| 17 | 3300031456 | Ga0307513_10008448 | Ga0307513_100084484 | 245 |
| 18 | 3300031649 | Ga0307514_10042700 | Ga0307514_100427003 | 245 |
| 19 | 3300005435 | Ga0070714_100221569 | Ga0070714_1002215692 | 247 |
| 20 | 3300005436 | Ga0070713_100077749 | Ga0070713_1000777491 | 247 |
| 21 | 3300025928 | Ga0207700_10751161 | Ga0207700_107511611 | 247 |
| 22 | 3300009094 | Ga0111539_10703407 | Ga0111539_107034072 | 248 |
| 23 | 3300025921 | Ga0207652_10213366 | Ga0207652_102133662 | 248 |
| 24 | 3300036401 | Ga0373937_0205767 | Ga0373937_0205767_794_1558 | 248 |
| 25 | iso_pu_bacteria | 2643221715 | 2644636036 | 248 |
| 26 | iso_pu_bacteria | 2902810491 | 2902815549 | 248 |
| 27 | 3300005937 | Ga0081455_10381412 | Ga0081455_103814121 | 249 |
| 28 | 3300009094 | Ga0111539_10524963 | Ga0111539_105249632 | 249 |
| 29 | 3300049590 | Ga0501074_0030841 | Ga0501074_0030841_43_795 | 249 |
| 30 | iso_pu_bacteria | 2513237150 | 2513957259 | 249 |
| 31 | iso_pu_bacteria | 2513237165 | 2514045518 | 249 |
| 32 | iso_pu_bacteria | 2515154189 | 2516024379 | 249 |
| 33 | iso_pu_bacteria | 2579778521 | 2579852390 | 249 |
| 34 | iso_pu_bacteria | 2619618881 | 2619855699 | 249 |
| 35 | iso_pu_bacteria | 2619619003 | 2620348138 | 249 |
| 36 | iso_pu_bacteria | 2626541554 | 2626635104 | 249 |
| 37 | iso_pu_bacteria | 2643221569 | 2643862716 | 249 |
| 38 | iso_pu_bacteria | 2643221594 | 2643980279 | 249 |
| 39 | iso_pu_bacteria | 2643221621 | 2644124756 | 249 |
| 40 | iso_pu_bacteria | 2671180195 | 2671836909 | 249 |
| 41 | iso_pu_bacteria | 2773857922 | 2774855065 | 249 |
| 42 | iso_pu_bacteria | 2791355406 | 2793977598 | 249 |
| 43 | iso_pu_bacteria | 2808606359 | 2808848572 | 249 |
| 44 | iso_pu_bacteria | 2808606395 | 2809032408 | 249 |
| 45 | iso_pu_bacteria | 2855730933 | 2855736298 | 249 |
| 46 | iso_pu_bacteria | 2855767633 | 2855773235 | 249 |
| 47 | iso_pu_bacteria | 2857542790 | 2857544756 | 249 |
| 48 | iso_pu_bacteria | 2858950400 | 2858952803 | 249 |
| 49 | iso_pu_bacteria | 2866552031 | 2866554295 | 249 |
| 50 | iso_pu_bacteria | 2870782633 | 2870790605 | 249 |
| 51 | iso_pu_bacteria | 2881412998 | 2881417327 | 249 |
| 52 | iso_pu_bacteria | 2899370129 | 2899376772 | 249 |
| 53 | iso_pu_bacteria | 2932422444 | 2932423074 | 249 |
| 54 | iso_pu_bacteria | 644736347 | 644747889 | 249 |
| 55 | iso_pu_bacteria | 8004212874 | 8004215484 | 249 |
| 56 | iso_pu_bacteria | 8023680758 | 8023683567 | 249 |
| 57 | iso_pu_bacteria | 8047893842 | 8047903130 | 249 |
| 58 | iso_pu_bacteria | 8048356638 | 8048365710 | 249 |
| 59 | iso_pu_bacteria | 8048369669 | 8048379429 | 249 |
| 60 | iso_pu_bacteria | 8048379754 | 8048389974 | 249 |
| 61 | iso_pu_bacteria | 8054913762 | 8054916519 | 249 |
| 62 | iso_pu_bacteria | 8054920844 | 8054924770 | 249 |
| 63 | 3300005335 | Ga0070666_10065583 | Ga0070666_100655832 | 250 |
| 64 | 3300005335 | Ga0070666_10141809 | Ga0070666_101418092 | 250 |
| 65 | 3300005355 | Ga0070671_100001125 | Ga0070671_10000112511 | 250 |
| 66 | 3300005367 | Ga0070667_100110363 | Ga0070667_1001103633 | 250 |
| 67 | 3300005445 | Ga0070708_100009136 | Ga0070708_1000091365 | 250 |
| 68 | 3300005467 | Ga0070706_100010812 | Ga0070706_1000108123 | 250 |
| 69 | 3300005468 | Ga0070707_100094179 | Ga0070707_1000941792 | 250 |
| 70 | 3300005471 | Ga0070698_100005870 | Ga0070698_1000058702 | 250 |
| 71 | 3300005518 | Ga0070699_100046766 | Ga0070699_1000467662 | 250 |
| 72 | 3300005518 | Ga0070699_100266237 | Ga0070699_1002662372 | 250 |
| 73 | 3300005536 | Ga0070697_100029590 | Ga0070697_1000295902 | 250 |
| 74 | 3300005548 | Ga0070665_100002036 | Ga0070665_10000203620 | 250 |
| 75 | 3300005843 | Ga0068860_100006385 | Ga0068860_1000063859 | 250 |
| 76 | 3300005937 | Ga0081455_10273362 | Ga0081455_102733622 | 250 |
| 77 | 3300006847 | Ga0075431_100366397 | Ga0075431_1003663972 | 250 |
| 78 | 3300009147 | Ga0114129_10427639 | Ga0114129_104276391 | 250 |
| 79 | 3300009147 | Ga0114129_11311161 | Ga0114129_113111612 | 250 |
| 80 | 3300009551 | Ga0105238_10718197 | Ga0105238_107181971 | 250 |
| 81 | 3300010375 | Ga0105239_10092619 | Ga0105239_100926192 | 250 |
| 82 | 3300025903 | Ga0207680_10004127 | Ga0207680_100041276 | 250 |
| 83 | 3300025910 | Ga0207684_10023622 | Ga0207684_100236224 | 250 |
| 84 | 3300025913 | Ga0207695_10465481 | Ga0207695_104654811 | 250 |
| 85 | 3300025922 | Ga0207646_10226259 | Ga0207646_102262592 | 250 |
| 86 | 3300025931 | Ga0207644_10008910 | Ga0207644_100089103 | 250 |
| 87 | 3300025986 | Ga0207658_10001006 | Ga0207658_100010062 | 250 |
| 88 | 3300025986 | Ga0207658_10269766 | Ga0207658_102697662 | 250 |
| 89 | 3300028379 | Ga0268266_10000492 | Ga0268266_1000049226 | 250 |
