F456374

General Info

Members Datasets Scaffolds Average Seq Length
505 266 464 256

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10256941|Ga0207674_102569412
Length 293
Sequence VADEVLVEYADRVAVMTINRPQARNAVNHAVSALMAEALDELDRRDDLTVGIITGAGGTFSSGMDLKAFLAGENVAIEGRGFAGLTQAPPRKPLIAAVEGWALAGGCEVALACDLIVAANDAKFGIPEVKRGLVAGAGGLIRLPRRIPAGIAMELALTGDPLPAVDAHRLGLVNALTEPGGALDGARALAARIAANGPLAVATTKQIIAQQHDWDMAEAWAQQQPMLQPVFRSSPACMIASVETQTRQWSTHGTSCTSWWRISGPLWVISGPSASSCRQRRTSSACHEWVPSV

Samples

Sample ID Description Type Environment
1 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
2 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
3 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
4 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
5 2619618881 Frankia sp. ACN1ag Isolate Unclassified
6 2619619003 Frankia sp. CpI1-P Isolate Nodule
7 2626541554 Frankia sp. AvcI.1 Isolate Nodule
8 2643221569 Achromobacter sp. Root565 Isolate Unclassified
9 2643221594 Achromobacter sp. Root170 Isolate Unclassified
10 2643221621 Achromobacter sp. Root83 Isolate Unclassified
11 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
12 2671180195 Frankia sp. CcI49 Isolate Nodule
13 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
14 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
15 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
16 2773857922 Frankia sp. CcI49 Isolate Nodule
17 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
18 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
19 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
20 2855730933 Achromobacter sp. HZ28 Isolate Nodule
21 2855767633 Achromobacter sp. HZ34 Isolate Nodule
22 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
23 2858950400 Achromobacter sp. K91 Isolate Unclassified
24 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
25 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
26 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
27 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
28 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
29 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
30 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
31 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
32 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
33 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
34 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
166 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
167 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
179 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
215 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
257 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
258 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
259 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
260 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
261 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
262 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
263 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
264 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
265 8054920844 Frankia tisae Agncl-8 Isolate Nodule
266 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.09
Metatranscriptomes 0.79
Isolates 8.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.75
Nodule 2.38
Rhizoplane 9.7
Rhizosphere 64.95
Stem 0
Stem Tuber 0.2
Unclassified 18.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10027390 3300001990 Bacteria 1797
2 JGI25151J46595_10001424 3300003187 Bacteria 16345
3 JGI25151J46595_10022718 3300003187 Bacteria 2598
4 JGI25165J46597_1000038 3300003214 Bacteria 283664
5 Ga0055540_1000102 3300003792 Bacteria 95294
6 Ga0070658_10103876 3300005327 Bacteria 2350
7 Ga0070683_100047848 3300005329 Bacteria 3953
8 Ga0070683_100063434 3300005329 Bacteria 3437
9 Ga0070683_100139557 3300005329 Bacteria 2296
10 Ga0070683_100296588 3300005329 Bacteria 1538
11 Ga0070683_100469672 3300005329 Bacteria 1201
12 Ga0070670_100044717 3300005331 Bacteria 3807
13 Ga0070666_10065583 3300005335 Bacteria 2464
14 Ga0070666_10065669 3300005335 Bacteria 2462
15 Ga0070666_10141809 3300005335 Bacteria 1674
16 Ga0070680_100003872 3300005336 Bacteria 11189
17 Ga0070680_100275486 3300005336 Bacteria 1425
18 Ga0070660_100006063 3300005339 Bacteria 8358
19 Ga0070661_100060445 3300005344 Bacteria 2781
20 Ga0070669_100000494 3300005353 Bacteria 29775
21 Ga0070671_100001125 3300005355 Bacteria 19843
22 Ga0070659_100012617 3300005366 Bacteria 6266
23 Ga0070667_100000313 3300005367 Bacteria 54181
24 Ga0070667_100007148 3300005367 Bacteria 9278
25 Ga0070667_100110363 3300005367 Bacteria 2385
26 Ga0070709_10011965 3300005434 Bacteria 4850
27 Ga0070714_100018744 3300005435 Bacteria 5629
28 Ga0070714_100026592 3300005435 Bacteria 4784
29 Ga0070714_100145613 3300005435 Bacteria 2131
30 Ga0070714_100221569 3300005435 Bacteria 1739
31 Ga0070713_100077749 3300005436 Bacteria 2822
32 Ga0070713_100303906 3300005436 Bacteria 1469
33 Ga0070708_100009136 3300005445 Bacteria 7993
34 Ga0070708_100235451 3300005445 Bacteria 1719
35 Ga0070663_100068731 3300005455 Bacteria 2572
36 Ga0070678_100583515 3300005456 Bacteria 996
37 Ga0070662_100003140 3300005457 Bacteria 10265
38 Ga0070681_10000022 3300005458 Bacteria 116402
39 Ga0070681_10133474 3300005458 Bacteria 2414
40 Ga0070681_10150480 3300005458 Bacteria 2254
41 Ga0070681_10498441 3300005458 Bacteria 1131
42 Ga0070706_100010812 3300005467 Bacteria 8472
43 Ga0070707_100094179 3300005468 Bacteria 2900
44 Ga0070698_100001029 3300005471 Bacteria 30680
45 Ga0070698_100005870 3300005471 Bacteria 13417
46 Ga0070699_100046766 3300005518 Bacteria 3745
47 Ga0070699_100266237 3300005518 Bacteria 1533
48 Ga0070679_100000004 3300005530 Bacteria 263662
49 Ga0070679_100108378 3300005530 Bacteria 2763
50 Ga0070679_100127139 3300005530 Bacteria 2530
51 Ga0070684_100045717 3300005535 Bacteria 3791
52 Ga0070684_100228282 3300005535 Bacteria 1699
53 Ga0070684_100319105 3300005535 Bacteria 1427
54 Ga0070697_100029590 3300005536 Bacteria 4393
55 Ga0070697_100075606 3300005536 Bacteria 2769
56 Ga0070665_100002036 3300005548 Bacteria 22749
57 Ga0070665_100006283 3300005548 Bacteria 12140
58 Ga0068855_101018652 3300005563 Bacteria 869
59 Ga0070664_100003085 3300005564 Bacteria 13467
60 Ga0070664_100039423 3300005564 Bacteria 3981
61 Ga0068857_100043813 3300005577 Bacteria 3969
62 Ga0068857_100046439 3300005577 Bacteria 3854
63 Ga0068857_100333855 3300005577 Bacteria 1401
64 Ga0068857_100345145 3300005577 Bacteria 1378
65 Ga0068859_100000081 3300005617 Bacteria 87606
66 Ga0068859_100002435 3300005617 Bacteria 18946
67 Ga0068859_100012548 3300005617 Bacteria 8526
68 Ga0068859_100042851 3300005617 Bacteria 4547
69 Ga0068864_100017914 3300005618 Bacteria 5909
70 Ga0068864_100124957 3300005618 Unclassified 2304
71 Ga0068864_100323525 3300005618 Bacteria 1449
72 Ga0068863_100000419 3300005841 Bacteria 43150
73 Ga0068863_100009985 3300005841 Bacteria 9242
74 Ga0068863_100012171 3300005841 Bacteria 8309
75 Ga0068858_100000789 3300005842 Bacteria 33040
76 Ga0068858_100009809 3300005842 Bacteria 9115
77 Ga0068858_100022009 3300005842 Bacteria 5953
78 Ga0068858_100510939 3300005842 Bacteria 1161
79 Ga0068860_100000227 3300005843 Bacteria 87278
80 Ga0068860_100006385 3300005843 Bacteria 11834
81 Ga0068860_100028059 3300005843 Bacteria 5420
82 Ga0068862_100000547 3300005844 Bacteria 39415
83 Ga0081455_10000365 3300005937 Bacteria 59750
84 Ga0081455_10000906 3300005937 Bacteria 38128
85 Ga0081455_10145213 3300005937 Bacteria 1836
86 Ga0081455_10273362 3300005937 Bacteria 1224
87 Ga0081455_10381412 3300005937 Bacteria 984
88 Ga0081539_10006295 3300005985 Bacteria 11470
89 Ga0070717_10176478 3300006028 Bacteria 1860
90 Ga0075368_10003241 3300006042 Bacteria 5418
91 Ga0075364_10024584 3300006051 Bacteria 3826
92 Ga0075364_10046044 3300006051 Bacteria 2839
93 Ga0075367_10000446 3300006178 Bacteria 15351
94 Ga0075428_100040062 3300006844 Bacteria 5156
95 Ga0075431_100012752 3300006847 Bacteria 8485
96 Ga0075431_100366397 3300006847 Bacteria 1447
97 Ga0075433_10064036 3300006852 Bacteria 3222
98 Ga0075429_100009455 3300006880 Bacteria 8460
99 Ga0075429_100662217 3300006880 Bacteria 915
100 Ga0097620_100000081 3300006931 Bacteria 87606
101 Ga0097620_100002435 3300006931 Bacteria 18946
102 Ga0097620_100012548 3300006931 Bacteria 8526
103 Ga0097620_100042851 3300006931 Bacteria 4547
104 Ga0075435_100005272 3300007076 Bacteria 9003
105 Ga0105240_10582810 3300009093 Bacteria 1234
106 Ga0111539_10524963 3300009094 Bacteria 1379
