F456327

General Info

Members Datasets Scaffolds Average Seq Length
505 249 1010 105

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100126842|Ga0068855_1001268424
Length 107
Sequence MMAKLTIVDRAGEEKMVDGENGLSVMEIIRDNGLDELLSLCGGCCSCATCHVYVDESGFEGALPAVSADENDLLDSSDHRTAQSRLSCQIPFSEALDGLTVRIAPED

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
164 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
165 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
166 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
167 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
168 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
169 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
170 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
171 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
172 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
187 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
188 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
191 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
229 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
230 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
231 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
233 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
234 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
235 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
237 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
238 2516143018 Ensifer sp. BR816 Isolate Nodule
239 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
240 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
241 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
242 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
243 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
244 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
245 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
246 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
247 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
248 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
249 643692032 Sinorhizobium fredii NGR234 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.43
Metatranscriptomes 0
Isolates 2.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.38
Nodule 0.59
Rhizoplane 4.75
Rhizosphere 87.33
Stem 0
Stem Tuber 0
Unclassified 1.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100126842 3300005563 Bacteria 2917
2 LJQas_1004390 3300000549 Bacteria 1840
3 JGI24736J21556_1003769 3300001904 Bacteria 2612
4 JGI24736J21556_1046320 3300001904 Bacteria 668
5 JGI24741J21665_1002496 3300001915 Bacteria 4761
6 JGI24740J21852_10011906 3300001979 Bacteria 3296
7 JGI24740J21852_10018152 3300001979 Bacteria 2503
8 JGI24739J22299_10002323 3300001989 Bacteria 7328
9 JGI24739J22299_10021861 3300001989 Bacteria 2273
10 JGI24737J22298_10075631 3300001990 Bacteria 1004
11 JGI24737J22298_10076949 3300001990 Bacteria 994
12 JGI24735J21928_10070174 3300002067 Bacteria 1004
13 JGI24735J21928_10190321 3300002067 Bacteria 594
14 JGI24750J21931_1007765 3300002070 Bacteria 1354
15 JGI24738J21930_10006571 3300002075 Bacteria 2720
16 JGI24738J21930_10012302 3300002075 Bacteria 1870
17 JGI24035J26624_1002194 3300002126 Bacteria 1819
18 JGI24034J26672_10005842 3300002239 Bacteria 1770
19 Ga0065707_10714410 3300005295 Bacteria 622
20 Ga0070658_10095941 3300005327 Bacteria 2448
21 Ga0070683_100089380 3300005329 Bacteria 2891
22 Ga0070683_100317402 3300005329 Bacteria 1483
23 Ga0070690_100253524 3300005330 Bacteria 1245
24 Ga0070670_100035594 3300005331 Bacteria 4285
25 Ga0070677_10000029 3300005333 Bacteria 42300
26 Ga0070677_10490872 3300005333 Bacteria 664
27 Ga0068869_100598791 3300005334 Bacteria 931
28 Ga0070666_10007820 3300005335 Bacteria 6602
29 Ga0070666_10022575 3300005335 Bacteria 4087
30 Ga0070666_11221528 3300005335 Unclassified 560
31 Ga0068868_100000021 3300005338 Bacteria 89090
32 Ga0070660_100000044 3300005339 Bacteria 71756
33 Ga0070660_100399985 3300005339 Bacteria 1136
34 Ga0070660_100430306 3300005339 Bacteria 1093
35 Ga0070689_100112384 3300005340 Bacteria 2168
36 Ga0070661_100145057 3300005344 Bacteria 1791
37 Ga0070661_101373964 3300005344 Bacteria 594
38 Ga0070692_10329707 3300005345 Bacteria 942
39 Ga0070668_100030352 3300005347 Bacteria 4109
40 Ga0070668_100187976 3300005347 Bacteria 1690
41 Ga0070668_101160607 3300005347 Bacteria 699
42 Ga0070668_101467268 3300005347 Bacteria 623
43 Ga0070669_100000302 3300005353 Bacteria 38805
44 Ga0070669_100027501 3300005353 Bacteria 4093
45 Ga0070669_101345870 3300005353 Unclassified 619
46 Ga0070675_100013240 3300005354 Bacteria 6483
47 Ga0070671_100000089 3300005355 Bacteria 58283
48 Ga0070671_100027007 3300005355 Bacteria 4723
49 Ga0070671_100048974 3300005355 Bacteria 3516
50 Ga0070671_101213904 3300005355 Bacteria 664
51 Ga0070674_100060786 3300005356 Bacteria 2635
52 Ga0070673_101151429 3300005364 Bacteria 726
53 Ga0070659_100000027 3300005366 Bacteria 143469