| 90 | 3300028379 | Ga0268266_10003465 | Ga0268266_100034653 | 250 |
| 91 | 3300033179 | Ga0307507_10222388 | Ga0307507_102223881 | 250 |
| 92 | 3300046491 | Ga0495584_0124925 | Ga0495584_0124925_35_808 | 250 |
| 93 | 3300048907 | Ga0496104_0025984 | Ga0496104_0025984_1679_2440 | 250 |
| 94 | 3300048908 | Ga0496105_0121420 | Ga0496105_0121420_780_1541 | 250 |
| 95 | 3300048910 | Ga0496107_0013929 | Ga0496107_0013929_344_1105 | 250 |
| 96 | 3300048922 | Ga0496119_0008598 | Ga0496119_0008598_5226_5987 | 250 |
| 97 | 3300048924 | Ga0496121_0021330 | Ga0496121_0021330_635_1396 | 250 |
| 98 | 3300049568 | Ga0501031_0000531 | Ga0501031_0000531_11269_12030 | 250 |
| 99 | 3300049569 | Ga0501032_0002291 | Ga0501032_0002291_9662_10423 | 250 |
| 100 | 3300049570 | Ga0501033_0001475 | Ga0501033_0001475_9724_10485 | 250 |
| 101 | 3300049571 | Ga0501034_0153988 | Ga0501034_0153988_1484_2245 | 250 |
| 102 | 3300049572 | Ga0501036_0013995 | Ga0501036_0013995_110_871 | 250 |
| 103 | 3300049573 | Ga0501037_0000892 | Ga0501037_0000892_11234_11995 | 250 |
| 104 | 3300049574 | Ga0501038_0006082 | Ga0501038_0006082_128_889 | 250 |
| 105 | 3300049579 | Ga0501043_0001450 | Ga0501043_0001450_10286_11047 | 250 |
| 106 | 3300049580 | Ga0501046_0001496 | Ga0501046_0001496_10415_11176 | 250 |
| 107 | 3300049581 | Ga0501047_0001572 | Ga0501047_0001572_10300_11061 | 250 |
| 108 | 3300049582 | Ga0501048_0002344 | Ga0501048_0002344_10269_11030 | 250 |
| 109 | 3300049585 | Ga0501069_0142384 | Ga0501069_0142384_578_1339 | 250 |
| 110 | 3300049586 | Ga0501070_0001310 | Ga0501070_0001310_10287_11048 | 250 |
| 111 | 3300049589 | Ga0501073_0024949 | Ga0501073_0024949_3090_3851 | 250 |
| 112 | 3300049741 | Ga0501079_0001063 | Ga0501079_0001063_9281_10042 | 250 |
| 113 | 3300049742 | Ga0501080_0019093 | Ga0501080_0019093_5541_6302 | 250 |
| 114 | 3300049744 | Ga0501083_0010515 | Ga0501083_0010515_5677_6438 | 250 |
| 115 | 3300049822 | Ga0501035_0001636 | Ga0501035_0001636_10649_11410 | 250 |
| 116 | 3300049823 | Ga0501044_0002493 | Ga0501044_0002493_9729_10490 | 250 |
| 117 | 3300050508 | nmdc:mga09592_196719_c1 | nmdc:mga09592_196719_c1_86_859 | 250 |
| 118 | 3300050508 | nmdc:mga09592_43503_c1 | nmdc:mga09592_43503_c1_1652_2425 | 250 |
| 119 | 3300050509 | nmdc:mga0qj67_231422_c1 | nmdc:mga0qj67_231422_c1_544_1317 | 250 |
| 120 | 3300050510 | nmdc:mga06r32_415124_c1 | nmdc:mga06r32_415124_c1_384_1157 | 250 |
| 121 | 3300050510 | nmdc:mga06r32_88493_c1 | nmdc:mga06r32_88493_c1_739_1512 | 250 |
| 122 | 3300050512 | nmdc:mga0n895_55775_c1 | nmdc:mga0n895_55775_c1_1554_2327 | 250 |
| 123 | 3300050513 | nmdc:mga0rr50_33011_c1 | nmdc:mga0rr50_33011_c1_1382_2155 | 250 |
| 124 | 3300050514 | nmdc:mga08x19_7962_c1 | nmdc:mga08x19_7962_c1_1994_2767 | 250 |
| 125 | 3300050515 | nmdc:mga0a205_27687_c1 | nmdc:mga0a205_27687_c1_1215_1988 | 250 |
| 126 | 3300003214 | JGI25165J46597_1000038 | JGI25165J46597_1000038150 | 251 |
| 127 | 3300003792 | Ga0055540_1000102 | Ga0055540_100010273 | 251 |
| 128 | 3300005335 | Ga0070666_10065669 | Ga0070666_100656692 | 251 |
| 129 | 3300005367 | Ga0070667_100007148 | Ga0070667_1000071482 | 251 |
| 130 | 3300005842 | Ga0068858_100510939 | Ga0068858_1005109391 | 251 |
| 131 | 3300009545 | Ga0105237_10003621 | Ga0105237_100036219 | 251 |
| 132 | 3300025233 | Ga0209437_102273 | Ga0209437_1022732 | 251 |
| 133 | 3300025261 | Ga0209233_1000042 | Ga0209233_1000042271 | 251 |
| 134 | 3300025303 | Ga0209051_1000116 | Ga0209051_100011613 | 251 |
| 135 | 3300025903 | Ga0207680_10048779 | Ga0207680_100487792 | 251 |
| 136 | 3300025914 | Ga0207671_10003961 | Ga0207671_100039615 | 251 |
| 137 | 3300025986 | Ga0207658_10000206 | Ga0207658_1000020610 | 251 |
| 138 | 3300026035 | Ga0207703_10089465 | Ga0207703_100894651 | 251 |
| 139 | 3300031251 | Ga0265327_10001906 | Ga0265327_1000190610 | 251 |
| 140 | 3300044658 | Ga0466972_0071207 | Ga0466972_0071207_29_823 | 251 |
| 141 | 3300045976 | Ga0466967_0046127 | Ga0466967_0046127_2795_3589 | 251 |
| 142 | 3300048903 | Ga0496100_0000095 | Ga0496100_0000095_16208_17002 | 251 |
| 143 | 3300048904 | Ga0496101_0000027 | Ga0496101_0000027_173230_174024 | 251 |
| 144 | 3300048905 | Ga0496102_0003706 | Ga0496102_0003706_2940_3734 | 251 |
| 145 | 3300048906 | Ga0496103_0000226 | Ga0496103_0000226_34512_35306 | 251 |
| 146 | 3300048909 | Ga0496106_0000413 | Ga0496106_0000413_12333_13127 | 251 |
| 147 | 3300048910 | Ga0496107_0000304 | Ga0496107_0000304_25343_26137 | 251 |
| 148 | 3300048911 | Ga0496108_0004308 | Ga0496108_0004308_8164_8958 | 251 |
| 149 | 3300048912 | Ga0496109_0000407 | Ga0496109_0000407_28786_29580 | 251 |