107 Ga0111539_10703407 3300009094 Bacteria 1176
108 Ga0105245_10054334 3300009098 Bacteria 3597
109 Ga0105245_10324633 3300009098 Bacteria 1517
110 Ga0105247_10000209 3300009101 Bacteria 56848
111 Ga0105247_10001558 3300009101 Bacteria 16340
112 Ga0114129_10427639 3300009147 Bacteria 1740
113 Ga0114129_11311161 3300009147 Bacteria 897
114 Ga0105248_10000884 3300009177 Bacteria 33587
115 Ga0105248_10011070 3300009177 Bacteria 9949
116 Ga0105237_10003621 3300009545 Bacteria 18248
117 Ga0105238_10718197 3300009551 Bacteria 1012
118 Ga0105249_10018007 3300009553 Bacteria 6278
119 Ga0105249_10065869 3300009553 Bacteria 3334
120 Ga0105239_10092619 3300010375 Bacteria 3336
121 Ga0105239_10141702 3300010375 Bacteria 2679
122 Ga0157369_10058214 3300013105 Bacteria 4168
123 Ga0157375_10479037 3300013308 Bacteria 1409
124 Ga0163163_10002291 3300014325 Bacteria 16160
125 Ga0163163_10388917 3300014325 Bacteria 1452
126 Ga0157379_10007178 3300014968 Bacteria 9640
127 Ga0206354_10171698 3300020081 Bacteria 1329
128 Ga0206353_11320048 3300020082 Bacteria 3068
129 Ga0213875_10003862 3300021388 Bacteria 8403
130 Ga0213875_10004667 3300021388 Bacteria 7465
131 Ga0213875_10011430 3300021388 Bacteria 4417
132 Ga0224712_10210136 3300022467 Bacteria 887
133 Ga0209437_102273 3300025233 Bacteria 3789
134 Ga0209233_1000042 3300025261 Bacteria 510519
135 Ga0209676_1008552 3300025292 Bacteria 4543
136 Ga0209025_1000055 3300025294 Bacteria 316748
137 Ga0209025_1000115 3300025294 Bacteria 218871
138 Ga0209050_1008588 3300025298 Bacteria 5412
139 Ga0209051_1000116 3300025303 Bacteria 150182
140 Ga0209051_1051012 3300025303 Bacteria 1380
141 Ga0207692_10094969 3300025898 Bacteria 1625
142 Ga0207710_10000449 3300025900 Bacteria 26704
143 Ga0207710_10001674 3300025900 Bacteria 10775
144 Ga0207710_10005821 3300025900 Bacteria 5287
145 Ga0207710_10007284 3300025900 Bacteria 4689
146 Ga0207680_10004127 3300025903 Bacteria 6871
147 Ga0207680_10048779 3300025903 Bacteria 2517
148 Ga0207699_10036944 3300025906 Bacteria 2788
149 Ga0207684_10023622 3300025910 Bacteria 5249
150 Ga0207707_10000029 3300025912 Bacteria 162223
151 Ga0207707_10109009 3300025912 Bacteria 2421
152 Ga0207707_10236245 3300025912 Bacteria 1590
153 Ga0207707_10325320 3300025912 Bacteria 1327
154 Ga0207695_10465481 3300025913 Bacteria 1147
155 Ga0207671_10003961 3300025914 Bacteria 14403
156 Ga0207660_10001708 3300025917 Bacteria 14721
157 Ga0207657_10007152 3300025919 Bacteria 11463
158 Ga0207649_10040470 3300025920 Bacteria 2833
159 Ga0207652_10000655 3300025921 Bacteria 34027
160 Ga0207652_10150298 3300025921 Bacteria 2085
161 Ga0207652_10213366 3300025921 Bacteria 1739
162 Ga0207652_10641653 3300025921 Bacteria 950
163 Ga0207646_10081545 3300025922 Bacteria 2892
164 Ga0207646_10226259 3300025922 Bacteria 1690
165 Ga0207700_10105032 3300025928 Bacteria 2261
166 Ga0207700_10360041 3300025928 Bacteria 1268
167 Ga0207700_10751161 3300025928 Bacteria 872
168 Ga0207664_10008501 3300025929 Bacteria 7166
169 Ga0207664_10041176 3300025929 Bacteria 3598
170 Ga0207664_10101770 3300025929 Bacteria 2375
171 Ga0207644_10008910 3300025931 Bacteria 6573
172 Ga0207706_10002746 3300025933 Bacteria 17108
173 Ga0207709_10318270 3300025935 Bacteria 1163
174 Ga0207704_10292695 3300025938 Bacteria 1243
175 Ga0207711_10000264 3300025941 Bacteria 57029
176 Ga0207711_10000284 3300025941 Bacteria 54200
177 Ga0207661_10071523 3300025944 Bacteria 2835
178 Ga0207661_10094623 3300025944 Bacteria 2496
179 Ga0207661_10135061 3300025944 Bacteria 2118
180 Ga0207661_10381073 3300025944 Bacteria 1276
181 Ga0207679_10025688 3300025945 Bacteria 4054
182 Ga0207679_10040623 3300025945 Bacteria 3331
183 Ga0207679_10136072 3300025945 Bacteria 1979
184 Ga0207667_10228032 3300025949 Bacteria 1908
185 Ga0207712_10002517 3300025961 Bacteria 11793
186 Ga0207712_10381652 3300025961 Bacteria 1180
187 Ga0207668_10302030 3300025972 Bacteria 1321
188 Ga0207658_10000206 3300025986 Bacteria 61427
189 Ga0207658_10000952 3300025986 Bacteria 23914
190 Ga0207658_10001006 3300025986 Bacteria 23090
191 Ga0207658_10027677 3300025986 Bacteria 3986
192 Ga0207658_10269766 3300025986 Bacteria 1454
193 Ga0207703_10000015 3300026035 Bacteria 287079
194 Ga0207703_10023177 3300026035 Bacteria 4876
195 Ga0207703_10024826 3300026035 Bacteria 4715
196 Ga0207703_10089465 3300026035 Bacteria 2586
197 Ga0207703_10320393 3300026035 Bacteria 1419
198 Ga0207678_10003869 3300026067 Bacteria 13462
199 Ga0207678_10044265 3300026067 Bacteria 3850
200 Ga0207641_10002933 3300026088 Bacteria 15422
201 Ga0207641_10007528 3300026088 Bacteria 9060
202 Ga0207641_10008125 3300026088 Bacteria 8689
203 Ga0207676_10147698 3300026095 Bacteria 2021
204 Ga0207676_10408669 3300026095 Bacteria 1270
205 Ga0207674_10059221 3300026116 Bacteria 3876
206 Ga0207674_10156265 3300026116 Bacteria 2236
207 Ga0207674_10256941 3300026116 Bacteria 1694
208 Ga0207674_10316867 3300026116 Bacteria 1509
209 Ga0207674_10360879 3300026116 Bacteria 1404
210 Ga0207674_10407868 3300026116 Bacteria 1313
211 Ga0207698_10220495 3300026142 Bacteria 1713
212 Ga0209813_10003017 3300027866 Bacteria 3907
213 Ga0268266_10000492 3300028379 Bacteria 56439
214 Ga0268266_10002209 3300028379 Bacteria 21278
215 Ga0268266_10003465 3300028379 Bacteria 15738
216 Ga0268265_10000518 3300028380 Bacteria 39429
217 Ga0268264_10000152 3300028381 Bacteria 157374
218 Ga0268264_10000220 3300028381 Bacteria 111692
219 Ga0268264_10019875 3300028381 Bacteria 5487
220 Ga0268264_10316750 3300028381 Bacteria 1474
221 Ga0307515_10048867 3300028794 Bacteria 6386
222 Ga0268256_1008888 3300030500 Bacteria 3397
223 Ga0265327_10001906 3300031251 Bacteria 24090
224 Ga0307513_10008448 3300031456 Bacteria 13175
225 Ga0307509_10006450 3300031507 Bacteria 15794
226 Ga0307514_10042700 3300031649 Bacteria 3564
227 Ga0307405_10015411 3300031731 Bacteria 4141
228 Ga0307413_10316514 3300031824 Bacteria 1190
229 Ga0307518_10020698 3300031838 Bacteria 4727
230 Ga0307518_10105941 3300031838 Bacteria 2008
231 Ga0307410_10085175 3300031852 Bacteria 2230
232 Ga0307412_10036713 3300031911 Bacteria 3142
233 Ga0307412_10079297 3300031911 Bacteria 2265
234 Ga0307409_100027582 3300031995 Bacteria 4027
235 Ga0307409_100287315 3300031995 Bacteria 1523
236 Ga0307409_100307875 3300031995 Bacteria 1477
237 Ga0307409_100491446 3300031995 Bacteria 1193
238 Ga0307416_100360459 3300032002 Bacteria 1476
239 Ga0307414_10495113 3300032004 Bacteria 1080
240 Ga0307411_10060765 3300032005 Bacteria 2512
241 Ga0307411_10598483 3300032005 Bacteria 948
242 Ga0307415_100033772 3300032126 Bacteria 3322
243 Ga0307415_100047905 3300032126 Bacteria 2880
244 Ga0307507_10222388 3300033179 Bacteria 1267
245 Ga0307510_10001944 3300033180 Bacteria 23245
246 Ga0373937_0205767 3300036401 Bacteria 1851
247 Ga0372808_002056 3300036459 Bacteria 2245
248 Ga0395905_0164302 3300037471 Bacteria 2086
249 Ga0436364_0248241 3300037853 Bacteria 6107
250 Ga0436364_0299324 3300037853 Bacteria 18043
251 Ga0436364_0712624 3300037853 Bacteria 17074
252 Ga0436364_1299779 3300037853 Bacteria 159755
253 Ga0436364_1545113 3300037853 Bacteria 8846
254 Ga0439436_0051496 3300041404 Bacteria 1163
255 Ga0439466_0011680 3300041411 Bacteria 3244
256 Ga0439464_0012717 3300042439 Bacteria 2245
257 Ga0466972_0071207 3300044658 Bacteria 1659
258 Ga0466972_0080721 3300044658 Bacteria 1549
259 Ga0466961_0028079 3300044693 Bacteria 3619
260 Ga0466963_0045891 3300044694 Bacteria 2879
261 Ga0466963_0362322 3300044694 Bacteria 1021
262 Ga0466971_0050322 3300044719 Bacteria 1875
263 Ga0466957_0032687 3300044842 Bacteria 3116
264 Ga0466960_0005889 3300044901 Bacteria 4886
265 Ga0466960_0036245 3300044901 Bacteria 2309
266 Ga0466960_0173506 3300044901 Bacteria 1165
267 Ga0466958_0057298 3300045836 Bacteria 2368
268 Ga0466958_0351080 3300045836 Bacteria 949
269 Ga0466967_0037608 3300045976 Bacteria 4143
270 Ga0466967_0042605 3300045976 Bacteria 3924
271 Ga0466967_0046127 3300045976 Bacteria 3792
272 Ga0466967_0124070 3300045976 Bacteria 2390
273 Ga0466967_0180793 3300045976 Bacteria 1989
274 Ga0466967_0222982 3300045976 Bacteria 1792
275 Ga0466967_0496016 3300045976 Bacteria 1198
276 Ga0466967_0764688 3300045976 Bacteria 958
277 Ga0466967_0864498 3300045976 Bacteria 899
278 Ga0495603_0010835 3300046455 Bacteria 5531
279 Ga0495603_0174115 3300046455 Bacteria 1246
280 Ga0495603_0264464 3300046455 Bacteria 990
281 Ga0495582_0079800 3300046473 Bacteria 1817
282 Ga0495584_0124925 3300046491 Bacteria 1304
283 Ga0495585_0010443 3300046492 Bacteria 5525
284 Ga0495594_0003695 3300046499 Bacteria 7855
285 Ga0495607_0046393 3300046501 Bacteria 2552