54 Ga0070659_100085590 3300005366 Bacteria 2521
55 Ga0070659_100100384 3300005366 Bacteria 2329
56 Ga0070667_100000339 3300005367 Bacteria 52285
57 Ga0070667_100036542 3300005367 Bacteria 4118
58 Ga0070705_100007579 3300005440 Bacteria 5347
59 Ga0070708_100478569 3300005445 Bacteria 1175
60 Ga0070663_100006821 3300005455 Bacteria 6905
61 Ga0070663_100029648 3300005455 Bacteria 3741
62 Ga0070662_100205847 3300005457 Bacteria 1563
63 Ga0070681_11385463 3300005458 Bacteria 627
64 Ga0070685_10582253 3300005466 Bacteria 803
65 Ga0070707_101124955 3300005468 Bacteria 751
66 Ga0070684_100837242 3300005535 Bacteria 861
67 Ga0070684_101165502 3300005535 Bacteria 725
68 Ga0068853_100006228 3300005539 Bacteria 9452
69 Ga0068853_100059754 3300005539 Bacteria 3293
70 Ga0068853_100073184 3300005539 Bacteria 2987
71 Ga0068853_100344853 3300005539 Bacteria 1384
72 Ga0068853_100462245 3300005539 Bacteria 1194
73 Ga0068853_100851550 3300005539 Bacteria 874
74 Ga0070672_101393476 3300005543 Bacteria 627
75 Ga0070686_100000152 3300005544 Bacteria 47696
76 Ga0070686_100061175 3300005544 Bacteria 2432
77 Ga0070686_100722485 3300005544 Bacteria 796
78 Ga0070696_100747400 3300005546 Bacteria 801
79 Ga0070665_100000354 3300005548 Bacteria 68927
80 Ga0070665_100003716 3300005548 Bacteria 16154
81 Ga0070665_100064614 3300005548 Bacteria 3670
82 Ga0070665_100087460 3300005548 Bacteria 3121
83 Ga0068855_100137715 3300005563 Bacteria 2784
84 Ga0070664_100171052 3300005564 Bacteria 1927
85 Ga0068857_100025646 3300005577 Bacteria 5189
86 Ga0068857_100031849 3300005577 Bacteria 4659
87 Ga0068857_100197453 3300005577 Bacteria 1833
88 Ga0068857_102393700 3300005577 Bacteria 518
89 Ga0068854_100177304 3300005578 Bacteria 1662
90 Ga0068854_100982130 3300005578 Bacteria 747
91 Ga0068856_100033646 3300005614 Bacteria 5019
92 Ga0068856_100365384 3300005614 Bacteria 1462
93 Ga0070702_101065470 3300005615 Bacteria 644
94 Ga0068852_100004899 3300005616 Bacteria 9506
95 Ga0068852_100365360 3300005616 Bacteria 1412
96 Ga0068852_100850347 3300005616 Bacteria 928
97 Ga0068852_102020801 3300005616 Bacteria 598
98 Ga0068859_100053025 3300005617 Bacteria 4078
99 Ga0068859_100094489 3300005617 Bacteria 3042
100 Ga0068859_100188434 3300005617 Bacteria 2147
101 Ga0068864_100202885 3300005618 Bacteria 1822
102 Ga0068864_100218506 3300005618 Bacteria 1758
103 Ga0068861_100050668 3300005719 Bacteria 3149
104 Ga0068851_10007576 3300005834 Bacteria 4990
105 Ga0068851_10076894 3300005834 Bacteria 1736
106 Ga0068851_10195547 3300005834 Bacteria 1126
107 Ga0068863_100011981 3300005841 Bacteria 8380
108 Ga0068863_100044513 3300005841 Bacteria 4213
109 Ga0068863_100047147 3300005841 Bacteria 4089
110 Ga0068858_100014602 3300005842 Bacteria 7398
111 Ga0068858_100017841 3300005842 Bacteria 6646
112 Ga0068858_100045005 3300005842 Bacteria 4090
113 Ga0068860_100000442 3300005843 Bacteria 52295
114 Ga0068860_100034512 3300005843 Bacteria 4853
115 Ga0068860_100036461 3300005843 Bacteria 4711
116 Ga0068860_100043647 3300005843 Bacteria 4276
117 Ga0068862_100037784 3300005844 Bacteria 4093
118 Ga0068862_100333724 3300005844 Bacteria 1403
119 Ga0068862_100412879 3300005844 Bacteria 1265
120 Ga0097621_101143717 3300006237 Bacteria 732
121 Ga0097621_102218505 3300006237 Unclassified 525
122 Ga0075370_10717932 3300006353 Bacteria 608
123 Ga0075370_10983115 3300006353 Bacteria 517
124 Ga0068871_101467502 3300006358 Bacteria 644
125 Ga0075434_100214521 3300006871 Bacteria 1945
126 Ga0097620_100053026 3300006931 Bacteria 4078
127 Ga0097620_100094485 3300006931 Bacteria 3042
128 Ga0097620_100188439 3300006931 Bacteria 2147
129 Ga0105240_10266724 3300009093 Bacteria 1973
130 Ga0105240_10399220 3300009093 Bacteria 1549
131 Ga0105240_11643586 3300009093 Bacteria 671
132 Ga0105245_10018640 3300009098 Bacteria 6069
133 Ga0105245_10072857 3300009098 Bacteria 3122
134 Ga0105245_10569570 3300009098 Bacteria 1156
135 Ga0105245_11295574 3300009098 Bacteria 777
136 Ga0105245_12065005 3300009098 Bacteria 623
137 Ga0105247_10019007 3300009101 Bacteria 4127
138 Ga0105247_10443676 3300009101 Bacteria 934
139 Ga0105247_11089900 3300009101 Bacteria 629
140 Ga0105241_10051454 3300009174 Bacteria 3141
141 Ga0105241_10708977 3300009174 Bacteria 919
142 Ga0105242_11093837 3300009176 Bacteria 811
143 Ga0105242_11437964 3300009176 Unclassified 718
144 Ga0105248_10015752 3300009177 Bacteria 8332
145 Ga0105248_10044388 3300009177 Bacteria 4985
146 Ga0105237_10053540 3300009545 Bacteria 4047
147 Ga0105237_12338945 3300009545 Bacteria 544
148 Ga0105238_10062085 3300009551 Bacteria 3738
149 Ga0105238_10126544 3300009551 Bacteria 2533
150 Ga0105238_10159234 3300009551 Bacteria 2233
151 Ga0105238_10263286 3300009551 Bacteria 1704
152 Ga0105238_10945606 3300009551 Bacteria 881
153 Ga0105249_10042662 3300009553 Bacteria 4127
154 Ga0105249_11982383 3300009553 Bacteria 655
155 Ga0105239_10984702 3300010375 Bacteria 969
156 Ga0105239_12141221 3300010375 Bacteria 650
157 Ga0105246_11179323 3300011119 Bacteria 704