| 150 | 3300048913 | Ga0496110_0003553 | Ga0496110_0003553_5073_5867 | 251 |
| 151 | 3300048914 | Ga0496111_0008490 | Ga0496111_0008490_5130_5924 | 251 |
| 152 | 3300048917 | Ga0496114_0000282 | Ga0496114_0000282_25029_25823 | 251 |
| 153 | 3300048918 | Ga0496115_0014824 | Ga0496115_0014824_4957_5751 | 251 |
| 154 | 3300048919 | Ga0496116_0002036 | Ga0496116_0002036_6295_7089 | 251 |
| 155 | 3300048920 | Ga0496117_0005400 | Ga0496117_0005400_6359_7153 | 251 |
| 156 | 3300048921 | Ga0496118_0019586 | Ga0496118_0019586_2180_2974 | 251 |
| 157 | 3300048922 | Ga0496119_0001985 | Ga0496119_0001985_8502_9296 | 251 |
| 158 | 3300048923 | Ga0496120_0004741 | Ga0496120_0004741_8545_9339 | 251 |
| 159 | 3300048924 | Ga0496121_0000004 | Ga0496121_0000004_907474_908268 | 251 |
| 160 | 3300048925 | Ga0496122_0000763 | Ga0496122_0000763_32637_33431 | 251 |
| 161 | 3300048926 | Ga0496123_0019687 | Ga0496123_0019687_282_1076 | 251 |
| 162 | 3300048927 | Ga0496124_0000030 | Ga0496124_0000030_119813_120607 | 251 |
| 163 | 3300048928 | Ga0496125_0000003 | Ga0496125_0000003_281500_282294 | 251 |
| 164 | 3300048929 | Ga0496126_0000001 | Ga0496126_0000001_907474_908268 | 251 |
| 165 | iso_pu_bacteria | 2684623035 | 2686534273 | 251 |
| 166 | iso_pu_bacteria | 2738541264 | 2738664964 | 251 |
| 167 | iso_pu_bacteria | 2738541356 | 2739144098 | 251 |
| 168 | iso_pu_bacteria | 2895880812 | 2895887991 | 251 |
| 169 | 3300005353 | Ga0070669_100000494 | Ga0070669_1000004946 | 252 |
| 170 | 3300005367 | Ga0070667_100000313 | Ga0070667_10000031323 | 252 |
| 171 | 3300005445 | Ga0070708_100235451 | Ga0070708_1002354512 | 252 |
| 172 | 3300005471 | Ga0070698_100001029 | Ga0070698_10000102918 | 252 |
| 173 | 3300005548 | Ga0070665_100006283 | Ga0070665_1000062836 | 252 |
| 174 | 3300005617 | Ga0068859_100000081 | Ga0068859_10000008159 | 252 |
| 175 | 3300005617 | Ga0068859_100002435 | Ga0068859_10000243514 | 252 |
| 176 | 3300005618 | Ga0068864_100124957 | Ga0068864_1001249572 | 252 |
| 177 | 3300005842 | Ga0068858_100009809 | Ga0068858_1000098093 | 252 |
| 178 | 3300005843 | Ga0068860_100000227 | Ga0068860_10000022759 | 252 |
| 179 | 3300005937 | Ga0081455_10145213 | Ga0081455_101452132 | 252 |
| 180 | 3300006051 | Ga0075364_10046044 | Ga0075364_100460442 | 252 |
| 181 | 3300006931 | Ga0097620_100000081 | Ga0097620_10000008159 | 252 |
| 182 | 3300006931 | Ga0097620_100002435 | Ga0097620_1000024357 | 252 |
| 183 | 3300009093 | Ga0105240_10582810 | Ga0105240_105828102 | 252 |
| 184 | 3300009098 | Ga0105245_10324633 | Ga0105245_103246332 | 252 |
| 185 | 3300009101 | Ga0105247_10000209 | Ga0105247_1000020913 | 252 |
| 186 | 3300009177 | Ga0105248_10000884 | Ga0105248_1000088424 | 252 |
| 187 | 3300025900 | Ga0207710_10000449 | Ga0207710_1000044927 | 252 |
| 188 | 3300025929 | Ga0207664_10041176 | Ga0207664_100411762 | 252 |
| 189 | 3300025941 | Ga0207711_10000264 | Ga0207711_1000026429 | 252 |
| 190 | 3300025986 | Ga0207658_10000952 | Ga0207658_100009522 | 252 |
| 191 | 3300026035 | Ga0207703_10023177 | Ga0207703_100231774 | 252 |
| 192 | 3300028379 | Ga0268266_10002209 | Ga0268266_1000220915 | 252 |
| 193 | 3300028381 | Ga0268264_10000152 | Ga0268264_1000015235 | 252 |
| 194 | 3300028381 | Ga0268264_10000220 | Ga0268264_10000220114 | 252 |
| 195 | 3300031731 | Ga0307405_10015411 | Ga0307405_100154112 | 252 |
| 196 | 3300031911 | Ga0307412_10036713 | Ga0307412_100367132 | 252 |
| 197 | 3300032005 | Ga0307411_10598483 | Ga0307411_105984831 | 252 |
| 198 | 3300037853 | Ga0436364_0248241 | Ga0436364_0248241_3041_3802 | 252 |
| 199 | 3300041411 | Ga0439466_0011680 | Ga0439466_0011680_2312_3073 | 252 |
| 200 | 3300044694 | Ga0466963_0045891 | Ga0466963_0045891_1024_1788 | 252 |
| 201 | 3300044719 | Ga0466971_0050322 | Ga0466971_0050322_50_814 | 252 |
| 202 | 3300044842 | Ga0466957_0032687 | Ga0466957_0032687_814_1578 | 252 |
| 203 | 3300044901 | Ga0466960_0173506 | Ga0466960_0173506_344_1108 | 252 |
| 204 | 3300045976 | Ga0466967_0037608 | Ga0466967_0037608_3062_3826 | 252 |
| 205 | 3300045976 | Ga0466967_0222982 | Ga0466967_0222982_205_969 | 252 |
| 206 | 3300046533 | Ga0495640_0088348 | Ga0495640_0088348_1237_1998 | 252 |
| 207 | 3300048903 | Ga0496100_0382638 | Ga0496100_0382638_42_815 | 252 |
| 208 | 3300048905 | Ga0496102_0000171 | Ga0496102_0000171_26867_27628 | 252 |
| 209 | 3300048906 | Ga0496103_0000871 | Ga0496103_0000871_14977_15738 | 252 |
| 210 | 3300048915 | Ga0496112_0215096 | Ga0496112_0215096_236_997 | 252 |
| 211 | 3300048916 | Ga0496113_0038582 | Ga0496113_0038582_664_1425 | 252 |
| 212 | 3300048919 | Ga0496116_0004224 | Ga0496116_0004224_3483_4244 | 252 |
| 213 | 3300048920 | Ga0496117_0000149 | Ga0496117_0000149_114235_114996 | 252 |