286 Ga0495606_0021321 3300046507 Bacteria 4747
287 Ga0495666_0002396 3300046526 Bacteria 9333
288 Ga0495640_0088348 3300046533 Bacteria 2049
289 Ga0495633_0001542 3300046558 Bacteria 17688
290 Ga0495668_0005584 3300046616 Bacteria 8457
291 Ga0495669_0001592 3300046684 Bacteria 9325
292 Ga0495624_0033151 3300046690 Bacteria 3346
293 Ga0495589_0053952 3300046794 Bacteria 1983
294 Ga0495676_0021262 3300047321 Bacteria 5669
295 Ga0495676_0176152 3300047321 Bacteria 1502
296 Ga0495683_0007957 3300047323 Bacteria 5690
297 Ga0495687_005501 3300047443 Bacteria 8048
298 Ga0495687_035492 3300047443 Bacteria 2241
299 Ga0495685_004610 3300047447 Bacteria 4465
300 Ga0495614_0016005 3300048089 Bacteria 3266
301 Ga0496100_0000095 3300048903 Bacteria 50413
302 Ga0496100_0002953 3300048903 Bacteria 8745
303 Ga0496100_0009066 3300048903 Bacteria 5576
304 Ga0496100_0382638 3300048903 Bacteria 1069
305 Ga0496100_0496309 3300048903 Bacteria 940
306 Ga0496101_0000027 3300048904 Bacteria 199664
307 Ga0496101_0018977 3300048904 Bacteria 4686
308 Ga0496101_0137186 3300048904 Bacteria 1862
309 Ga0496101_0423733 3300048904 Bacteria 1049
310 Ga0496102_0000020 3300048905 Bacteria 260823
311 Ga0496102_0000111 3300048905 Bacteria 117001
312 Ga0496102_0000171 3300048905 Bacteria 87903
313 Ga0496102_0000190 3300048905 Bacteria 83444
314 Ga0496102_0003706 3300048905 Bacteria 12918
315 Ga0496102_0392090 3300048905 Bacteria 1306
316 Ga0496102_0507361 3300048905 Bacteria 1128
317 Ga0496103_0000030 3300048906 Bacteria 211729
318 Ga0496103_0000088 3300048906 Bacteria 104382
319 Ga0496103_0000125 3300048906 Bacteria 83408
320 Ga0496103_0000226 3300048906 Bacteria 54762
321 Ga0496103_0000871 3300048906 Bacteria 21931
322 Ga0496104_0025984 3300048907 Bacteria 5400
323 Ga0496104_0040259 3300048907 Bacteria 4380
324 Ga0496104_0387229 3300048907 Bacteria 1310
325 Ga0496104_0474473 3300048907 Bacteria 1162
326 Ga0496105_0121420 3300048908 Bacteria 2154
327 Ga0496105_0183050 3300048908 Bacteria 1715
328 Ga0496106_0000413 3300048909 Bacteria 30337
329 Ga0496106_0344036 3300048909 Bacteria 1198
330 Ga0496107_0000304 3300048910 Bacteria 26272
331 Ga0496107_0013929 3300048910 Bacteria 5625
332 Ga0496107_0032123 3300048910 Bacteria 3751
333 Ga0496108_0004308 3300048911 Bacteria 11444
334 Ga0496108_0115454 3300048911 Bacteria 2299
335 Ga0496109_0000407 3300048912 Bacteria 38371
336 Ga0496109_0576754 3300048912 Bacteria 1060
337 Ga0496110_0003553 3300048913 Bacteria 11972
338 Ga0496110_0031115 3300048913 Bacteria 4603
339 Ga0496110_0079377 3300048913 Bacteria 2922
340 Ga0496110_0138986 3300048913 Bacteria 2196
341 Ga0496111_0008490 3300048914 Bacteria 6802
342 Ga0496112_0204888 3300048915 Bacteria 1931
343 Ga0496112_0215096 3300048915 Bacteria 1878
344 Ga0496113_0038582 3300048916 Bacteria 3513
345 Ga0496114_0000282 3300048917 Bacteria 37014
346 Ga0496114_0477272 3300048917 Bacteria 1103
347 Ga0496115_0014824 3300048918 Bacteria 5912
348 Ga0496115_0059617 3300048918 Bacteria 3074
349 Ga0496116_0000067 3300048919 Bacteria 260793
350 Ga0496116_0000337 3300048919 Bacteria 75447
351 Ga0496116_0002036 3300048919 Bacteria 21684
352 Ga0496116_0004224 3300048919 Bacteria 13805
353 Ga0496117_0000149 3300048920 Bacteria 149137
354 Ga0496117_0000170 3300048920 Bacteria 136272
355 Ga0496117_0000313 3300048920 Bacteria 84841
356 Ga0496117_0005400 3300048920 Bacteria 13447
357 Ga0496118_0000049 3300048921 Bacteria 251875
358 Ga0496118_0000308 3300048921 Bacteria 84829
359 Ga0496118_0000337 3300048921 Bacteria 80147
360 Ga0496118_0018942 3300048921 Bacteria 6172
361 Ga0496118_0019586 3300048921 Bacteria 6041
362 Ga0496118_0044396 3300048921 Bacteria 3481
363 Ga0496118_0051972 3300048921 Bacteria 3131
364 Ga0496119_0001985 3300048922 Bacteria 23212
365 Ga0496119_0004562 3300048922 Bacteria 13703
366 Ga0496119_0008598 3300048922 Bacteria 8941
367 Ga0496119_0011159 3300048922 Bacteria 7481
368 Ga0496119_0025811 3300048922 Bacteria 4093
369 Ga0496119_0042601 3300048922 Bacteria 2877
370 Ga0496120_0004741 3300048923 Bacteria 11165
371 Ga0496120_0008130 3300048923 Bacteria 7695
372 Ga0496120_0009211 3300048923 Bacteria 7031
373 Ga0496120_0062871 3300048923 Bacteria 2067
374 Ga0496121_0000004 3300048924 Bacteria 1139011
375 Ga0496121_0001602 3300048924 Bacteria 37551
376 Ga0496121_0012251 3300048924 Bacteria 9390
377 Ga0496121_0021330 3300048924 Bacteria 6351
378 Ga0496121_0030413 3300048924 Bacteria 4959
379 Ga0496121_0038895 3300048924 Bacteria 4202
380 Ga0496121_0041540 3300048924 Bacteria 4017
381 Ga0496122_0000763 3300048925 Bacteria 62213
382 Ga0496122_0159958 3300048925 Bacteria 1375
383 Ga0496122_0289244 3300048925 Bacteria 891
384 Ga0496123_0019687 3300048926 Bacteria 5313
385 Ga0496123_0086287 3300048926 Bacteria 1884
386 Ga0496124_0000030 3300048927 Bacteria 351350
387 Ga0496124_0000330 3300048927 Bacteria 87622
388 Ga0496124_0029837 3300048927 Bacteria 4851
389 Ga0496124_0051701 3300048927 Bacteria 3494
390 Ga0496125_0000003 3300048928 Bacteria 1189767
391 Ga0496125_0015580 3300048928 Bacteria 7341
392 Ga0496125_0021713 3300048928 Bacteria 5976
393 Ga0496126_0000001 3300048929 Bacteria 1139011
394 Ga0496126_0000006 3300048929 Bacteria 798804
395 Ga0496126_0000080 3300048929 Bacteria 221672
396 Ga0496126_0000514 3300048929 Bacteria 75337
397 Ga0496126_0000999 3300048929 Bacteria 48191
398 Ga0496126_0013957 3300048929 Bacteria 8146
399 Ga0496126_0157000 3300048929 Bacteria 1946
400 Ga0496126_0255822 3300048929 Bacteria 1458
401 Ga0496126_0338289 3300048929 Bacteria 1233
402 Ga0501031_0000531 3300049568 Bacteria 22307
403 Ga0501032_0002291 3300049569 Bacteria 15023
404 Ga0501032_0035594 3300049569 Bacteria 3402
405 Ga0501033_0001475 3300049570 Bacteria 20815
406 Ga0501033_0017275 3300049570 Bacteria 5452
407 Ga0501034_0000335 3300049571 Bacteria 82157
408 Ga0501034_0153988 3300049571 Bacteria 2273
409 Ga0501036_0013995 3300049572 Bacteria 6667
410 Ga0501037_0000892 3300049573 Bacteria 22278
411 Ga0501037_0047673 3300049573 Bacteria 3139
412 Ga0501038_0006082 3300049574 Bacteria 11166
413 Ga0501038_0496733 3300049574 Bacteria 933
414 Ga0501042_0438070 3300049578 Bacteria 947
415 Ga0501043_0001450 3300049579 Bacteria 20716
416 Ga0501043_0088622 3300049579 Bacteria 2432
417 Ga0501046_0001496 3300049580 Bacteria 22390
418 Ga0501047_0001572 3300049581 Bacteria 22294
419 Ga0501047_0010522 3300049581 Bacteria 8750
420 Ga0501048_0002344 3300049582 Bacteria 14454
421 Ga0501069_0001445 3300049585 Bacteria 11667
422 Ga0501069_0142384 3300049585 Bacteria 1375
423 Ga0501069_0365915 3300049585 Bacteria 851
424 Ga0501070_0000325 3300049586 Bacteria 43267
425 Ga0501070_0001310 3300049586 Bacteria 22281
426 Ga0501070_0006844 3300049586 Bacteria 9701
427 Ga0501070_0009183 3300049586 Bacteria 8358
428 Ga0501070_0013263 3300049586 Bacteria 6948
429 Ga0501070_0168212 3300049586 Bacteria 1806
430 Ga0501073_0024949 3300049589 Bacteria 4290
431 Ga0501073_0033685 3300049589 Bacteria 3646
432 Ga0501074_0030841 3300049590 Bacteria 3884
433 Ga0501074_0032057 3300049590 Bacteria 3809
434 Ga0501079_0001063 3300049741 Bacteria 19093
435 Ga0501079_0001277 3300049741 Bacteria 17674
436 Ga0501080_0000096 3300049742 Bacteria 59454
437 Ga0501080_0019093 3300049742 Bacteria 6347
438 Ga0501080_0272048 3300049742 Bacteria 1541
439 Ga0501080_0354659 3300049742 Bacteria 1324
440 Ga0501083_0010515 3300049744 Bacteria 6511
441 Ga0501035_0001636 3300049822 Bacteria 22643
442 Ga0501035_0147265 3300049822 Bacteria 2044
443 Ga0501044_0000201 3300049823 Bacteria 75685
444 Ga0501044_0002493 3300049823 Bacteria 21004
445 Ga0501044_0002899 3300049823 Bacteria 19530
446 Ga0501044_0065517 3300049823 Bacteria 3705
447 nmdc:mga00v17_155802_c1 3300050491 Bacteria 1469
448 nmdc:mga00v17_49838_c1 3300050491 Bacteria 2542
449 nmdc:mga06z11_1130_c1 3300050494 Bacteria 9719
450 nmdc:mga04h51_3309_c1 3300050495 Bacteria 3907
451 nmdc:mga09592_196719_c1 3300050508 Bacteria 1745
452 nmdc:mga09592_365_c1 3300050508 Bacteria 33116
453 nmdc:mga09592_43503_c1 3300050508 Bacteria 3780
454 nmdc:mga0qj67_231422_c1 3300050509 Bacteria 1499
455 nmdc:mga06r32_415124_c1 3300050510 Bacteria 1327
456 nmdc:mga06r32_88493_c1 3300050510 Bacteria 3023
457 nmdc:mga0n895_55775_c1 3300050512 Bacteria 3890
458 nmdc:mga0rr50_33011_c1 3300050513 Bacteria 3695
459 nmdc:mga08x19_7962_c1 3300050514 Bacteria 6296
460 nmdc:mga0a205_27687_c1 3300050515 Bacteria 5414
461 Ga0500593_000020 3300053117 Bacteria 54324
462 Ga0500568_0000763 3300053139 Bacteria 22859
463 Ga0500616_0000220 3300053153 Bacteria 89104
464 Ga0466962_0161212 3300061719 Bacteria 1090