158 Ga0157373_10199580 3300013100 Bacteria 1410
159 Ga0157373_10358487 3300013100 Bacteria 1041
160 Ga0157371_10319478 3300013102 Bacteria 1126
161 Ga0157371_10338453 3300013102 Bacteria 1094
162 Ga0157370_10013741 3300013104 Bacteria 8322
163 Ga0157369_10220096 3300013105 Bacteria 1987
164 Ga0157369_10982595 3300013105 Bacteria 864
165 Ga0157378_12128775 3300013297 Bacteria 612
166 Ga0163162_10036722 3300013306 Bacteria 4885
167 Ga0157372_10265968 3300013307 Bacteria 1991
168 Ga0157372_10832664 3300013307 Bacteria 1071
169 Ga0157372_10939869 3300013307 Bacteria 1002
170 Ga0157372_11289991 3300013307 Bacteria 843
171 Ga0157375_11218039 3300013308 Bacteria 883
172 Ga0157375_11363184 3300013308 Bacteria 835
173 Ga0157375_11576471 3300013308 Bacteria 776
174 Ga0157375_12095565 3300013308 Bacteria 673
175 Ga0163163_10345956 3300014325 Bacteria 1542
176 Ga0163163_11827380 3300014325 Bacteria 668
177 Ga0157380_10044825 3300014326 Bacteria 3468
178 Ga0157379_10308188 3300014968 Bacteria 1444
179 Ga0157379_10556012 3300014968 Bacteria 1068
180 Ga0157376_11829537 3300014969 Bacteria 644
181 Ga0163161_10022051 3300017792 Bacteria 4481
182 Ga0213876_10001018 3300021384 Bacteria 18185
183 Ga0213876_10014853 3300021384 Bacteria 4127
184 Ga0213876_10034251 3300021384 Bacteria 2678
185 Ga0207666_1042055 3300025271 Bacteria 716
186 Ga0207673_1034584 3300025290 Bacteria 704
187 Ga0209257_1090848 3300025304 Bacteria 763
188 Ga0207697_10010106 3300025315 Bacteria 4051
189 Ga0207697_10142458 3300025315 Bacteria 1040
190 Ga0207656_10015570 3300025321 Bacteria 2945
191 Ga0207656_10054312 3300025321 Bacteria 1741
192 Ga0207656_10082973 3300025321 Bacteria 1444
193 Ga0207682_10000227 3300025893 Bacteria 25316
194 Ga0207710_10000513 3300025900 Bacteria 24057
195 Ga0207710_10125736 3300025900 Bacteria 1228
196 Ga0207710_10267054 3300025900 Bacteria 859
197 Ga0207688_10283161 3300025901 Bacteria 1010
198 Ga0207680_10011217 3300025903 Bacteria 4519
199 Ga0207680_10183177 3300025903 Bacteria 1417
200 Ga0207680_10189179 3300025903 Bacteria 1396
201 Ga0207647_10182091 3300025904 Bacteria 1220
202 Ga0207647_10246906 3300025904 Bacteria 1024
203 Ga0207645_10257210 3300025907 Bacteria 1156
204 Ga0207705_10064630 3300025909 Bacteria 2644
205 Ga0207654_10099782 3300025911 Bacteria 1787
206 Ga0207695_10252764 3300025913 Bacteria 1661
207 Ga0207695_10557127 3300025913 Bacteria 1028
208 Ga0207671_10456715 3300025914 Bacteria 1018
209 Ga0207657_10001409 3300025919 Bacteria 25657
210 Ga0207657_10055561 3300025919 Bacteria 3419
211 Ga0207657_10109581 3300025919 Bacteria 2282
212 Ga0207657_11394896 3300025919 Bacteria 526
213 Ga0207649_10402064 3300025920 Bacteria 1025
214 Ga0207649_11480257 3300025920 Bacteria 537
215 Ga0207681_10000313 3300025923 Bacteria 35417
216 Ga0207681_10021433 3300025923 Bacteria 4107
217 Ga0207681_11093144 3300025923 Bacteria 670
218 Ga0207694_10033550 3300025924 Bacteria 3932
219 Ga0207694_10129059 3300025924 Bacteria 2025
220 Ga0207694_10733511 3300025924 Bacteria 834
221 Ga0207650_10019895 3300025925 Bacteria 4725
222 Ga0207659_10071778 3300025926 Bacteria 2529
223 Ga0207687_10084974 3300025927 Bacteria 2295
224 Ga0207687_10120521 3300025927 Bacteria 1961
225 Ga0207687_10675424 3300025927 Bacteria 875
226 Ga0207687_10823251 3300025927 Bacteria 792
227 Ga0207687_10933118 3300025927 Bacteria 743
228 Ga0207644_10000005 3300025931 Bacteria 441948
229 Ga0207644_10013740 3300025931 Bacteria 5406
230 Ga0207690_10000067 3300025932 Bacteria 91404
231 Ga0207690_10044282 3300025932 Bacteria 2933
232 Ga0207690_10126355 3300025932 Bacteria 1865
233 Ga0207690_10163017 3300025932 Bacteria 1664
234 Ga0207706_10303950 3300025933 Bacteria 1390
235 Ga0207706_10361124 3300025933 Bacteria 1262
236 Ga0207686_10487418 3300025934 Bacteria 954
237 Ga0207709_11783770 3300025935 Bacteria 512
238 Ga0207670_10091323 3300025936 Bacteria 2153
239 Ga0207670_10610686 3300025936 Bacteria 896
240 Ga0207670_11734240 3300025936 Bacteria 531
241 Ga0207691_10294224 3300025940 Bacteria 1396
242 Ga0207711_10014451 3300025941 Bacteria 6559
243 Ga0207711_10137054 3300025941 Bacteria 2199
244 Ga0207711_10146883 3300025941 Bacteria 2125
245 Ga0207711_10350760 3300025941 Bacteria 1366
246 Ga0207689_10306458 3300025942 Bacteria 1317
247 Ga0207661_11145200 3300025944 Bacteria 716
248 Ga0207679_10270029 3300025945 Bacteria 1454
249 Ga0207667_10055718 3300025949 Bacteria 4155
250 Ga0207667_10133329 3300025949 Bacteria 2559
251 Ga0207667_10662811 3300025949 Bacteria 1048
252 Ga0207651_10540159 3300025960 Bacteria 1012
253 Ga0207651_11289131 3300025960 Bacteria 657
254 Ga0207712_10006375 3300025961 Bacteria 7442
255 Ga0207712_11278568 3300025961 Bacteria 655
256 Ga0207668_10587175 3300025972 Bacteria 969
257 Ga0207668_10730617 3300025972 Bacteria 872
258 Ga0207668_11695002 3300025972 Bacteria 571
259 Ga0207640_10025772 3300025981 Bacteria 3563
260 Ga0207640_10027521 3300025981 Bacteria 3465
261 Ga0207640_10050981 3300025981 Bacteria 2688