| 214 | 3300048921 | Ga0496118_0000049 | Ga0496118_0000049_136880_137641 | 252 |
| 215 | 3300048923 | Ga0496120_0062871 | Ga0496120_0062871_910_1677 | 252 |
| 216 | 3300048926 | Ga0496123_0086287 | Ga0496123_0086287_904_1665 | 252 |
| 217 | 3300048927 | Ga0496124_0000330 | Ga0496124_0000330_26975_27736 | 252 |
| 218 | 3300048929 | Ga0496126_0157000 | Ga0496126_0157000_235_996 | 252 |
| 219 | 3300050491 | nmdc:mga00v17_49838_c1 | nmdc:mga00v17_49838_c1_450_1211 | 252 |
| 220 | 3300053139 | Ga0500568_0000763 | Ga0500568_0000763_31_795 | 252 |
| 221 | 3300053153 | Ga0500616_0000220 | Ga0500616_0000220_42984_43748 | 252 |
| 222 | 3300001990 | JGI24737J22298_10027390 | JGI24737J22298_100273901 | 253 |
| 223 | 3300003187 | JGI25151J46595_10001424 | JGI25151J46595_100014243 | 253 |
| 224 | 3300003187 | JGI25151J46595_10022718 | JGI25151J46595_100227181 | 253 |
| 225 | 3300005327 | Ga0070658_10103876 | Ga0070658_101038763 | 253 |
| 226 | 3300005329 | Ga0070683_100047848 | Ga0070683_1000478482 | 253 |
| 227 | 3300005329 | Ga0070683_100063434 | Ga0070683_1000634345 | 253 |
| 228 | 3300005329 | Ga0070683_100139557 | Ga0070683_1001395573 | 253 |
| 229 | 3300005329 | Ga0070683_100296588 | Ga0070683_1002965882 | 253 |
| 230 | 3300005329 | Ga0070683_100469672 | Ga0070683_1004696721 | 253 |
| 231 | 3300005331 | Ga0070670_100044717 | Ga0070670_1000447175 | 253 |
| 232 | 3300005336 | Ga0070680_100003872 | Ga0070680_1000038725 | 253 |
| 233 | 3300005336 | Ga0070680_100275486 | Ga0070680_1002754862 | 253 |
| 234 | 3300005339 | Ga0070660_100006063 | Ga0070660_1000060636 | 253 |
| 235 | 3300005344 | Ga0070661_100060445 | Ga0070661_1000604452 | 253 |
| 236 | 3300005366 | Ga0070659_100012617 | Ga0070659_1000126175 | 253 |
| 237 | 3300005434 | Ga0070709_10011965 | Ga0070709_100119654 | 253 |
| 238 | 3300005435 | Ga0070714_100018744 | Ga0070714_1000187446 | 253 |
| 239 | 3300005435 | Ga0070714_100026592 | Ga0070714_1000265923 | 253 |
| 240 | 3300005435 | Ga0070714_100145613 | Ga0070714_1001456133 | 253 |
| 241 | 3300005436 | Ga0070713_100303906 | Ga0070713_1003039062 | 253 |
| 242 | 3300005455 | Ga0070663_100068731 | Ga0070663_1000687312 | 253 |
| 243 | 3300005456 | Ga0070678_100583515 | Ga0070678_1005835152 | 253 |
| 244 | 3300005457 | Ga0070662_100003140 | Ga0070662_1000031409 | 253 |
| 245 | 3300005458 | Ga0070681_10000022 | Ga0070681_1000002275 | 253 |
| 246 | 3300005458 | Ga0070681_10133474 | Ga0070681_101334741 | 253 |
| 247 | 3300005458 | Ga0070681_10150480 | Ga0070681_101504803 | 253 |
| 248 | 3300005458 | Ga0070681_10498441 | Ga0070681_104984411 | 253 |
| 249 | 3300005530 | Ga0070679_100000004 | Ga0070679_100000004118 | 253 |
| 250 | 3300005530 | Ga0070679_100108378 | Ga0070679_1001083782 | 253 |
| 251 | 3300005530 | Ga0070679_100127139 | Ga0070679_1001271391 | 253 |
| 252 | 3300005535 | Ga0070684_100045717 | Ga0070684_1000457172 | 253 |
| 253 | 3300005535 | Ga0070684_100228282 | Ga0070684_1002282822 | 253 |
| 254 | 3300005535 | Ga0070684_100319105 | Ga0070684_1003191052 | 253 |
| 255 | 3300005563 | Ga0068855_101018652 | Ga0068855_1010186521 | 253 |
| 256 | 3300005564 | Ga0070664_100003085 | Ga0070664_10000308513 | 253 |
| 257 | 3300005564 | Ga0070664_100039423 | Ga0070664_1000394232 | 253 |
| 258 | 3300005577 | Ga0068857_100043813 | Ga0068857_1000438134 | 253 |
| 259 | 3300005577 | Ga0068857_100046439 | Ga0068857_1000464392 | 253 |
| 260 | 3300005577 | Ga0068857_100333855 | Ga0068857_1003338552 | 253 |
| 261 | 3300005577 | Ga0068857_100345145 | Ga0068857_1003451452 | 253 |
| 262 | 3300005617 | Ga0068859_100012548 | Ga0068859_1000125486 | 253 |
| 263 | 3300005617 | Ga0068859_100042851 | Ga0068859_1000428512 | 253 |
| 264 | 3300005618 | Ga0068864_100017914 | Ga0068864_1000179142 | 253 |
| 265 | 3300005618 | Ga0068864_100323525 | Ga0068864_1003235251 | 253 |
| 266 | 3300005841 | Ga0068863_100000419 | Ga0068863_10000041917 | 253 |
| 267 | 3300005841 | Ga0068863_100009985 | Ga0068863_1000099858 | 253 |
| 268 | 3300005841 | Ga0068863_100012171 | Ga0068863_1000121716 | 253 |
| 269 | 3300005842 | Ga0068858_100000789 | Ga0068858_10000078930 | 253 |
| 270 | 3300005842 | Ga0068858_100022009 | Ga0068858_1000220095 | 253 |
| 271 | 3300005843 | Ga0068860_100028059 | Ga0068860_1000280593 | 253 |
| 272 | 3300005844 | Ga0068862_100000547 | Ga0068862_10000054723 | 253 |
| 273 | 3300005937 | Ga0081455_10000365 | Ga0081455_1000036530 | 253 |
| 274 | 3300005937 | Ga0081455_10000906 | Ga0081455_100009064 | 253 |
| 275 | 3300005985 | Ga0081539_10006295 | Ga0081539_100062954 | 253 |
| 276 | 3300006028 | Ga0070717_10176478 | Ga0070717_101764783 | 253 |