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0764688 Ga0466967_0764688_277_948 222
2 3300048929 Ga0496126_0013957 Ga0496126_0013957_6578_7342 237
3 3300044694 Ga0466963_0362322 Ga0466963_0362322_78_842 238
4 3300045976 Ga0466967_0864498 Ga0466967_0864498_20_784 238
5 3300025921 Ga0207652_10641653 Ga0207652_106416531 239
6 3300028381 Ga0268264_10316750 Ga0268264_103167502 240
7 3300053117 Ga0500593_000020 Ga0500593_000020_52957_53697 244
8 3300005536 Ga0070697_100075606 Ga0070697_1000756061 245
9 3300006844 Ga0075428_100040062 Ga0075428_1000400622 245
10 3300006847 Ga0075431_100012752 Ga0075431_1000127522 245
11 3300006852 Ga0075433_10064036 Ga0075433_100640362 245
12 3300006880 Ga0075429_100009455 Ga0075429_1000094554 245
13 3300006880 Ga0075429_100662217 Ga0075429_1006622171 245
14 3300007076 Ga0075435_100005272 Ga0075435_1000052726 245
15 3300025922 Ga0207646_10081545 Ga0207646_100815452 245
16 3300028794 Ga0307515_10048867 Ga0307515_100488672 245
17 3300031456 Ga0307513_10008448 Ga0307513_100084484 245
18 3300031649 Ga0307514_10042700 Ga0307514_100427003 245
19 3300005435 Ga0070714_100221569 Ga0070714_1002215692 247
20 3300005436 Ga0070713_100077749 Ga0070713_1000777491 247
21 3300025928 Ga0207700_10751161 Ga0207700_107511611 247
22 3300009094 Ga0111539_10703407 Ga0111539_107034072 248
23 3300025921 Ga0207652_10213366 Ga0207652_102133662 248
24 3300036401 Ga0373937_0205767 Ga0373937_0205767_794_1558 248
25 iso_pu_bacteria 2643221715 2644636036 248
26 iso_pu_bacteria 2902810491 2902815549 248
27 3300005937 Ga0081455_10381412 Ga0081455_103814121 249
28 3300009094 Ga0111539_10524963 Ga0111539_105249632 249
29 3300049590 Ga0501074_0030841 Ga0501074_0030841_43_795 249
30 iso_pu_bacteria 2513237150 2513957259 249
31 iso_pu_bacteria 2513237165 2514045518 249
32 iso_pu_bacteria 2515154189 2516024379 249
33 iso_pu_bacteria 2579778521 2579852390 249
34 iso_pu_bacteria 2619618881 2619855699 249
35 iso_pu_bacteria 2619619003 2620348138 249
36 iso_pu_bacteria 2626541554 2626635104 249
37 iso_pu_bacteria 2643221569 2643862716 249
38 iso_pu_bacteria 2643221594 2643980279 249
39 iso_pu_bacteria 2643221621 2644124756 249
40 iso_pu_bacteria 2671180195 2671836909 249
41 iso_pu_bacteria 2773857922 2774855065 249
42 iso_pu_bacteria 2791355406 2793977598 249
43 iso_pu_bacteria 2808606359 2808848572 249
44 iso_pu_bacteria 2808606395 2809032408 249
45 iso_pu_bacteria 2855730933 2855736298 249
46 iso_pu_bacteria 2855767633 2855773235 249
47 iso_pu_bacteria 2857542790 2857544756 249
48 iso_pu_bacteria 2858950400 2858952803 249
49 iso_pu_bacteria 2866552031 2866554295 249
50 iso_pu_bacteria 2870782633 2870790605 249
51 iso_pu_bacteria 2881412998 2881417327 249
52 iso_pu_bacteria 2899370129 2899376772 249
53 iso_pu_bacteria 2932422444 2932423074 249
54 iso_pu_bacteria 644736347 644747889 249
55 iso_pu_bacteria 8004212874 8004215484 249
56 iso_pu_bacteria 8023680758 8023683567 249
57 iso_pu_bacteria 8047893842 8047903130 249
58 iso_pu_bacteria 8048356638 8048365710 249
59 iso_pu_bacteria 8048369669 8048379429 249
60 iso_pu_bacteria 8048379754 8048389974 249
61 iso_pu_bacteria 8054913762 8054916519 249
62 iso_pu_bacteria 8054920844 8054924770 249
63 3300005335 Ga0070666_10065583 Ga0070666_100655832 250
64 3300005335 Ga0070666_10141809 Ga0070666_101418092 250
65 3300005355 Ga0070671_100001125 Ga0070671_10000112511 250
66 3300005367 Ga0070667_100110363 Ga0070667_1001103633 250
67 3300005445 Ga0070708_100009136 Ga0070708_1000091365 250
68 3300005467 Ga0070706_100010812 Ga0070706_1000108123 250
69 3300005468 Ga0070707_100094179 Ga0070707_1000941792 250
70 3300005471 Ga0070698_100005870 Ga0070698_1000058702 250
71 3300005518 Ga0070699_100046766 Ga0070699_1000467662 250
72 3300005518 Ga0070699_100266237 Ga0070699_1002662372 250
73 3300005536 Ga0070697_100029590 Ga0070697_1000295902 250
74 3300005548 Ga0070665_100002036 Ga0070665_10000203620 250
75 3300005843 Ga0068860_100006385 Ga0068860_1000063859 250
76 3300005937 Ga0081455_10273362 Ga0081455_102733622 250
77 3300006847 Ga0075431_100366397 Ga0075431_1003663972 250
78 3300009147 Ga0114129_10427639 Ga0114129_104276391 250
79 3300009147 Ga0114129_11311161 Ga0114129_113111612 250
80 3300009551 Ga0105238_10718197 Ga0105238_107181971 250
81 3300010375 Ga0105239_10092619 Ga0105239_100926192 250
82 3300025903 Ga0207680_10004127 Ga0207680_100041276 250
83 3300025910 Ga0207684_10023622 Ga0207684_100236224 250
84 3300025913 Ga0207695_10465481 Ga0207695_104654811 250
85 3300025922 Ga0207646_10226259 Ga0207646_102262592 250
86 3300025931 Ga0207644_10008910 Ga0207644_100089103 250
87 3300025986 Ga0207658_10001006 Ga0207658_100010062 250
88 3300025986 Ga0207658_10269766 Ga0207658_102697662 250
89 3300028379 Ga0268266_10000492 Ga0268266_1000049226 250
90 3300028379 Ga0268266_10003465 Ga0268266_100034653 250
91 3300033179 Ga0307507_10222388 Ga0307507_102223881 250
92 3300046491 Ga0495584_0124925 Ga0495584_0124925_35_808 250
93 3300048907 Ga0496104_0025984 Ga0496104_0025984_1679_2440 250
94 3300048908 Ga0496105_0121420 Ga0496105_0121420_780_1541 250
95 3300048910 Ga0496107_0013929 Ga0496107_0013929_344_1105 250
96 3300048922 Ga0496119_0008598 Ga0496119_0008598_5226_5987 250
97 3300048924 Ga0496121_0021330 Ga0496121_0021330_635_1396 250
98 3300049568 Ga0501031_0000531 Ga0501031_0000531_11269_12030 250
99 3300049569 Ga0501032_0002291 Ga0501032_0002291_9662_10423 250
100 3300049570 Ga0501033_0001475 Ga0501033_0001475_9724_10485 250
101 3300049571 Ga0501034_0153988 Ga0501034_0153988_1484_2245 250
102 3300049572 Ga0501036_0013995 Ga0501036_0013995_110_871 250
103 3300049573 Ga0501037_0000892 Ga0501037_0000892_11234_11995 250
104 3300049574 Ga0501038_0006082 Ga0501038_0006082_128_889 250
105 3300049579 Ga0501043_0001450 Ga0501043_0001450_10286_11047 250
106 3300049580 Ga0501046_0001496 Ga0501046_0001496_10415_11176 250
107 3300049581 Ga0501047_0001572 Ga0501047_0001572_10300_11061 250
108 3300049582 Ga0501048_0002344 Ga0501048_0002344_10269_11030 250
109 3300049585 Ga0501069_0142384 Ga0501069_0142384_578_1339 250
110 3300049586 Ga0501070_0001310 Ga0501070_0001310_10287_11048 250
111 3300049589 Ga0501073_0024949 Ga0501073_0024949_3090_3851 250
112 3300049741 Ga0501079_0001063 Ga0501079_0001063_9281_10042 250
113 3300049742 Ga0501080_0019093 Ga0501080_0019093_5541_6302 250
114 3300049744 Ga0501083_0010515 Ga0501083_0010515_5677_6438 250
115 3300049822 Ga0501035_0001636 Ga0501035_0001636_10649_11410 250
116 3300049823 Ga0501044_0002493 Ga0501044_0002493_9729_10490 250
117 3300050508 nmdc:mga09592_196719_c1 nmdc:mga09592_196719_c1_86_859 250
118 3300050508 nmdc:mga09592_43503_c1 nmdc:mga09592_43503_c1_1652_2425 250
119 3300050509 nmdc:mga0qj67_231422_c1 nmdc:mga0qj67_231422_c1_544_1317 250
120 3300050510 nmdc:mga06r32_415124_c1 nmdc:mga06r32_415124_c1_384_1157 250
121 3300050510 nmdc:mga06r32_88493_c1 nmdc:mga06r32_88493_c1_739_1512 250
122 3300050512 nmdc:mga0n895_55775_c1 nmdc:mga0n895_55775_c1_1554_2327 250
123 3300050513 nmdc:mga0rr50_33011_c1 nmdc:mga0rr50_33011_c1_1382_2155 250
124 3300050514 nmdc:mga08x19_7962_c1 nmdc:mga08x19_7962_c1_1994_2767 250
125 3300050515 nmdc:mga0a205_27687_c1 nmdc:mga0a205_27687_c1_1215_1988 250
126 3300003214 JGI25165J46597_1000038 JGI25165J46597_1000038150 251
127 3300003792 Ga0055540_1000102 Ga0055540_100010273 251
128 3300005335 Ga0070666_10065669 Ga0070666_100656692 251
129 3300005367 Ga0070667_100007148 Ga0070667_1000071482 251
130 3300005842 Ga0068858_100510939 Ga0068858_1005109391 251
131 3300009545 Ga0105237_10003621 Ga0105237_100036219 251
132 3300025233 Ga0209437_102273 Ga0209437_1022732 251
133 3300025261 Ga0209233_1000042 Ga0209233_1000042271 251