262 Ga0207640_11306867 3300025981 Bacteria 648
263 Ga0207640_11462200 3300025981 Bacteria 613
264 Ga0207658_10000492 3300025986 Bacteria 36290
265 Ga0207658_10034006 3300025986 Bacteria 3639
266 Ga0207677_10000036 3300026023 Bacteria 115815
267 Ga0207703_10000584 3300026035 Bacteria 37152
268 Ga0207703_10002816 3300026035 Bacteria 14836
269 Ga0207703_10142493 3300026035 Bacteria 2081
270 Ga0207703_11345807 3300026035 Bacteria 687
271 Ga0207639_10003754 3300026041 Bacteria 10220
272 Ga0207639_10008273 3300026041 Bacteria 7127
273 Ga0207639_10083897 3300026041 Bacteria 2530
274 Ga0207639_10186846 3300026041 Bacteria 1767
275 Ga0207639_10275822 3300026041 Bacteria 1477
276 Ga0207639_10703966 3300026041 Bacteria 937
277 Ga0207678_10002196 3300026067 Bacteria 17622
278 Ga0207678_10009989 3300026067 Bacteria 8327
279 Ga0207708_10593311 3300026075 Bacteria 938
280 Ga0207702_10018798 3300026078 Bacteria 5715
281 Ga0207641_10002999 3300026088 Bacteria 15251
282 Ga0207641_10003551 3300026088 Bacteria 13782
283 Ga0207641_10005625 3300026088 Bacteria 10678
284 Ga0207641_10064753 3300026088 Bacteria 3125
285 Ga0207676_10075645 3300026095 Bacteria 2717
286 Ga0207676_10168989 3300026095 Bacteria 1903
287 Ga0207674_10016473 3300026116 Bacteria 8089
288 Ga0207674_10041158 3300026116 Bacteria 4780
289 Ga0207674_10069626 3300026116 Bacteria 3538
290 Ga0207674_10235998 3300026116 Bacteria 1776
291 Ga0207674_10593308 3300026116 Bacteria 1070
292 Ga0207674_10593735 3300026116 Bacteria 1070
293 Ga0207675_100046576 3300026118 Bacteria 4051
294 Ga0207675_101050901 3300026118 Bacteria 833
295 Ga0207698_10018599 3300026142 Bacteria 4739
296 Ga0207698_10041720 3300026142 Bacteria 3422
297 Ga0207698_10353300 3300026142 Bacteria 1389
298 Ga0207698_10374075 3300026142 Bacteria 1353
299 Ga0207698_10404539 3300026142 Bacteria 1305
300 Ga0207698_11130897 3300026142 Bacteria 796
301 Ga0268266_10000093 3300028379 Bacteria 191879
302 Ga0268266_10001503 3300028379 Bacteria 27580
303 Ga0268266_10510842 3300028379 Bacteria 1148
304 Ga0268266_11802285 3300028379 Unclassified 587
305 Ga0268265_10026740 3300028380 Bacteria 4107
306 Ga0268265_10204400 3300028380 Bacteria 1716
307 Ga0268264_10000491 3300028381 Bacteria 52312
308 Ga0268264_10012118 3300028381 Bacteria 7099
309 Ga0268264_10016923 3300028381 Bacteria 5969
310 Ga0268264_10034856 3300028381 Bacteria 4142
311 Ga0307408_100015416 3300031548 Bacteria 5087
312 Ga0307408_100046898 3300031548 Bacteria 3092
313 Ga0307408_100064636 3300031548 Bacteria 2680
314 Ga0307408_100177669 3300031548 Bacteria 1704
315 Ga0307408_100453161 3300031548 Bacteria 1113
316 Ga0307408_100583147 3300031548 Bacteria 991
317 Ga0307408_100602506 3300031548 Bacteria 976
318 Ga0307405_10029938 3300031731 Bacteria 3187
319 Ga0307405_10035700 3300031731 Bacteria 2971
320 Ga0307405_10069897 3300031731 Bacteria 2253
321 Ga0307405_10101234 3300031731 Bacteria 1932
322 Ga0307405_10164296 3300031731 Bacteria 1576
323 Ga0307405_10299636 3300031731 Bacteria 1219
324 Ga0307405_10321249 3300031731 Bacteria 1182
325 Ga0307405_11052656 3300031731 Bacteria 697
326 Ga0307405_11264046 3300031731 Bacteria 641
327 Ga0307413_10003300 3300031824 Bacteria 6768
328 Ga0307413_10394207 3300031824 Bacteria 1083
329 Ga0307413_10669663 3300031824 Bacteria 858
330 Ga0307413_12008410 3300031824 Bacteria 521
331 Ga0307410_10034774 3300031852 Bacteria 3267
332 Ga0307410_10113741 3300031852 Bacteria 1962
333 Ga0307410_10120313 3300031852 Bacteria 1914
334 Ga0307410_10137034 3300031852 Bacteria 1805
335 Ga0307410_10182851 3300031852 Bacteria 1588
336 Ga0307410_10247387 3300031852 Bacteria 1385
337 Ga0307410_10255922 3300031852 Bacteria 1363
338 Ga0307406_10038711 3300031901 Bacteria 2953
339 Ga0307406_10062871 3300031901 Bacteria 2402
340 Ga0307406_10117288 3300031901 Bacteria 1844
341 Ga0307406_10183560 3300031901 Bacteria 1525
342 Ga0307406_11004374 3300031901 Bacteria 716
343 Ga0307406_11102925 3300031901 Bacteria 685
344 Ga0307406_11420293 3300031901 Bacteria 609
345 Ga0307407_10014620 3300031903 Bacteria 3851
346 Ga0307407_10199340 3300031903 Bacteria 1340
347 Ga0307412_10020470 3300031911 Bacteria 4026
348 Ga0307412_10039562 3300031911 Bacteria 3045
349 Ga0307412_10054043 3300031911 Bacteria 2664
350 Ga0307412_10086124 3300031911 Bacteria 2185
351 Ga0307412_10199762 3300031911 Bacteria 1517
352 Ga0307412_11319358 3300031911 Bacteria 650
353 Ga0307412_12151103 3300031911 Bacteria 519
354 Ga0307409_100060181 3300031995 Bacteria 2960
355 Ga0307409_100131247 3300031995 Bacteria 2141
356 Ga0307409_100252470 3300031995 Bacteria 1613
357 Ga0307416_100060285 3300032002 Bacteria 3089
358 Ga0307416_100065603 3300032002 Bacteria 2984
359 Ga0307416_100076519 3300032002 Bacteria 2805
360 Ga0307416_100076900 3300032002 Bacteria 2800
361 Ga0307416_100145623 3300032002 Bacteria 2162
362 Ga0307416_100199179 3300032002 Bacteria 1898
363 Ga0307416_100222654 3300032002 Bacteria 1811
364 Ga0307416_100486038 3300032002 Bacteria 1296