| 277 | 3300006042 | Ga0075368_10003241 | Ga0075368_100032413 | 253 |
| 278 | 3300006051 | Ga0075364_10024584 | Ga0075364_100245844 | 253 |
| 279 | 3300006178 | Ga0075367_10000446 | Ga0075367_100004464 | 253 |
| 280 | 3300006931 | Ga0097620_100012548 | Ga0097620_1000125485 | 253 |
| 281 | 3300006931 | Ga0097620_100042851 | Ga0097620_1000428512 | 253 |
| 282 | 3300009098 | Ga0105245_10054334 | Ga0105245_100543343 | 253 |
| 283 | 3300009101 | Ga0105247_10001558 | Ga0105247_1000155818 | 253 |
| 284 | 3300009177 | Ga0105248_10011070 | Ga0105248_100110707 | 253 |
| 285 | 3300009553 | Ga0105249_10018007 | Ga0105249_100180077 | 253 |
| 286 | 3300009553 | Ga0105249_10065869 | Ga0105249_100658695 | 253 |
| 287 | 3300010375 | Ga0105239_10141702 | Ga0105239_101417022 | 253 |
| 288 | 3300013105 | Ga0157369_10058214 | Ga0157369_100582144 | 253 |
| 289 | 3300013308 | Ga0157375_10479037 | Ga0157375_104790372 | 253 |
| 290 | 3300014325 | Ga0163163_10002291 | Ga0163163_1000229115 | 253 |
| 291 | 3300014325 | Ga0163163_10388917 | Ga0163163_103889172 | 253 |
| 292 | 3300014968 | Ga0157379_10007178 | Ga0157379_100071783 | 253 |
| 293 | 3300020081 | Ga0206354_10171698 | Ga0206354_101716981 | 253 |
| 294 | 3300020082 | Ga0206353_11320048 | Ga0206353_113200483 | 253 |
| 295 | 3300021388 | Ga0213875_10003862 | Ga0213875_100038626 | 253 |
| 296 | 3300021388 | Ga0213875_10004667 | Ga0213875_100046676 | 253 |
| 297 | 3300021388 | Ga0213875_10011430 | Ga0213875_100114302 | 253 |
| 298 | 3300022467 | Ga0224712_10210136 | Ga0224712_102101361 | 253 |
| 299 | 3300025292 | Ga0209676_1008552 | Ga0209676_10085523 | 253 |
| 300 | 3300025294 | Ga0209025_1000055 | Ga0209025_1000055160 | 253 |
| 301 | 3300025294 | Ga0209025_1000115 | Ga0209025_1000115129 | 253 |
| 302 | 3300025298 | Ga0209050_1008588 | Ga0209050_10085884 | 253 |
| 303 | 3300025303 | Ga0209051_1051012 | Ga0209051_10510121 | 253 |
| 304 | 3300025898 | Ga0207692_10094969 | Ga0207692_100949692 | 253 |
| 305 | 3300025900 | Ga0207710_10001674 | Ga0207710_1000167412 | 253 |
| 306 | 3300025900 | Ga0207710_10005821 | Ga0207710_100058214 | 253 |
| 307 | 3300025900 | Ga0207710_10007284 | Ga0207710_100072844 | 253 |
| 308 | 3300025906 | Ga0207699_10036944 | Ga0207699_100369444 | 253 |
| 309 | 3300025912 | Ga0207707_10000029 | Ga0207707_1000002910 | 253 |
| 310 | 3300025912 | Ga0207707_10109009 | Ga0207707_101090092 | 253 |
| 311 | 3300025912 | Ga0207707_10236245 | Ga0207707_102362452 | 253 |
| 312 | 3300025912 | Ga0207707_10325320 | Ga0207707_103253202 | 253 |
| 313 | 3300025917 | Ga0207660_10001708 | Ga0207660_1000170812 | 253 |
| 314 | 3300025919 | Ga0207657_10007152 | Ga0207657_100071527 | 253 |
| 315 | 3300025920 | Ga0207649_10040470 | Ga0207649_100404703 | 253 |
| 316 | 3300025921 | Ga0207652_10000655 | Ga0207652_100006556 | 253 |
| 317 | 3300025921 | Ga0207652_10150298 | Ga0207652_101502982 | 253 |
| 318 | 3300025928 | Ga0207700_10105032 | Ga0207700_101050322 | 253 |
| 319 | 3300025928 | Ga0207700_10360041 | Ga0207700_103600411 | 253 |
| 320 | 3300025929 | Ga0207664_10008501 | Ga0207664_100085017 | 253 |
| 321 | 3300025929 | Ga0207664_10101770 | Ga0207664_101017703 | 253 |
| 322 | 3300025933 | Ga0207706_10002746 | Ga0207706_1000274613 | 253 |
| 323 | 3300025935 | Ga0207709_10318270 | Ga0207709_103182701 | 253 |
| 324 | 3300025938 | Ga0207704_10292695 | Ga0207704_102926952 | 253 |
| 325 | 3300025941 | Ga0207711_10000284 | Ga0207711_1000028431 | 253 |
| 326 | 3300025944 | Ga0207661_10071523 | Ga0207661_100715233 | 253 |
| 327 | 3300025944 | Ga0207661_10094623 | Ga0207661_100946232 | 253 |
| 328 | 3300025944 | Ga0207661_10135061 | Ga0207661_101350612 | 253 |
| 329 | 3300025944 | Ga0207661_10381073 | Ga0207661_103810732 | 253 |
| 330 | 3300025945 | Ga0207679_10025688 | Ga0207679_100256882 | 253 |
| 331 | 3300025945 | Ga0207679_10040623 | Ga0207679_100406233 | 253 |
| 332 | 3300025945 | Ga0207679_10136072 | Ga0207679_101360723 | 253 |
| 333 | 3300025949 | Ga0207667_10228032 | Ga0207667_102280321 | 253 |
| 334 | 3300025961 | Ga0207712_10002517 | Ga0207712_100025175 | 253 |
| 335 | 3300025961 | Ga0207712_10381652 | Ga0207712_103816521 | 253 |
| 336 | 3300025972 | Ga0207668_10302030 | Ga0207668_103020302 | 253 |
| 337 | 3300025986 | Ga0207658_10027677 | Ga0207658_100276772 | 253 |
| 338 | 3300026035 | Ga0207703_10000015 | Ga0207703_10000015193 | 253 |
| 339 | 3300026035 | Ga0207703_10024826 | Ga0207703_100248264 | 253 |
| 340 | 3300026035 | Ga0207703_10320393 | Ga0207703_103203932 | 253 |
| 341 | 3300026067 | Ga0207678_10003869 | Ga0207678_1000386911 | 253 |
| 342 | 3300026067 | Ga0207678_10044265 | Ga0207678_100442652 | 253 |