134 3300025303 Ga0209051_1000116 Ga0209051_100011613 251
135 3300025903 Ga0207680_10048779 Ga0207680_100487792 251
136 3300025914 Ga0207671_10003961 Ga0207671_100039615 251
137 3300025986 Ga0207658_10000206 Ga0207658_1000020610 251
138 3300026035 Ga0207703_10089465 Ga0207703_100894651 251
139 3300031251 Ga0265327_10001906 Ga0265327_1000190610 251
140 3300044658 Ga0466972_0071207 Ga0466972_0071207_29_823 251
141 3300045976 Ga0466967_0046127 Ga0466967_0046127_2795_3589 251
142 3300048903 Ga0496100_0000095 Ga0496100_0000095_16208_17002 251
143 3300048904 Ga0496101_0000027 Ga0496101_0000027_173230_174024 251
144 3300048905 Ga0496102_0003706 Ga0496102_0003706_2940_3734 251
145 3300048906 Ga0496103_0000226 Ga0496103_0000226_34512_35306 251
146 3300048909 Ga0496106_0000413 Ga0496106_0000413_12333_13127 251
147 3300048910 Ga0496107_0000304 Ga0496107_0000304_25343_26137 251
148 3300048911 Ga0496108_0004308 Ga0496108_0004308_8164_8958 251
149 3300048912 Ga0496109_0000407 Ga0496109_0000407_28786_29580 251
150 3300048913 Ga0496110_0003553 Ga0496110_0003553_5073_5867 251
151 3300048914 Ga0496111_0008490 Ga0496111_0008490_5130_5924 251
152 3300048917 Ga0496114_0000282 Ga0496114_0000282_25029_25823 251
153 3300048918 Ga0496115_0014824 Ga0496115_0014824_4957_5751 251
154 3300048919 Ga0496116_0002036 Ga0496116_0002036_6295_7089 251
155 3300048920 Ga0496117_0005400 Ga0496117_0005400_6359_7153 251
156 3300048921 Ga0496118_0019586 Ga0496118_0019586_2180_2974 251
157 3300048922 Ga0496119_0001985 Ga0496119_0001985_8502_9296 251
158 3300048923 Ga0496120_0004741 Ga0496120_0004741_8545_9339 251
159 3300048924 Ga0496121_0000004 Ga0496121_0000004_907474_908268 251
160 3300048925 Ga0496122_0000763 Ga0496122_0000763_32637_33431 251
161 3300048926 Ga0496123_0019687 Ga0496123_0019687_282_1076 251
162 3300048927 Ga0496124_0000030 Ga0496124_0000030_119813_120607 251
163 3300048928 Ga0496125_0000003 Ga0496125_0000003_281500_282294 251
164 3300048929 Ga0496126_0000001 Ga0496126_0000001_907474_908268 251
165 iso_pu_bacteria 2684623035 2686534273 251
166 iso_pu_bacteria 2738541264 2738664964 251
167 iso_pu_bacteria 2738541356 2739144098 251
168 iso_pu_bacteria 2895880812 2895887991 251
169 3300005353 Ga0070669_100000494 Ga0070669_1000004946 252
170 3300005367 Ga0070667_100000313 Ga0070667_10000031323 252
171 3300005445 Ga0070708_100235451 Ga0070708_1002354512 252
172 3300005471 Ga0070698_100001029 Ga0070698_10000102918 252
173 3300005548 Ga0070665_100006283 Ga0070665_1000062836 252
174 3300005617 Ga0068859_100000081 Ga0068859_10000008159 252
175 3300005617 Ga0068859_100002435 Ga0068859_10000243514 252
176 3300005618 Ga0068864_100124957 Ga0068864_1001249572 252
177 3300005842 Ga0068858_100009809 Ga0068858_1000098093 252
178 3300005843 Ga0068860_100000227 Ga0068860_10000022759 252
179 3300005937 Ga0081455_10145213 Ga0081455_101452132 252
180 3300006051 Ga0075364_10046044 Ga0075364_100460442 252
181 3300006931 Ga0097620_100000081 Ga0097620_10000008159 252
182 3300006931 Ga0097620_100002435 Ga0097620_1000024357 252
183 3300009093 Ga0105240_10582810 Ga0105240_105828102 252
184 3300009098 Ga0105245_10324633 Ga0105245_103246332 252
185 3300009101 Ga0105247_10000209 Ga0105247_1000020913 252
186 3300009177 Ga0105248_10000884 Ga0105248_1000088424 252
187 3300025900 Ga0207710_10000449 Ga0207710_1000044927 252
188 3300025929 Ga0207664_10041176 Ga0207664_100411762 252
189 3300025941 Ga0207711_10000264 Ga0207711_1000026429 252
190 3300025986 Ga0207658_10000952 Ga0207658_100009522 252
191 3300026035 Ga0207703_10023177 Ga0207703_100231774 252
192 3300028379 Ga0268266_10002209 Ga0268266_1000220915 252
193 3300028381 Ga0268264_10000152 Ga0268264_1000015235 252
194 3300028381 Ga0268264_10000220 Ga0268264_10000220114 252
195 3300031731 Ga0307405_10015411 Ga0307405_100154112 252
196 3300031911 Ga0307412_10036713 Ga0307412_100367132 252
197 3300032005 Ga0307411_10598483 Ga0307411_105984831 252
198 3300037853 Ga0436364_0248241 Ga0436364_0248241_3041_3802 252
199 3300041411 Ga0439466_0011680 Ga0439466_0011680_2312_3073 252
200 3300044694 Ga0466963_0045891 Ga0466963_0045891_1024_1788 252
201 3300044719 Ga0466971_0050322 Ga0466971_0050322_50_814 252
202 3300044842 Ga0466957_0032687 Ga0466957_0032687_814_1578 252
203 3300044901 Ga0466960_0173506 Ga0466960_0173506_344_1108 252
204 3300045976 Ga0466967_0037608 Ga0466967_0037608_3062_3826 252
205 3300045976 Ga0466967_0222982 Ga0466967_0222982_205_969 252
206 3300046533 Ga0495640_0088348 Ga0495640_0088348_1237_1998 252
207 3300048903 Ga0496100_0382638 Ga0496100_0382638_42_815 252
208 3300048905 Ga0496102_0000171 Ga0496102_0000171_26867_27628 252
209 3300048906 Ga0496103_0000871 Ga0496103_0000871_14977_15738 252
210 3300048915 Ga0496112_0215096 Ga0496112_0215096_236_997 252
211 3300048916 Ga0496113_0038582 Ga0496113_0038582_664_1425 252
212 3300048919 Ga0496116_0004224 Ga0496116_0004224_3483_4244 252
213 3300048920 Ga0496117_0000149 Ga0496117_0000149_114235_114996 252
214 3300048921 Ga0496118_0000049 Ga0496118_0000049_136880_137641 252
215 3300048923 Ga0496120_0062871 Ga0496120_0062871_910_1677 252
216 3300048926 Ga0496123_0086287 Ga0496123_0086287_904_1665 252
217 3300048927 Ga0496124_0000330 Ga0496124_0000330_26975_27736 252
218 3300048929 Ga0496126_0157000 Ga0496126_0157000_235_996 252
219 3300050491 nmdc:mga00v17_49838_c1 nmdc:mga00v17_49838_c1_450_1211 252
220 3300053139 Ga0500568_0000763 Ga0500568_0000763_31_795 252
221 3300053153 Ga0500616_0000220 Ga0500616_0000220_42984_43748 252
222 3300001990 JGI24737J22298_10027390 JGI24737J22298_100273901 253
223 3300003187 JGI25151J46595_10001424 JGI25151J46595_100014243 253
224 3300003187 JGI25151J46595_10022718 JGI25151J46595_100227181 253
225 3300005327 Ga0070658_10103876 Ga0070658_101038763 253
226 3300005329 Ga0070683_100047848 Ga0070683_1000478482 253
227 3300005329 Ga0070683_100063434 Ga0070683_1000634345 253
228 3300005329 Ga0070683_100139557 Ga0070683_1001395573 253
229 3300005329 Ga0070683_100296588 Ga0070683_1002965882 253
230 3300005329 Ga0070683_100469672 Ga0070683_1004696721 253
231 3300005331 Ga0070670_100044717 Ga0070670_1000447175 253
232 3300005336 Ga0070680_100003872 Ga0070680_1000038725 253
233 3300005336 Ga0070680_100275486 Ga0070680_1002754862 253
234 3300005339 Ga0070660_100006063 Ga0070660_1000060636 253
235 3300005344 Ga0070661_100060445 Ga0070661_1000604452 253
236 3300005366 Ga0070659_100012617 Ga0070659_1000126175 253
237 3300005434 Ga0070709_10011965 Ga0070709_100119654 253
238 3300005435 Ga0070714_100018744 Ga0070714_1000187446 253
239 3300005435 Ga0070714_100026592 Ga0070714_1000265923 253
240 3300005435 Ga0070714_100145613 Ga0070714_1001456133 253
241 3300005436 Ga0070713_100303906 Ga0070713_1003039062 253
242 3300005455 Ga0070663_100068731 Ga0070663_1000687312 253
243 3300005456 Ga0070678_100583515 Ga0070678_1005835152 253
244 3300005457 Ga0070662_100003140 Ga0070662_1000031409 253
245 3300005458 Ga0070681_10000022 Ga0070681_1000002275 253
246 3300005458 Ga0070681_10133474 Ga0070681_101334741 253
247 3300005458 Ga0070681_10150480 Ga0070681_101504803 253
248 3300005458 Ga0070681_10498441 Ga0070681_104984411 253
249 3300005530 Ga0070679_100000004 Ga0070679_100000004118 253
250 3300005530 Ga0070679_100108378 Ga0070679_1001083782 253
251 3300005530 Ga0070679_100127139 Ga0070679_1001271391 253
252 3300005535 Ga0070684_100045717 Ga0070684_1000457172 253
253 3300005535 Ga0070684_100228282 Ga0070684_1002282822 253
254 3300005535 Ga0070684_100319105 Ga0070684_1003191052 253
255 3300005563 Ga0068855_101018652 Ga0068855_1010186521 253
256 3300005564 Ga0070664_100003085 Ga0070664_10000308513 253
257 3300005564 Ga0070664_100039423 Ga0070664_1000394232 253
258 3300005577 Ga0068857_100043813 Ga0068857_1000438134 253