365 Ga0307416_100568006 3300032002 Bacteria 1210
366 Ga0307416_100658113 3300032002 Bacteria 1133
367 Ga0307416_100749547 3300032002 Bacteria 1069
368 Ga0307416_100914935 3300032002 Bacteria 978
369 Ga0307416_101650109 3300032002 Bacteria 746
370 Ga0307416_101911438 3300032002 Bacteria 697
371 Ga0307416_103022283 3300032002 Bacteria 563
372 Ga0307414_10002554 3300032004 Bacteria 9572
373 Ga0307414_10064532 3300032004 Bacteria 2608
374 Ga0307414_10089065 3300032004 Bacteria 2286
375 Ga0307414_10188779 3300032004 Bacteria 1665
376 Ga0307414_10591013 3300032004 Bacteria 994
377 Ga0307414_10628882 3300032004 Bacteria 966
378 Ga0307414_11412330 3300032004 Bacteria 647
379 Ga0307414_11417218 3300032004 Bacteria 646
380 Ga0307414_12010614 3300032004 Bacteria 540
381 Ga0307411_10005386 3300032005 Bacteria 6280
382 Ga0307411_10134930 3300032005 Bacteria 1810
383 Ga0307411_10137692 3300032005 Bacteria 1795
384 Ga0307411_10207543 3300032005 Bacteria 1510
385 Ga0307411_11380615 3300032005 Bacteria 644
386 Ga0307411_11521707 3300032005 Bacteria 615
387 Ga0307411_11862368 3300032005 Bacteria 559
388 Ga0307411_12009197 3300032005 Bacteria 540
389 Ga0307411_12060754 3300032005 Unclassified 533
390 Ga0307411_12125514 3300032005 Bacteria 526
391 Ga0307411_12163592 3300032005 Bacteria 521
392 Ga0307415_100092229 3300032126 Bacteria 2196
393 Ga0307415_100476367 3300032126 Bacteria 1086
394 Ga0307415_100940192 3300032126 Bacteria 799
395 Ga0307415_101465201 3300032126 Bacteria 652
396 Ga0307510_10001552 3300033180 Bacteria 25413
397 Ga0373932_0017388 3300035112 Bacteria 1845
398 Ga0373931_0149807 3300035691 Bacteria 1359
399 Ga0395905_0851301 3300037471 Bacteria 815
400 Ga0395901_0701185 3300038443 Bacteria 1010
401 Ga0436365_0267983 3300039437 Bacteria 981
402 Ga0436365_0794411 3300039437 Bacteria 78184
403 Ga0436365_1062590 3300039437 Bacteria 8527
404 Ga0436365_1444662 3300039437 Bacteria 6184
405 Ga0436363_0558578 3300039450 Bacteria 1201
406 Ga0436363_0875254 3300039450 Bacteria 635
407 Ga0436362_0573919 3300039453 Bacteria 843
408 Ga0439453_0043972 3300041408 Bacteria 884
409 Ga0451787_258347 3300041441 Bacteria 524
410 Ga0451789_0625612 3300041443 Bacteria 802
411 Ga0451793_0509886 3300041452 Bacteria 1202
412 Ga0451797_0916757 3300041453 Bacteria 1027
413 Ga0451804_0257040 3300041463 Bacteria 604
414 Ga0451807_1810464 3300041486 Bacteria 714
415 Ga0451841_1174666 3300041498 Bacteria 624
416 Ga0451849_0266587 3300041505 Bacteria 864
417 Ga0451853_0050215 3300041512 Bacteria 747
418 Ga0451853_2208097 3300041512 Bacteria 726
419 Ga0450923_022840 3300042125 Bacteria 1229
420 Ga0439434_0160347 3300042435 Bacteria 747
421 Ga0466972_0018060 3300044658 Bacteria 3528
422 Ga0466961_0013225 3300044693 Bacteria 5281
423 Ga0466961_0483542 3300044693 Bacteria 748
424 Ga0466963_0005523 3300044694 Bacteria 7400
425 Ga0466964_0322539 3300044706 Bacteria 785
426 Ga0466971_0053263 3300044719 Bacteria 1823
427 Ga0466957_0003219 3300044842 Bacteria 8930
428 Ga0466959_0500535 3300045049 Unclassified 821
429 Ga0466958_0008794 3300045836 Bacteria 5608
430 Ga0466958_0283927 3300045836 Bacteria 1061
431 Ga0466967_0223477 3300045976 Bacteria 1790
432 Ga0495584_0104478 3300046491 Bacteria 1432
433 Ga0495632_0000001 3300046519 Bacteria 873295
434 Ga0495637_0000108 3300046520 Bacteria 60028
435 Ga0495643_0000020 3300046522 Bacteria 294973
436 Ga0495648_0008519 3300046524 Bacteria 8057
437 Ga0495663_0000002 3300046525 Bacteria 495384
438 Ga0495663_0187526 3300046525 Bacteria 718
439 Ga0495654_0010343 3300046530 Bacteria 5077
440 Ga0495633_0004517 3300046558 Bacteria 8801
441 Ga0495633_0579809 3300046558 Bacteria 505
442 Ga0495668_0176763 3300046616 Bacteria 1170
443 Ga0495668_0396850 3300046616 Bacteria 758
444 Ga0495625_0068493 3300046660 Bacteria 2495
445 Ga0495671_0000016 3300046692 Bacteria 294821
446 Ga0495649_0480012 3300046694 Bacteria 619
447 Ga0495681_0000929 3300047470 Bacteria 22583
448 Ga0495626_0035627 3300048091 Bacteria 2374
449 Ga0496100_1243446 3300048903 Bacteria 587
450 Ga0496101_0038880 3300048904 Bacteria 3380
451 Ga0496103_0092291 3300048906 Bacteria 1911
452 Ga0496104_0404942 3300048907 Bacteria 1276
453 Ga0496105_0039787 3300048908 Bacteria 3876
454 Ga0496106_0001999 3300048909 Bacteria 15340
455 Ga0496107_0001507 3300048910 Bacteria 14463
456 Ga0496108_0185404 3300048911 Bacteria 1802
457 Ga0496109_0143028 3300048912 Bacteria 2237
458 Ga0496109_1450813 3300048912 Bacteria 621
459 Ga0496110_0140483 3300048913 Bacteria 2183
460 Ga0496111_0127045 3300048914 Bacteria 1885
461 Ga0496111_0768130 3300048914 Bacteria 698
462 Ga0496112_0274807 3300048915 Bacteria 1632
463 Ga0496113_0003027 3300048916 Bacteria 9962
464 Ga0496113_0484610 3300048916 Bacteria 993
465 Ga0496115_0153612 3300048918 Bacteria 1901
466 Ga0496119_0396769 3300048922 Bacteria 659
467 Ga0496121_0000017 3300048924 Bacteria 546415
468 Ga0496121_0000114 3300048924 Bacteria 179427
469 Ga0496124_0253224 3300048927 Bacteria 1301