| 343 | 3300026088 | Ga0207641_10002933 | Ga0207641_1000293315 | 253 |
| 344 | 3300026088 | Ga0207641_10007528 | Ga0207641_100075283 | 253 |
| 345 | 3300026088 | Ga0207641_10008125 | Ga0207641_100081256 | 253 |
| 346 | 3300026095 | Ga0207676_10147698 | Ga0207676_101476982 | 253 |
| 347 | 3300026095 | Ga0207676_10408669 | Ga0207676_104086692 | 253 |
| 348 | 3300026116 | Ga0207674_10059221 | Ga0207674_100592215 | 253 |
| 349 | 3300026116 | Ga0207674_10156265 | Ga0207674_101562653 | 253 |
| 350 | 3300026116 | Ga0207674_10256941 | Ga0207674_102569412 | 253 |
| 351 | 3300026116 | Ga0207674_10316867 | Ga0207674_103168672 | 253 |
| 352 | 3300026116 | Ga0207674_10360879 | Ga0207674_103608792 | 253 |
| 353 | 3300026116 | Ga0207674_10407868 | Ga0207674_104078681 | 253 |
| 354 | 3300026142 | Ga0207698_10220495 | Ga0207698_102204951 | 253 |
| 355 | 3300027866 | Ga0209813_10003017 | Ga0209813_100030174 | 253 |
| 356 | 3300028380 | Ga0268265_10000518 | Ga0268265_1000051817 | 253 |
| 357 | 3300028381 | Ga0268264_10019875 | Ga0268264_100198756 | 253 |
| 358 | 3300030500 | Ga0268256_1008888 | Ga0268256_10088881 | 253 |
| 359 | 3300031507 | Ga0307509_10006450 | Ga0307509_1000645011 | 253 |
| 360 | 3300031824 | Ga0307413_10316514 | Ga0307413_103165141 | 253 |
| 361 | 3300031838 | Ga0307518_10020698 | Ga0307518_100206984 | 253 |
| 362 | 3300031838 | Ga0307518_10105941 | Ga0307518_101059411 | 253 |
| 363 | 3300031852 | Ga0307410_10085175 | Ga0307410_100851752 | 253 |
| 364 | 3300031911 | Ga0307412_10079297 | Ga0307412_100792973 | 253 |
| 365 | 3300031995 | Ga0307409_100027582 | Ga0307409_1000275823 | 253 |
| 366 | 3300031995 | Ga0307409_100287315 | Ga0307409_1002873152 | 253 |
| 367 | 3300031995 | Ga0307409_100307875 | Ga0307409_1003078752 | 253 |
| 368 | 3300031995 | Ga0307409_100491446 | Ga0307409_1004914462 | 253 |
| 369 | 3300032002 | Ga0307416_100360459 | Ga0307416_1003604592 | 253 |
| 370 | 3300032004 | Ga0307414_10495113 | Ga0307414_104951132 | 253 |
| 371 | 3300032005 | Ga0307411_10060765 | Ga0307411_100607653 | 253 |
| 372 | 3300032126 | Ga0307415_100033772 | Ga0307415_1000337723 | 253 |
| 373 | 3300032126 | Ga0307415_100047905 | Ga0307415_1000479053 | 253 |
| 374 | 3300033180 | Ga0307510_10001944 | Ga0307510_1000194418 | 253 |
| 375 | 3300036459 | Ga0372808_002056 | Ga0372808_002056_872_1684 | 253 |
| 376 | 3300037471 | Ga0395905_0164302 | Ga0395905_0164302_1292_2056 | 253 |
| 377 | 3300037853 | Ga0436364_0299324 | Ga0436364_0299324_708_1472 | 253 |
| 378 | 3300037853 | Ga0436364_0712624 | Ga0436364_0712624_4094_4858 | 253 |
| 379 | 3300037853 | Ga0436364_1299779 | Ga0436364_1299779_54646_55410 | 253 |
| 380 | 3300037853 | Ga0436364_1545113 | Ga0436364_1545113_6364_7128 | 253 |
| 381 | 3300041404 | Ga0439436_0051496 | Ga0439436_0051496_376_1143 | 253 |
| 382 | 3300042439 | Ga0439464_0012717 | Ga0439464_0012717_1326_2087 | 253 |
| 383 | 3300044658 | Ga0466972_0080721 | Ga0466972_0080721_168_935 | 253 |
| 384 | 3300044693 | Ga0466961_0028079 | Ga0466961_0028079_991_1758 | 253 |
| 385 | 3300044901 | Ga0466960_0005889 | Ga0466960_0005889_370_1137 | 253 |
| 386 | 3300044901 | Ga0466960_0036245 | Ga0466960_0036245_1519_2298 | 253 |
| 387 | 3300045836 | Ga0466958_0057298 | Ga0466958_0057298_1256_2044 | 253 |
| 388 | 3300045836 | Ga0466958_0351080 | Ga0466958_0351080_125_892 | 253 |
| 389 | 3300045976 | Ga0466967_0042605 | Ga0466967_0042605_2803_3582 | 253 |
| 390 | 3300045976 | Ga0466967_0124070 | Ga0466967_0124070_180_944 | 253 |
| 391 | 3300045976 | Ga0466967_0180793 | Ga0466967_0180793_1061_1828 | 253 |
| 392 | 3300045976 | Ga0466967_0496016 | Ga0466967_0496016_208_972 | 253 |
| 393 | 3300046455 | Ga0495603_0010835 | Ga0495603_0010835_985_1749 | 253 |
| 394 | 3300046455 | Ga0495603_0174115 | Ga0495603_0174115_101_868 | 253 |
| 395 | 3300046455 | Ga0495603_0264464 | Ga0495603_0264464_21_788 | 253 |
| 396 | 3300046473 | Ga0495582_0079800 | Ga0495582_0079800_496_1260 | 253 |
| 397 | 3300046492 | Ga0495585_0010443 | Ga0495585_0010443_2641_3405 | 253 |
| 398 | 3300046499 | Ga0495594_0003695 | Ga0495594_0003695_5988_6752 | 253 |
| 399 | 3300046501 | Ga0495607_0046393 | Ga0495607_0046393_1558_2322 | 253 |
| 400 | 3300046507 | Ga0495606_0021321 | Ga0495606_0021321_2154_2918 | 253 |
| 401 | 3300046526 | Ga0495666_0002396 | Ga0495666_0002396_156_920 | 253 |
| 402 | 3300046558 | Ga0495633_0001542 | Ga0495633_0001542_12282_13058 | 253 |
| 403 | 3300046616 | Ga0495668_0005584 | Ga0495668_0005584_7507_8271 | 253 |
| 404 | 3300046684 | Ga0495669_0001592 | Ga0495669_0001592_2164_2934 | 253 |
| 405 | 3300046690 | Ga0495624_0033151 | Ga0495624_0033151_133_897 | 253 |
| 406 | 3300046794 | Ga0495589_0053952 | Ga0495589_0053952_438_1205 | 253 |