259 3300005577 Ga0068857_100046439 Ga0068857_1000464392 253
260 3300005577 Ga0068857_100333855 Ga0068857_1003338552 253
261 3300005577 Ga0068857_100345145 Ga0068857_1003451452 253
262 3300005617 Ga0068859_100012548 Ga0068859_1000125486 253
263 3300005617 Ga0068859_100042851 Ga0068859_1000428512 253
264 3300005618 Ga0068864_100017914 Ga0068864_1000179142 253
265 3300005618 Ga0068864_100323525 Ga0068864_1003235251 253
266 3300005841 Ga0068863_100000419 Ga0068863_10000041917 253
267 3300005841 Ga0068863_100009985 Ga0068863_1000099858 253
268 3300005841 Ga0068863_100012171 Ga0068863_1000121716 253
269 3300005842 Ga0068858_100000789 Ga0068858_10000078930 253
270 3300005842 Ga0068858_100022009 Ga0068858_1000220095 253
271 3300005843 Ga0068860_100028059 Ga0068860_1000280593 253
272 3300005844 Ga0068862_100000547 Ga0068862_10000054723 253
273 3300005937 Ga0081455_10000365 Ga0081455_1000036530 253
274 3300005937 Ga0081455_10000906 Ga0081455_100009064 253
275 3300005985 Ga0081539_10006295 Ga0081539_100062954 253
276 3300006028 Ga0070717_10176478 Ga0070717_101764783 253
277 3300006042 Ga0075368_10003241 Ga0075368_100032413 253
278 3300006051 Ga0075364_10024584 Ga0075364_100245844 253
279 3300006178 Ga0075367_10000446 Ga0075367_100004464 253
280 3300006931 Ga0097620_100012548 Ga0097620_1000125485 253
281 3300006931 Ga0097620_100042851 Ga0097620_1000428512 253
282 3300009098 Ga0105245_10054334 Ga0105245_100543343 253
283 3300009101 Ga0105247_10001558 Ga0105247_1000155818 253
284 3300009177 Ga0105248_10011070 Ga0105248_100110707 253
285 3300009553 Ga0105249_10018007 Ga0105249_100180077 253
286 3300009553 Ga0105249_10065869 Ga0105249_100658695 253
287 3300010375 Ga0105239_10141702 Ga0105239_101417022 253
288 3300013105 Ga0157369_10058214 Ga0157369_100582144 253
289 3300013308 Ga0157375_10479037 Ga0157375_104790372 253
290 3300014325 Ga0163163_10002291 Ga0163163_1000229115 253
291 3300014325 Ga0163163_10388917 Ga0163163_103889172 253
292 3300014968 Ga0157379_10007178 Ga0157379_100071783 253
293 3300020081 Ga0206354_10171698 Ga0206354_101716981 253
294 3300020082 Ga0206353_11320048 Ga0206353_113200483 253
295 3300021388 Ga0213875_10003862 Ga0213875_100038626 253
296 3300021388 Ga0213875_10004667 Ga0213875_100046676 253
297 3300021388 Ga0213875_10011430 Ga0213875_100114302 253
298 3300022467 Ga0224712_10210136 Ga0224712_102101361 253
299 3300025292 Ga0209676_1008552 Ga0209676_10085523 253
300 3300025294 Ga0209025_1000055 Ga0209025_1000055160 253
301 3300025294 Ga0209025_1000115 Ga0209025_1000115129 253
302 3300025298 Ga0209050_1008588 Ga0209050_10085884 253
303 3300025303 Ga0209051_1051012 Ga0209051_10510121 253
304 3300025898 Ga0207692_10094969 Ga0207692_100949692 253
305 3300025900 Ga0207710_10001674 Ga0207710_1000167412 253
306 3300025900 Ga0207710_10005821 Ga0207710_100058214 253
307 3300025900 Ga0207710_10007284 Ga0207710_100072844 253
308 3300025906 Ga0207699_10036944 Ga0207699_100369444 253
309 3300025912 Ga0207707_10000029 Ga0207707_1000002910 253
310 3300025912 Ga0207707_10109009 Ga0207707_101090092 253
311 3300025912 Ga0207707_10236245 Ga0207707_102362452 253
312 3300025912 Ga0207707_10325320 Ga0207707_103253202 253
313 3300025917 Ga0207660_10001708 Ga0207660_1000170812 253
314 3300025919 Ga0207657_10007152 Ga0207657_100071527 253
315 3300025920 Ga0207649_10040470 Ga0207649_100404703 253
316 3300025921 Ga0207652_10000655 Ga0207652_100006556 253
317 3300025921 Ga0207652_10150298 Ga0207652_101502982 253
318 3300025928 Ga0207700_10105032 Ga0207700_101050322 253
319 3300025928 Ga0207700_10360041 Ga0207700_103600411 253
320 3300025929 Ga0207664_10008501 Ga0207664_100085017 253
321 3300025929 Ga0207664_10101770 Ga0207664_101017703 253
322 3300025933 Ga0207706_10002746 Ga0207706_1000274613 253
323 3300025935 Ga0207709_10318270 Ga0207709_103182701 253
324 3300025938 Ga0207704_10292695 Ga0207704_102926952 253
325 3300025941 Ga0207711_10000284 Ga0207711_1000028431 253
326 3300025944 Ga0207661_10071523 Ga0207661_100715233 253
327 3300025944 Ga0207661_10094623 Ga0207661_100946232 253
328 3300025944 Ga0207661_10135061 Ga0207661_101350612 253
329 3300025944 Ga0207661_10381073 Ga0207661_103810732 253
330 3300025945 Ga0207679_10025688 Ga0207679_100256882 253
331 3300025945 Ga0207679_10040623 Ga0207679_100406233 253
332 3300025945 Ga0207679_10136072 Ga0207679_101360723 253
333 3300025949 Ga0207667_10228032 Ga0207667_102280321 253
334 3300025961 Ga0207712_10002517 Ga0207712_100025175 253
335 3300025961 Ga0207712_10381652 Ga0207712_103816521 253
336 3300025972 Ga0207668_10302030 Ga0207668_103020302 253
337 3300025986 Ga0207658_10027677 Ga0207658_100276772 253
338 3300026035 Ga0207703_10000015 Ga0207703_10000015193 253
339 3300026035 Ga0207703_10024826 Ga0207703_100248264 253
340 3300026035 Ga0207703_10320393 Ga0207703_103203932 253
341 3300026067 Ga0207678_10003869 Ga0207678_1000386911 253
342 3300026067 Ga0207678_10044265 Ga0207678_100442652 253
343 3300026088 Ga0207641_10002933 Ga0207641_1000293315 253
344 3300026088 Ga0207641_10007528 Ga0207641_100075283 253
345 3300026088 Ga0207641_10008125 Ga0207641_100081256 253
346 3300026095 Ga0207676_10147698 Ga0207676_101476982 253
347 3300026095 Ga0207676_10408669 Ga0207676_104086692 253
348 3300026116 Ga0207674_10059221 Ga0207674_100592215 253
349 3300026116 Ga0207674_10156265 Ga0207674_101562653 253
350 3300026116 Ga0207674_10256941 Ga0207674_102569412 253
351 3300026116 Ga0207674_10316867 Ga0207674_103168672 253
352 3300026116 Ga0207674_10360879 Ga0207674_103608792 253
353 3300026116 Ga0207674_10407868 Ga0207674_104078681 253
354 3300026142 Ga0207698_10220495 Ga0207698_102204951 253
355 3300027866 Ga0209813_10003017 Ga0209813_100030174 253
356 3300028380 Ga0268265_10000518 Ga0268265_1000051817 253
357 3300028381 Ga0268264_10019875 Ga0268264_100198756 253
358 3300030500 Ga0268256_1008888 Ga0268256_10088881 253
359 3300031507 Ga0307509_10006450 Ga0307509_1000645011 253
360 3300031824 Ga0307413_10316514 Ga0307413_103165141 253
361 3300031838 Ga0307518_10020698 Ga0307518_100206984 253
362 3300031838 Ga0307518_10105941 Ga0307518_101059411 253
363 3300031852 Ga0307410_10085175 Ga0307410_100851752 253
364 3300031911 Ga0307412_10079297 Ga0307412_100792973 253
365 3300031995 Ga0307409_100027582 Ga0307409_1000275823 253
366 3300031995 Ga0307409_100287315 Ga0307409_1002873152 253
367 3300031995 Ga0307409_100307875 Ga0307409_1003078752 253
368 3300031995 Ga0307409_100491446 Ga0307409_1004914462 253
369 3300032002 Ga0307416_100360459 Ga0307416_1003604592 253
370 3300032004 Ga0307414_10495113 Ga0307414_104951132 253
371 3300032005 Ga0307411_10060765 Ga0307411_100607653 253
372 3300032126 Ga0307415_100033772 Ga0307415_1000337723 253
373 3300032126 Ga0307415_100047905 Ga0307415_1000479053 253
374 3300033180 Ga0307510_10001944 Ga0307510_1000194418 253
375 3300036459 Ga0372808_002056 Ga0372808_002056_872_1684 253
376 3300037471 Ga0395905_0164302 Ga0395905_0164302_1292_2056 253
377 3300037853 Ga0436364_0299324 Ga0436364_0299324_708_1472 253
378 3300037853 Ga0436364_0712624 Ga0436364_0712624_4094_4858 253
379 3300037853 Ga0436364_1299779 Ga0436364_1299779_54646_55410 253
380 3300037853 Ga0436364_1545113 Ga0436364_1545113_6364_7128 253
381 3300041404 Ga0439436_0051496 Ga0439436_0051496_376_1143 253
382 3300042439 Ga0439464_0012717 Ga0439464_0012717_1326_2087 253
383 3300044658 Ga0466972_0080721 Ga0466972_0080721_168_935 253
384 3300044693 Ga0466961_0028079 Ga0466961_0028079_991_1758 253
385 3300044901 Ga0466960_0005889 Ga0466960_0005889_370_1137 253
386 3300044901 Ga0466960_0036245 Ga0466960_0036245_1519_2298 253
387 3300045836 Ga0466958_0057298 Ga0466958_0057298_1256_2044 253