470 Ga0496126_0001667 3300048929 Bacteria 33333
471 Ga0496126_1116976 3300048929 Bacteria 584
472 Ga0501034_0513801 3300049571 Bacteria 1110
473 Ga0501037_0838102 3300049573 Bacteria 605
474 Ga0501041_0306569 3300049577 Bacteria 1001
475 Ga0501043_0642809 3300049579 Bacteria 780
476 Ga0501069_0003915 3300049585 Bacteria 7678
477 Ga0501070_0151326 3300049586 Bacteria 1914
478 Ga0501073_0612516 3300049589 Unclassified 752
479 Ga0501074_0459143 3300049590 Unclassified 903
480 Ga0501080_0123075 3300049742 Bacteria 2403
481 Ga0501080_1443336 3300049742 Bacteria 586
482 nmdc:mga0k408_117727_c1 3300050493 Bacteria 1572
483 nmdc:mga0n895_458403_c1 3300050512 Bacteria 1287
484 Ga0500646_0036084 3300053090 Bacteria 1376
485 Ga0500592_000009 3300053116 Bacteria 87878
486 Ga0500568_0001425 3300053139 Bacteria 15507
487 Ga0500604_0000198 3300053151 Bacteria 17067
488 Ga0500616_0000238 3300053153 Bacteria 86573
489 Ga0500627_0000051 3300053158 Bacteria 56260
490 Ga0500611_029122 3300053727 Bacteria 1127
491 Ga0500587_004826 3300053739 Bacteria 1839
492 Ga0466962_0000640 3300061719 Bacteria 15596
493 2511388212 2511231027 Bacteria 5013807
494 2516206524 2516143018 Bacteria 6951533
495 2585268355 2582581306 Bacteria 6450535
496 2585397434 2582581866 Bacteria 6859583
497 2657686193 2657244999 Bacteria 5946535
498 2725946918 2724679232 Bacteria 7646494
499 2770196092 2767802442 Bacteria 5747986
500 2804755540 2802429268 Bacteria 6094027
501 2838662590 2838661181 Bacteria 7385261
502 2848297517 2848297114 Bacteria 3608511
503 2919142812 2919138771 Bacteria 5281312
504 2919713233 2919709256 Bacteria 4318106
505 643823490 643692032 Bacteria 6891900
506 Ga0068855_100126842
507 LJQas_1004390
508 JGI24736J21556_1003769
509 JGI24736J21556_1046320
510 JGI24741J21665_1002496
511 JGI24740J21852_10011906
512 JGI24740J21852_10018152
513 JGI24739J22299_10002323
514 JGI24739J22299_10021861
515 JGI24737J22298_10075631
516 JGI24737J22298_10076949
517 JGI24735J21928_10070174
518 JGI24735J21928_10190321
519 JGI24750J21931_1007765
520 JGI24738J21930_10006571
521 JGI24738J21930_10012302
522 JGI24035J26624_1002194
523 JGI24034J26672_10005842
524 Ga0065707_10714410
525 Ga0070658_10095941
526 Ga0070683_100089380
527 Ga0070683_100317402
528 Ga0070690_100253524
529 Ga0070670_100035594
530 Ga0070677_10000029
531 Ga0070677_10490872
532 Ga0068869_100598791
533 Ga0070666_10007820
534 Ga0070666_10022575
535 Ga0070666_11221528
536 Ga0068868_100000021
537 Ga0070660_100000044
538 Ga0070660_100399985
539 Ga0070660_100430306
540 Ga0070689_100112384
541 Ga0070661_100145057
542 Ga0070661_101373964
543 Ga0070692_10329707
544 Ga0070668_100030352
545 Ga0070668_100187976
546 Ga0070668_101160607
547 Ga0070668_101467268
548 Ga0070669_100000302
549 Ga0070669_100027501
550 Ga0070669_101345870
551 Ga0070675_100013240
552 Ga0070671_100000089
553 Ga0070671_100027007
554 Ga0070671_100048974
555 Ga0070671_101213904
556 Ga0070674_100060786
557 Ga0070673_101151429
558 Ga0070659_100000027
559 Ga0070659_100085590
560 Ga0070659_100100384
561 Ga0070667_100000339
562 Ga0070667_100036542
563 Ga0070705_100007579
564 Ga0070708_100478569
565 Ga0070663_100006821
566 Ga0070663_100029648
567 Ga0070662_100205847
568 Ga0070681_11385463
569 Ga0070685_10582253
570 Ga0070707_101124955
571 Ga0070684_100837242
572 Ga0070684_101165502
573 Ga0068853_100006228
574 Ga0068853_100059754
575 Ga0068853_100073184
576 Ga0068853_100344853
577 Ga0068853_100462245
578 Ga0068853_100851550
579 Ga0070672_101393476
580 Ga0070686_100000152
581 Ga0070686_100061175
582 Ga0070686_100722485
583 Ga0070696_100747400
584 Ga0070665_100000354
585 Ga0070665_100003716
586 Ga0070665_100064614
587 Ga0070665_100087460
588 Ga0068855_100137715
589 Ga0070664_100171052
590 Ga0068857_100025646
591 Ga0068857_100031849
592 Ga0068857_100197453
593 Ga0068857_102393700
594 Ga0068854_100177304
595 Ga0068854_100982130
596 Ga0068856_100033646
597 Ga0068856_100365384
598 Ga0070702_101065470
599 Ga0068852_100004899
600 Ga0068852_100365360
601 Ga0068852_100850347
602 Ga0068852_102020801
603 Ga0068859_100053025
604 Ga0068859_100094489
605 Ga0068859_100188434
606 Ga0068864_100202885
607 Ga0068864_100218506
608 Ga0068861_100050668
609 Ga0068851_10007576
610 Ga0068851_10076894
611 Ga0068851_10195547
612 Ga0068863_100011981
613 Ga0068863_100044513
614 Ga0068863_100047147
615 Ga0068858_100014602
616 Ga0068858_100017841
617 Ga0068858_100045005
618 Ga0068860_100000442
619 Ga0068860_100034512
620 Ga0068860_100036461
621 Ga0068860_100043647
622 Ga0068862_100037784
623 Ga0068862_100333724
624 Ga0068862_100412879
625 Ga0097621_101143717
626 Ga0097621_102218505
627 Ga0075370_10717932
628 Ga0075370_10983115
629 Ga0068871_101467502
630 Ga0075434_100214521
631 Ga0097620_100053026
632 Ga0097620_100094485
633 Ga0097620_100188439
634 Ga0105240_10266724
635 Ga0105240_10399220
636 Ga0105240_11643586
637 Ga0105245_10018640
638 Ga0105245_10072857
639 Ga0105245_10569570
640 Ga0105245_11295574
641 Ga0105245_12065005
642 Ga0105247_10019007
643 Ga0105247_10443676