| 407 | 3300047321 | Ga0495676_0021262 | Ga0495676_0021262_1432_2196 | 253 |
| 408 | 3300047321 | Ga0495676_0176152 | Ga0495676_0176152_92_865 | 253 |
| 409 | 3300047323 | Ga0495683_0007957 | Ga0495683_0007957_367_1131 | 253 |
| 410 | 3300047443 | Ga0495687_005501 | Ga0495687_005501_2922_3686 | 253 |
| 411 | 3300047443 | Ga0495687_035492 | Ga0495687_035492_326_1090 | 253 |
| 412 | 3300047447 | Ga0495685_004610 | Ga0495685_004610_2684_3448 | 253 |
| 413 | 3300048089 | Ga0495614_0016005 | Ga0495614_0016005_1014_1778 | 253 |
| 414 | 3300048903 | Ga0496100_0002953 | Ga0496100_0002953_4970_5797 | 253 |
| 415 | 3300048903 | Ga0496100_0009066 | Ga0496100_0009066_3906_4703 | 253 |
| 416 | 3300048903 | Ga0496100_0496309 | Ga0496100_0496309_141_908 | 253 |
| 417 | 3300048904 | Ga0496101_0018977 | Ga0496101_0018977_3067_3894 | 253 |
| 418 | 3300048904 | Ga0496101_0137186 | Ga0496101_0137186_853_1650 | 253 |
| 419 | 3300048904 | Ga0496101_0423733 | Ga0496101_0423733_115_882 | 253 |
| 420 | 3300048905 | Ga0496102_0000020 | Ga0496102_0000020_215886_216713 | 253 |
| 421 | 3300048905 | Ga0496102_0000111 | Ga0496102_0000111_2212_2979 | 253 |
| 422 | 3300048905 | Ga0496102_0000190 | Ga0496102_0000190_35932_36729 | 253 |
| 423 | 3300048905 | Ga0496102_0392090 | Ga0496102_0392090_373_1137 | 253 |
| 424 | 3300048905 | Ga0496102_0507361 | Ga0496102_0507361_316_1116 | 253 |
| 425 | 3300048906 | Ga0496103_0000030 | Ga0496103_0000030_97490_98257 | 253 |
| 426 | 3300048906 | Ga0496103_0000088 | Ga0496103_0000088_22625_23452 | 253 |
| 427 | 3300048906 | Ga0496103_0000125 | Ga0496103_0000125_35924_36721 | 253 |
| 428 | 3300048907 | Ga0496104_0040259 | Ga0496104_0040259_3194_4021 | 253 |
| 429 | 3300048907 | Ga0496104_0387229 | Ga0496104_0387229_331_1131 | 253 |
| 430 | 3300048907 | Ga0496104_0474473 | Ga0496104_0474473_36_833 | 253 |
| 431 | 3300048908 | Ga0496105_0183050 | Ga0496105_0183050_101_919 | 253 |
| 432 | 3300048909 | Ga0496106_0344036 | Ga0496106_0344036_14_811 | 253 |
| 433 | 3300048910 | Ga0496107_0032123 | Ga0496107_0032123_2525_3322 | 253 |
| 434 | 3300048911 | Ga0496108_0115454 | Ga0496108_0115454_975_1739 | 253 |
| 435 | 3300048912 | Ga0496109_0576754 | Ga0496109_0576754_36_833 | 253 |
| 436 | 3300048913 | Ga0496110_0031115 | Ga0496110_0031115_3782_4579 | 253 |
| 437 | 3300048913 | Ga0496110_0079377 | Ga0496110_0079377_1015_1815 | 253 |
| 438 | 3300048913 | Ga0496110_0138986 | Ga0496110_0138986_78_905 | 253 |
| 439 | 3300048915 | Ga0496112_0204888 | Ga0496112_0204888_191_958 | 253 |
| 440 | 3300048917 | Ga0496114_0477272 | Ga0496114_0477272_170_967 | 253 |
| 441 | 3300048918 | Ga0496115_0059617 | Ga0496115_0059617_1297_2097 | 253 |
| 442 | 3300048919 | Ga0496116_0000067 | Ga0496116_0000067_215871_216698 | 253 |
| 443 | 3300048919 | Ga0496116_0000337 | Ga0496116_0000337_30105_30902 | 253 |
| 444 | 3300048920 | Ga0496117_0000170 | Ga0496117_0000170_91306_92133 | 253 |
| 445 | 3300048920 | Ga0496117_0000313 | Ga0496117_0000313_37268_38065 | 253 |
| 446 | 3300048921 | Ga0496118_0000308 | Ga0496118_0000308_46716_47513 | 253 |
| 447 | 3300048921 | Ga0496118_0000337 | Ga0496118_0000337_22638_23465 | 253 |
| 448 | 3300048921 | Ga0496118_0018942 | Ga0496118_0018942_5215_5994 | 253 |
| 449 | 3300048921 | Ga0496118_0044396 | Ga0496118_0044396_1818_2585 | 253 |
| 450 | 3300048921 | Ga0496118_0051972 | Ga0496118_0051972_2155_2922 | 253 |
| 451 | 3300048922 | Ga0496119_0004562 | Ga0496119_0004562_11476_12303 | 253 |
| 452 | 3300048922 | Ga0496119_0011159 | Ga0496119_0011159_2721_3518 | 253 |
| 453 | 3300048922 | Ga0496119_0025811 | Ga0496119_0025811_1678_2496 | 253 |
| 454 | 3300048922 | Ga0496119_0042601 | Ga0496119_0042601_1623_2405 | 253 |
| 455 | 3300048923 | Ga0496120_0008130 | Ga0496120_0008130_6772_7569 | 253 |
| 456 | 3300048923 | Ga0496120_0009211 | Ga0496120_0009211_1232_2059 | 253 |
| 457 | 3300048924 | Ga0496121_0001602 | Ga0496121_0001602_22751_23548 | 253 |
| 458 | 3300048924 | Ga0496121_0012251 | Ga0496121_0012251_1352_2119 | 253 |
| 459 | 3300048924 | Ga0496121_0030413 | Ga0496121_0030413_3654_4472 | 253 |
| 460 | 3300048924 | Ga0496121_0038895 | Ga0496121_0038895_3100_3927 | 253 |
| 461 | 3300048924 | Ga0496121_0041540 | Ga0496121_0041540_840_1622 | 253 |
| 462 | 3300048925 | Ga0496122_0159958 | Ga0496122_0159958_315_1091 | 253 |
| 463 | 3300048925 | Ga0496122_0289244 | Ga0496122_0289244_106_873 | 253 |
| 464 | 3300048927 | Ga0496124_0029837 | Ga0496124_0029837_356_1153 | 253 |
| 465 | 3300048927 | Ga0496124_0051701 | Ga0496124_0051701_354_1181 | 253 |
| 466 | 3300048928 | Ga0496125_0015580 | Ga0496125_0015580_4686_5450 | 253 |