388 3300045836 Ga0466958_0351080 Ga0466958_0351080_125_892 253
389 3300045976 Ga0466967_0042605 Ga0466967_0042605_2803_3582 253
390 3300045976 Ga0466967_0124070 Ga0466967_0124070_180_944 253
391 3300045976 Ga0466967_0180793 Ga0466967_0180793_1061_1828 253
392 3300045976 Ga0466967_0496016 Ga0466967_0496016_208_972 253
393 3300046455 Ga0495603_0010835 Ga0495603_0010835_985_1749 253
394 3300046455 Ga0495603_0174115 Ga0495603_0174115_101_868 253
395 3300046455 Ga0495603_0264464 Ga0495603_0264464_21_788 253
396 3300046473 Ga0495582_0079800 Ga0495582_0079800_496_1260 253
397 3300046492 Ga0495585_0010443 Ga0495585_0010443_2641_3405 253
398 3300046499 Ga0495594_0003695 Ga0495594_0003695_5988_6752 253
399 3300046501 Ga0495607_0046393 Ga0495607_0046393_1558_2322 253
400 3300046507 Ga0495606_0021321 Ga0495606_0021321_2154_2918 253
401 3300046526 Ga0495666_0002396 Ga0495666_0002396_156_920 253
402 3300046558 Ga0495633_0001542 Ga0495633_0001542_12282_13058 253
403 3300046616 Ga0495668_0005584 Ga0495668_0005584_7507_8271 253
404 3300046684 Ga0495669_0001592 Ga0495669_0001592_2164_2934 253
405 3300046690 Ga0495624_0033151 Ga0495624_0033151_133_897 253
406 3300046794 Ga0495589_0053952 Ga0495589_0053952_438_1205 253
407 3300047321 Ga0495676_0021262 Ga0495676_0021262_1432_2196 253
408 3300047321 Ga0495676_0176152 Ga0495676_0176152_92_865 253
409 3300047323 Ga0495683_0007957 Ga0495683_0007957_367_1131 253
410 3300047443 Ga0495687_005501 Ga0495687_005501_2922_3686 253
411 3300047443 Ga0495687_035492 Ga0495687_035492_326_1090 253
412 3300047447 Ga0495685_004610 Ga0495685_004610_2684_3448 253
413 3300048089 Ga0495614_0016005 Ga0495614_0016005_1014_1778 253
414 3300048903 Ga0496100_0002953 Ga0496100_0002953_4970_5797 253
415 3300048903 Ga0496100_0009066 Ga0496100_0009066_3906_4703 253
416 3300048903 Ga0496100_0496309 Ga0496100_0496309_141_908 253
417 3300048904 Ga0496101_0018977 Ga0496101_0018977_3067_3894 253
418 3300048904 Ga0496101_0137186 Ga0496101_0137186_853_1650 253
419 3300048904 Ga0496101_0423733 Ga0496101_0423733_115_882 253
420 3300048905 Ga0496102_0000020 Ga0496102_0000020_215886_216713 253
421 3300048905 Ga0496102_0000111 Ga0496102_0000111_2212_2979 253
422 3300048905 Ga0496102_0000190 Ga0496102_0000190_35932_36729 253
423 3300048905 Ga0496102_0392090 Ga0496102_0392090_373_1137 253
424 3300048905 Ga0496102_0507361 Ga0496102_0507361_316_1116 253
425 3300048906 Ga0496103_0000030 Ga0496103_0000030_97490_98257 253
426 3300048906 Ga0496103_0000088 Ga0496103_0000088_22625_23452 253
427 3300048906 Ga0496103_0000125 Ga0496103_0000125_35924_36721 253
428 3300048907 Ga0496104_0040259 Ga0496104_0040259_3194_4021 253
429 3300048907 Ga0496104_0387229 Ga0496104_0387229_331_1131 253
430 3300048907 Ga0496104_0474473 Ga0496104_0474473_36_833 253
431 3300048908 Ga0496105_0183050 Ga0496105_0183050_101_919 253
432 3300048909 Ga0496106_0344036 Ga0496106_0344036_14_811 253
433 3300048910 Ga0496107_0032123 Ga0496107_0032123_2525_3322 253
434 3300048911 Ga0496108_0115454 Ga0496108_0115454_975_1739 253
435 3300048912 Ga0496109_0576754 Ga0496109_0576754_36_833 253
436 3300048913 Ga0496110_0031115 Ga0496110_0031115_3782_4579 253
437 3300048913 Ga0496110_0079377 Ga0496110_0079377_1015_1815 253
438 3300048913 Ga0496110_0138986 Ga0496110_0138986_78_905 253
439 3300048915 Ga0496112_0204888 Ga0496112_0204888_191_958 253
440 3300048917 Ga0496114_0477272 Ga0496114_0477272_170_967 253
441 3300048918 Ga0496115_0059617 Ga0496115_0059617_1297_2097 253
442 3300048919 Ga0496116_0000067 Ga0496116_0000067_215871_216698 253
443 3300048919 Ga0496116_0000337 Ga0496116_0000337_30105_30902 253
444 3300048920 Ga0496117_0000170 Ga0496117_0000170_91306_92133 253
445 3300048920 Ga0496117_0000313 Ga0496117_0000313_37268_38065 253
446 3300048921 Ga0496118_0000308 Ga0496118_0000308_46716_47513 253
447 3300048921 Ga0496118_0000337 Ga0496118_0000337_22638_23465 253
448 3300048921 Ga0496118_0018942 Ga0496118_0018942_5215_5994 253
449 3300048921 Ga0496118_0044396 Ga0496118_0044396_1818_2585 253
450 3300048921 Ga0496118_0051972 Ga0496118_0051972_2155_2922 253
451 3300048922 Ga0496119_0004562 Ga0496119_0004562_11476_12303 253
452 3300048922 Ga0496119_0011159 Ga0496119_0011159_2721_3518 253
453 3300048922 Ga0496119_0025811 Ga0496119_0025811_1678_2496 253
454 3300048922 Ga0496119_0042601 Ga0496119_0042601_1623_2405 253
455 3300048923 Ga0496120_0008130 Ga0496120_0008130_6772_7569 253
456 3300048923 Ga0496120_0009211 Ga0496120_0009211_1232_2059 253
457 3300048924 Ga0496121_0001602 Ga0496121_0001602_22751_23548 253
458 3300048924 Ga0496121_0012251 Ga0496121_0012251_1352_2119 253
459 3300048924 Ga0496121_0030413 Ga0496121_0030413_3654_4472 253
460 3300048924 Ga0496121_0038895 Ga0496121_0038895_3100_3927 253
461 3300048924 Ga0496121_0041540 Ga0496121_0041540_840_1622 253
462 3300048925 Ga0496122_0159958 Ga0496122_0159958_315_1091 253
463 3300048925 Ga0496122_0289244 Ga0496122_0289244_106_873 253
464 3300048927 Ga0496124_0029837 Ga0496124_0029837_356_1153 253
465 3300048927 Ga0496124_0051701 Ga0496124_0051701_354_1181 253
466 3300048928 Ga0496125_0015580 Ga0496125_0015580_4686_5450 253
467 3300048928 Ga0496125_0021713 Ga0496125_0021713_4974_5801 253
468 3300048929 Ga0496126_0000006 Ga0496126_0000006_525175_525939 253
469 3300048929 Ga0496126_0000080 Ga0496126_0000080_4913_5740 253
470 3300048929 Ga0496126_0000514 Ga0496126_0000514_30001_30798 253
471 3300048929 Ga0496126_0000999 Ga0496126_0000999_31910_32680 253
472 3300048929 Ga0496126_0255822 Ga0496126_0255822_457_1257 253
473 3300048929 Ga0496126_0338289 Ga0496126_0338289_322_1086 253
474 3300049569 Ga0501032_0035594 Ga0501032_0035594_1072_1839 253
475 3300049570 Ga0501033_0017275 Ga0501033_0017275_3335_4102 253
476 3300049571 Ga0501034_0000335 Ga0501034_0000335_18484_19248 253
477 3300049573 Ga0501037_0047673 Ga0501037_0047673_1852_2619 253
478 3300049574 Ga0501038_0496733 Ga0501038_0496733_120_887 253
479 3300049578 Ga0501042_0438070 Ga0501042_0438070_19_858 253
480 3300049579 Ga0501043_0088622 Ga0501043_0088622_388_1155 253
481 3300049581 Ga0501047_0010522 Ga0501047_0010522_537_1304 253
482 3300049585 Ga0501069_0001445 Ga0501069_0001445_7166_7933 253
483 3300049585 Ga0501069_0365915 Ga0501069_0365915_16_804 253
484 3300049586 Ga0501070_0000325 Ga0501070_0000325_7520_8287 253
485 3300049586 Ga0501070_0006844 Ga0501070_0006844_3768_4535 253
486 3300049586 Ga0501070_0009183 Ga0501070_0009183_5164_5931 253
487 3300049586 Ga0501070_0013263 Ga0501070_0013263_2077_2844 253
488 3300049586 Ga0501070_0168212 Ga0501070_0168212_396_1187 253
489 3300049589 Ga0501073_0033685 Ga0501073_0033685_2355_3122 253
490 3300049590 Ga0501074_0032057 Ga0501074_0032057_2867_3634 253
491 3300049741 Ga0501079_0001277 Ga0501079_0001277_121_888 253
492 3300049742 Ga0501080_0000096 Ga0501080_0000096_7178_7945 253
493 3300049742 Ga0501080_0272048 Ga0501080_0272048_92_859 253
494 3300049742 Ga0501080_0354659 Ga0501080_0354659_278_1045 253
495 3300049822 Ga0501035_0147265 Ga0501035_0147265_405_1172 253
496 3300049823 Ga0501044_0000201 Ga0501044_0000201_51880_52647 253
497 3300049823 Ga0501044_0002899 Ga0501044_0002899_8424_9191 253
498 3300049823 Ga0501044_0065517 Ga0501044_0065517_2585_3352 253
499 3300050491 nmdc:mga00v17_155802_c1 nmdc:mga00v17_155802_c1_694_1458 253
500 3300050494 nmdc:mga06z11_1130_c1 nmdc:mga06z11_1130_c1_6127_6891 253
501 3300050495 nmdc:mga04h51_3309_c1 nmdc:mga04h51_3309_c1_536_1300 253
502 3300050508 nmdc:mga09592_365_c1 nmdc:mga09592_365_c1_19977_20741 253
503 3300061719 Ga0466962_0161212 Ga0466962_0161212_213_980 253
504 iso_pu_bacteria 2895880812 2895890237 253
505 iso_pu_bacteria 8056060235 8056063608 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

8

252

0.93

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

13

258

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kjp-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis h37rv 0.9884 4 251
3qxi-assembly1.cif.gz_C crystal structure of enoyl-coa hydratase echa1 from mycobacterium marinum 0.9863 4 251
3qxi-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase echa1 from mycobacterium marinum 0.9802 4 251
3trr-assembly2.cif.gz_D crystal structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus 0.9771 3 251
5kjp-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis h37rv 0.9728 4 251
ID Description Score Start End Superfamily
3qxiB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9867 4 193 3.90.226.10
3rsiB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1; 0.973 89 190 3.90.226.20
af_O06536_1_113_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9697 15 115 3.90.226.10
3rsiC01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9672 2 57 3.30.300.220
3qxiB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9616 4 193 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A356HP65-F1-model_v4 deleted 0.9969 77 251
AF-A0A3N1D316-F1-model_v4 Enoyl-CoA hydratase 0.9931 2 251 GO:0003824
GO:0006635
AF-A8LD72-F1-model_v4 deleted 0.9929 2 251
AF-A0A2M6VVT7-F1-model_v4 Enoyl-CoA hydratase 0.9928 1 251 GO:0006635
GO:0016836
AF-J4TIU2-F1-model_v4 Carnitinyl-CoA dehydratase CaiD 0.9896 1 251 GO:0004300
GO:0006631

Feature Viewer

pLDDT pTM Quality
96.68 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map