644 Ga0105247_11089900
645 Ga0105241_10051454
646 Ga0105241_10708977
647 Ga0105242_11093837
648 Ga0105242_11437964
649 Ga0105248_10015752
650 Ga0105248_10044388
651 Ga0105237_10053540
652 Ga0105237_12338945
653 Ga0105238_10062085
654 Ga0105238_10126544
655 Ga0105238_10159234
656 Ga0105238_10263286
657 Ga0105238_10945606
658 Ga0105249_10042662
659 Ga0105249_11982383
660 Ga0105239_10984702
661 Ga0105239_12141221
662 Ga0105246_11179323
663 Ga0157373_10199580
664 Ga0157373_10358487
665 Ga0157371_10319478
666 Ga0157371_10338453
667 Ga0157370_10013741
668 Ga0157369_10220096
669 Ga0157369_10982595
670 Ga0157378_12128775
671 Ga0163162_10036722
672 Ga0157372_10265968
673 Ga0157372_10832664
674 Ga0157372_10939869
675 Ga0157372_11289991
676 Ga0157375_11218039
677 Ga0157375_11363184
678 Ga0157375_11576471
679 Ga0157375_12095565
680 Ga0163163_10345956
681 Ga0163163_11827380
682 Ga0157380_10044825
683 Ga0157379_10308188
684 Ga0157379_10556012
685 Ga0157376_11829537
686 Ga0163161_10022051
687 Ga0213876_10001018
688 Ga0213876_10014853
689 Ga0213876_10034251
690 Ga0207666_1042055
691 Ga0207673_1034584
692 Ga0209257_1090848
693 Ga0207697_10010106
694 Ga0207697_10142458
695 Ga0207656_10015570
696 Ga0207656_10054312
697 Ga0207656_10082973
698 Ga0207682_10000227
699 Ga0207710_10000513
700 Ga0207710_10125736
701 Ga0207710_10267054
702 Ga0207688_10283161
703 Ga0207680_10011217
704 Ga0207680_10183177
705 Ga0207680_10189179
706 Ga0207647_10182091
707 Ga0207647_10246906
708 Ga0207645_10257210
709 Ga0207705_10064630
710 Ga0207654_10099782
711 Ga0207695_10252764
712 Ga0207695_10557127
713 Ga0207671_10456715
714 Ga0207657_10001409
715 Ga0207657_10055561
716 Ga0207657_10109581
717 Ga0207657_11394896
718 Ga0207649_10402064
719 Ga0207649_11480257
720 Ga0207681_10000313
721 Ga0207681_10021433
722 Ga0207681_11093144
723 Ga0207694_10033550
724 Ga0207694_10129059
725 Ga0207694_10733511
726 Ga0207650_10019895
727 Ga0207659_10071778
728 Ga0207687_10084974
729 Ga0207687_10120521
730 Ga0207687_10675424
731 Ga0207687_10823251
732 Ga0207687_10933118
733 Ga0207644_10000005
734 Ga0207644_10013740
735 Ga0207690_10000067
736 Ga0207690_10044282
737 Ga0207690_10126355
738 Ga0207690_10163017
739 Ga0207706_10303950
740 Ga0207706_10361124
741 Ga0207686_10487418
742 Ga0207709_11783770
743 Ga0207670_10091323
744 Ga0207670_10610686
745 Ga0207670_11734240
746 Ga0207691_10294224
747 Ga0207711_10014451
748 Ga0207711_10137054
749 Ga0207711_10146883
750 Ga0207711_10350760
751 Ga0207689_10306458
752 Ga0207661_11145200
753 Ga0207679_10270029
754 Ga0207667_10055718
755 Ga0207667_10133329
756 Ga0207667_10662811
757 Ga0207651_10540159
758 Ga0207651_11289131
759 Ga0207712_10006375
760 Ga0207712_11278568
761 Ga0207668_10587175
762 Ga0207668_10730617
763 Ga0207668_11695002
764 Ga0207640_10025772
765 Ga0207640_10027521
766 Ga0207640_10050981
767 Ga0207640_11306867
768 Ga0207640_11462200
769 Ga0207658_10000492
770 Ga0207658_10034006
771 Ga0207677_10000036
772 Ga0207703_10000584
773 Ga0207703_10002816
774 Ga0207703_10142493
775 Ga0207703_11345807
776 Ga0207639_10003754
777 Ga0207639_10008273
778 Ga0207639_10083897
779 Ga0207639_10186846
780 Ga0207639_10275822
781 Ga0207639_10703966
782 Ga0207678_10002196
783 Ga0207678_10009989
784 Ga0207708_10593311
785 Ga0207702_10018798
786 Ga0207641_10002999
787 Ga0207641_10003551
788 Ga0207641_10005625
789 Ga0207641_10064753
790 Ga0207676_10075645
791 Ga0207676_10168989
792 Ga0207674_10016473
793 Ga0207674_10041158
794 Ga0207674_10069626
795 Ga0207674_10235998
796 Ga0207674_10593308
797 Ga0207674_10593735
798 Ga0207675_100046576
799 Ga0207675_101050901
800 Ga0207698_10018599
801 Ga0207698_10041720
802 Ga0207698_10353300
803 Ga0207698_10374075
804 Ga0207698_10404539
805 Ga0207698_11130897
806 Ga0268266_10000093
807 Ga0268266_10001503
808 Ga0268266_10510842
809 Ga0268266_11802285
810 Ga0268265_10026740
811 Ga0268265_10204400
812 Ga0268264_10000491
813 Ga0268264_10012118
814 Ga0268264_10016923
815 Ga0268264_10034856
816 Ga0307408_100015416
817 Ga0307408_100046898
818 Ga0307408_100064636
819 Ga0307408_100177669
820 Ga0307408_100453161
821 Ga0307408_100583147
822 Ga0307408_100602506
823 Ga0307405_10029938
824 Ga0307405_10035700
825 Ga0307405_10069897
826 Ga0307405_10101234
827 Ga0307405_10164296
828 Ga0307405_10299636
829 Ga0307405_10321249
830 Ga0307405_11052656
831 Ga0307405_11264046
832 Ga0307413_10003300
833 Ga0307413_10394207
834 Ga0307413_10669663
835 Ga0307413_12008410
836 Ga0307410_10034774
837 Ga0307410_10113741
838 Ga0307410_10120313
839 Ga0307410_10137034
840 Ga0307410_10182851
841 Ga0307410_10247387
842 Ga0307410_10255922
843 Ga0307406_10038711
844 Ga0307406_10062871
845 Ga0307406_10117288
846 Ga0307406_10183560
847 Ga0307406_11004374
848 Ga0307406_11102925
849 Ga0307406_11420293
850 Ga0307407_10014620
851 Ga0307407_10199340
852 Ga0307412_10020470
853 Ga0307412_10039562
854 Ga0307412_10054043
855 Ga0307412_10086124
856 Ga0307412_10199762
857 Ga0307412_11319358
858 Ga0307412_12151103
859 Ga0307409_100060181
860 Ga0307409_100131247
861 Ga0307409_100252470
862 Ga0307416_100060285
863 Ga0307416_100065603
864 Ga0307416_100076519
865 Ga0307416_100076900
866 Ga0307416_100145623
867 Ga0307416_100199179
868 Ga0307416_100222654
869 Ga0307416_100486038
870 Ga0307416_100568006
871 Ga0307416_100658113
872 Ga0307416_100749547
873 Ga0307416_100914935
874 Ga0307416_101650109
875 Ga0307416_101911438
876 Ga0307416_103022283
877 Ga0307414_10002554
878 Ga0307414_10064532
879 Ga0307414_10089065
880 Ga0307414_10188779
881 Ga0307414_10591013
882 Ga0307414_10628882
883 Ga0307414_11412330
884 Ga0307414_11417218
885 Ga0307414_12010614
886 Ga0307411_10005386
887 Ga0307411_10134930
888 Ga0307411_10137692
889 Ga0307411_10207543
890 Ga0307411_11380615
891 Ga0307411_11521707
892 Ga0307411_11862368
893 Ga0307411_12009197
894 Ga0307411_12060754
895 Ga0307411_12125514
896 Ga0307411_12163592
897 Ga0307415_100092229
898 Ga0307415_100476367
899 Ga0307415_100940192
900 Ga0307415_101465201
901 Ga0307510_10001552
902 Ga0373932_0017388
903 Ga0373931_0149807
904 Ga0395905_0851301
905 Ga0395901_0701185
906 Ga0436365_0267983
907 Ga0436365_0794411
908 Ga0436365_1062590
909 Ga0436365_1444662
910 Ga0436363_0558578
911 Ga0436363_0875254
912 Ga0436362_0573919
913 Ga0439453_0043972
914 Ga0451787_258347
915 Ga0451789_0625612
916 Ga0451793_0509886
917 Ga0451797_0916757
918 Ga0451804_0257040
919 Ga0451807_1810464
920 Ga0451841_1174666
921 Ga0451849_0266587
922 Ga0451853_0050215
923 Ga0451853_2208097
924 Ga0450923_022840
925 Ga0439434_0160347
926 Ga0466972_0018060
927 Ga0466961_0013225
928 Ga0466961_0483542
929 Ga0466963_0005523
930 Ga0466964_0322539
931 Ga0466971_0053263
932 Ga0466957_0003219
933 Ga0466959_0500535
934 Ga0466958_0008794
935 Ga0466958_0283927
936 Ga0466967_0223477
937 Ga0495584_0104478
938 Ga0495632_0000001
939 Ga0495637_0000108
940 Ga0495643_0000020
941 Ga0495648_0008519
942 Ga0495663_0000002
943 Ga0495663_0187526
944 Ga0495654_0010343
945 Ga0495633_0004517
946 Ga0495633_0579809
947 Ga0495668_0176763
948 Ga0495668_0396850
949 Ga0495625_0068493
950 Ga0495671_0000016
951 Ga0495649_0480012
952 Ga0495681_0000929
953 Ga0495626_0035627
954 Ga0496100_1243446
955 Ga0496101_0038880
956 Ga0496103_0092291
957 Ga0496104_0404942
958 Ga0496105_0039787
959 Ga0496106_0001999
960 Ga0496107_0001507
961 Ga0496108_0185404
962 Ga0496109_0143028
963 Ga0496109_1450813
964 Ga0496110_0140483
965 Ga0496111_0127045
966 Ga0496111_0768130
967 Ga0496112_0274807
968 Ga0496113_0003027
969 Ga0496113_0484610
970 Ga0496115_0153612
971 Ga0496119_0396769
972 Ga0496121_0000017
973 Ga0496121_0000114
974 Ga0496124_0253224
975 Ga0496126_0001667
976 Ga0496126_1116976
977 Ga0501034_0513801
978 Ga0501037_0838102
979 Ga0501041_0306569
980 Ga0501043_0642809
981 Ga0501069_0003915
982 Ga0501070_0151326
983 Ga0501073_0612516
984 Ga0501074_0459143
985 Ga0501080_0123075
986 Ga0501080_1443336
987 nmdc:mga0k408_117727_c1
988 nmdc:mga0n895_458403_c1
989 Ga0500646_0036084
990 Ga0500592_000009
991 Ga0500568_0001425
992 Ga0500604_0000198
993 Ga0500616_0000238
994 Ga0500627_0000051
995 Ga0500611_029122
996 Ga0500587_004826
997 Ga0466962_0000640
998 2511388212
999 2516206524
1000 2585268355
1001 2585397434
1002 2657686193
1003 2725946918
1004 2770196092
1005 2804755540
1006 2838662590
1007 2848297517
1008 2919142812
1009 2919713233
1010 643823490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

8

93

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lxf-assembly1.cif.gz_A crystal structure of [2fe-2s] ferredoxin arx from novosphingobium aromaticivorans 0.9963 4 106
3lxf-assembly1.cif.gz_A crystal structure of [2fe-2s] ferredoxin arx from novosphingobium aromaticivorans 0.9774 4 106
2y5c-assembly2.cif.gz_B structure of human ferredoxin 2 (fdx2)in complex with 2fe2s cluster 0.9692 2 101
4ltu-assembly2.cif.gz_B crystal structure of ferredoxin from rhodopseudomonas palustris haa2 0.9613 4 106
6nbl-assembly2.cif.gz_D cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide 0.955 3 105
ID Description Score Start End Superfamily
3lxfB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9971 4 106 3.10.20.30
3lxfB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9781 4 106 3.10.20.30
af_Q9CPW2_55_168_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9767 2 103 3.10.20.30
4ltuB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9613 4 106 3.10.20.30
af_M9ND39_2_143_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.96 4 18 3.30.710.10
ID Description Score Start End GO Terms
AF-A0A4Q3CB93-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 1.004 26 106 GO:0009055
GO:0051537
GO:0140647
AF-A0A419TFV9-F1-model_v4 deleted 1 1 106
AF-X5CWH9-F1-model_v4 Chloroacetanilide N-alkylformylase 2, ferredoxin component (Ferredoxin CndB2) 0.9994 3 106 GO:0009055
GO:0046872
GO:0051537
GO:0140647
AF-Q2G8A3-F1-model_v4 Ferredoxin 0.9993 2 106 GO:0009055
GO:0046872
GO:0051537
GO:0140647
AF-A0A0H0XV86-F1-model_v4 Ferredoxin 0.9989 3 106 GO:0009055
GO:0051537
GO:0140647

Map