| 467 | 3300048928 | Ga0496125_0021713 | Ga0496125_0021713_4974_5801 | 253 |
| 468 | 3300048929 | Ga0496126_0000006 | Ga0496126_0000006_525175_525939 | 253 |
| 469 | 3300048929 | Ga0496126_0000080 | Ga0496126_0000080_4913_5740 | 253 |
| 470 | 3300048929 | Ga0496126_0000514 | Ga0496126_0000514_30001_30798 | 253 |
| 471 | 3300048929 | Ga0496126_0000999 | Ga0496126_0000999_31910_32680 | 253 |
| 472 | 3300048929 | Ga0496126_0255822 | Ga0496126_0255822_457_1257 | 253 |
| 473 | 3300048929 | Ga0496126_0338289 | Ga0496126_0338289_322_1086 | 253 |
| 474 | 3300049569 | Ga0501032_0035594 | Ga0501032_0035594_1072_1839 | 253 |
| 475 | 3300049570 | Ga0501033_0017275 | Ga0501033_0017275_3335_4102 | 253 |
| 476 | 3300049571 | Ga0501034_0000335 | Ga0501034_0000335_18484_19248 | 253 |
| 477 | 3300049573 | Ga0501037_0047673 | Ga0501037_0047673_1852_2619 | 253 |
| 478 | 3300049574 | Ga0501038_0496733 | Ga0501038_0496733_120_887 | 253 |
| 479 | 3300049578 | Ga0501042_0438070 | Ga0501042_0438070_19_858 | 253 |
| 480 | 3300049579 | Ga0501043_0088622 | Ga0501043_0088622_388_1155 | 253 |
| 481 | 3300049581 | Ga0501047_0010522 | Ga0501047_0010522_537_1304 | 253 |
| 482 | 3300049585 | Ga0501069_0001445 | Ga0501069_0001445_7166_7933 | 253 |
| 483 | 3300049585 | Ga0501069_0365915 | Ga0501069_0365915_16_804 | 253 |
| 484 | 3300049586 | Ga0501070_0000325 | Ga0501070_0000325_7520_8287 | 253 |
| 485 | 3300049586 | Ga0501070_0006844 | Ga0501070_0006844_3768_4535 | 253 |
| 486 | 3300049586 | Ga0501070_0009183 | Ga0501070_0009183_5164_5931 | 253 |
| 487 | 3300049586 | Ga0501070_0013263 | Ga0501070_0013263_2077_2844 | 253 |
| 488 | 3300049586 | Ga0501070_0168212 | Ga0501070_0168212_396_1187 | 253 |
| 489 | 3300049589 | Ga0501073_0033685 | Ga0501073_0033685_2355_3122 | 253 |
| 490 | 3300049590 | Ga0501074_0032057 | Ga0501074_0032057_2867_3634 | 253 |
| 491 | 3300049741 | Ga0501079_0001277 | Ga0501079_0001277_121_888 | 253 |
| 492 | 3300049742 | Ga0501080_0000096 | Ga0501080_0000096_7178_7945 | 253 |
| 493 | 3300049742 | Ga0501080_0272048 | Ga0501080_0272048_92_859 | 253 |
| 494 | 3300049742 | Ga0501080_0354659 | Ga0501080_0354659_278_1045 | 253 |
| 495 | 3300049822 | Ga0501035_0147265 | Ga0501035_0147265_405_1172 | 253 |
| 496 | 3300049823 | Ga0501044_0000201 | Ga0501044_0000201_51880_52647 | 253 |
| 497 | 3300049823 | Ga0501044_0002899 | Ga0501044_0002899_8424_9191 | 253 |
| 498 | 3300049823 | Ga0501044_0065517 | Ga0501044_0065517_2585_3352 | 253 |
| 499 | 3300050491 | nmdc:mga00v17_155802_c1 | nmdc:mga00v17_155802_c1_694_1458 | 253 |
| 500 | 3300050494 | nmdc:mga06z11_1130_c1 | nmdc:mga06z11_1130_c1_6127_6891 | 253 |
| 501 | 3300050495 | nmdc:mga04h51_3309_c1 | nmdc:mga04h51_3309_c1_536_1300 | 253 |
| 502 | 3300050508 | nmdc:mga09592_365_c1 | nmdc:mga09592_365_c1_19977_20741 | 253 |
| 503 | 3300061719 | Ga0466962_0161212 | Ga0466962_0161212_213_980 | 253 |
| 504 | iso_pu_bacteria | 2895880812 | 2895890237 | 253 |
| 505 | iso_pu_bacteria | 8056060235 | 8056063608 | 253 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5kjp-assembly1.cif.gz_A | crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis h37rv | 0.9884 | 4 | 251 |
| 3qxi-assembly1.cif.gz_C | crystal structure of enoyl-coa hydratase echa1 from mycobacterium marinum | 0.9863 | 4 | 251 |
| 3qxi-assembly1.cif.gz_A | crystal structure of enoyl-coa hydratase echa1 from mycobacterium marinum | 0.9802 | 4 | 251 |
| 3trr-assembly2.cif.gz_D | crystal structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus | 0.9771 | 3 | 251 |
| 5kjp-assembly1.cif.gz_A | crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis h37rv | 0.9728 | 4 | 251 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3qxiB01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9867 | 4 | 193 | 3.90.226.10 |
| 3rsiB02 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1; | 0.973 | 89 | 190 | 3.90.226.20 |
| af_O06536_1_113_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9697 | 15 | 115 | 3.90.226.10 |
| 3rsiC01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.9672 | 2 | 57 | 3.30.300.220 |
| 3qxiB01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9616 | 4 | 193 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A356HP65-F1-model_v4 | deleted | 0.9969 | 77 | 251 |
|
| AF-A0A3N1D316-F1-model_v4 | Enoyl-CoA hydratase | 0.9931 | 2 | 251 |
GO:0003824
GO:0006635 |
| AF-A8LD72-F1-model_v4 | deleted | 0.9929 | 2 | 251 |
|
| AF-A0A2M6VVT7-F1-model_v4 | Enoyl-CoA hydratase | 0.9928 | 1 | 251 |
GO:0006635
GO:0016836 |
| AF-J4TIU2-F1-model_v4 | Carnitinyl-CoA dehydratase CaiD | 0.9896 | 1 | 251 |
GO:0004300
GO:0006631 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar