F456305

General Info

Members Datasets Scaffolds Average Seq Length
505 259 502 68

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_11219326|Ga0070676_112193262
Length 66
Sequence MLEEEAAPRRARGAALGELAKEDLEVYGVEELEERIDALKAEIARTEARLDKKRSGRSAADSLFKL

Samples

Sample ID Description Type Environment
1 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
2 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
3 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
225 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
226 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
227 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
228 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
229 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
230 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
231 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
232 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
233 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
234 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
235 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
236 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
237 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
238 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
241 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
242 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
243 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
244 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
245 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
246 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
247 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
248 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
251 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
252 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
253 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
254 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
255 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
256 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
257 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
258 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
259 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.4
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.88
Nodule 0
Rhizoplane 1.98
Rhizosphere 80.99
Stem 0
Stem Tuber 0
Unclassified 5.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10139656 3300002459 Unclassified 513
2 JGI25157J39369_1004666 3300002741 Bacteria 2416
3 Ga0055530_10000571 3300003791 Bacteria 31903
4 Ga0055531_10010712 3300003794 Bacteria 4519
5 Ga0055543_1031511 3300004625 Bacteria 924
6 Ga0065165_1003949 3300005262 Bacteria 9746
7 Ga0065707_10984542 3300005295 Bacteria 543
8 Ga0070658_10301182 3300005327 Bacteria 1367
9 Ga0070658_10387511 3300005327 Bacteria 1199
10 Ga0070658_11522667 3300005327 Unclassified 580
11 Ga0070658_11823822 3300005327 Bacteria 526
12 Ga0070676_11219326 3300005328 Unclassified 572
13 Ga0070676_11333266 3300005328 Bacteria 549
14 Ga0070683_101067175 3300005329 Bacteria 776
15 Ga0070690_101776173 3300005330 Bacteria 502
16 Ga0070670_100000013 3300005331 Bacteria 250768
17 Ga0070670_100052230 3300005331 Bacteria 3510
18 Ga0070666_10112866 3300005335 Bacteria 1880
19 Ga0070666_10407853 3300005335 Bacteria 977
20 Ga0070680_100082776 3300005336 Bacteria 2649
21 Ga0070680_100114065 3300005336 Bacteria 2251
22 Ga0070680_100238896 3300005336 Bacteria 1535
23 Ga0070680_101808433 3300005336 Bacteria 529
24 Ga0070682_100812114 3300005337 Bacteria 761
25 Ga0070660_100060427 3300005339 Bacteria 2941
26 Ga0070660_100627543 3300005339 Bacteria 899
27 Ga0070660_100955062 3300005339 Bacteria 724
28 Ga0070660_101562998 3300005339 Bacteria 561
29 Ga0070689_100103639 3300005340 Bacteria 2255
30 Ga0070691_10018090 3300005341 Bacteria 3245
31 Ga0070668_100001526 3300005347 Bacteria 16698
32 Ga0070668_100003606 3300005347 Bacteria 11421
33 Ga0070668_100013026 3300005347 Bacteria 6193
34 Ga0070668_101792022 3300005347 Unclassified 564
35 Ga0070669_100018780 3300005353 Bacteria 4942
36 Ga0070669_101611341 3300005353 Bacteria 565
37 Ga0070671_100003043 3300005355 Bacteria 13045
38 Ga0070671_100132630 3300005355 Bacteria 2099
39 Ga0070674_100600093 3300005356 Bacteria 930
40 Ga0070674_101169521 3300005356 Bacteria 682
41 Ga0070659_100004901 3300005366 Bacteria 9569
42 Ga0070659_100031856 3300005366 Bacteria 4086
43 Ga0070659_100297471 3300005366 Bacteria 1345
44 Ga0070667_100013998 3300005367 Bacteria 6630
45 Ga0070667_100060263 3300005367 Bacteria 3211
46 Ga0070662_100961971 3300005457 Bacteria 730
47 Ga0070681_10008232 3300005458 Bacteria 10204
48 Ga0070681_10047452 3300005458 Bacteria 4293
49 Ga0070681_10131168 3300005458 Bacteria 2438
50 Ga0070681_11076158 3300005458 Bacteria 725
51 Ga0068867_100922049 3300005459 Bacteria 787
52 Ga0068867_101180646 3300005459 Bacteria 702
53 Ga0068867_101758288 3300005459 Bacteria 582
54 Ga0070706_102025802 3300005467 Bacteria 521
55 Ga0070679_100084190 3300005530 Bacteria 3168
56 Ga0070679_100568431 3300005530 Bacteria 1077
57 Ga0070684_100508599 3300005535 Bacteria 1116
58 Ga0070684_101930439 3300005535 Bacteria 557
59 Ga0068853_100082770 3300005539 Bacteria 2811
60 Ga0068853_100082771 3300005539 Bacteria 2811
61 Ga0068853_101328630 3300005539 Bacteria 695
62 Ga0068853_101524579 3300005539 Bacteria 647
63 Ga0068853_101900890 3300005539 Bacteria 577
64 Ga0070686_101826647 3300005544 Unclassified 518
65 Ga0070665_100001028 3300005548 Bacteria 34986
66 Ga0070665_100007680 3300005548 Bacteria 10954
67 Ga0070665_100021088 3300005548 Bacteria 6550
68 Ga0070665_100029272 3300005548 Bacteria 5544
69 Ga0070665_101629875 3300005548 Bacteria 653
70 Ga0068855_100074031 3300005563 Bacteria 3956
71 Ga0068855_100086104 3300005563 Bacteria 3634
72 Ga0068855_100694398 3300005563 Bacteria 1089
73 Ga0070664_100363245 3300005564 Bacteria 1319
74 Ga0070664_101532649 3300005564 Bacteria 631
75 Ga0068857_101643730 3300005577 Bacteria 627
76 Ga0068857_101725664 3300005577 Bacteria 612
77 Ga0068854_100534306 3300005578 Bacteria 992
78 Ga0068856_100756351 3300005614 Bacteria 992
79 Ga0068856_100873650 3300005614 Bacteria 918
80 Ga0068852_100058837 3300005616 Bacteria 3330
81 Ga0068852_101267663 3300005616 Bacteria 759
82 Ga0068859_100001153 3300005617 Bacteria 26984
83 Ga0068859_100234342 3300005617 Bacteria 1924
84 Ga0068859_101311188 3300005617 Bacteria 798
85 Ga0068859_102022835 3300005617 Bacteria 636
86 Ga0068864_100000142 3300005618 Bacteria 69641
87 Ga0068864_100000283 3300005618 Bacteria 45450
88 Ga0068864_100046803 3300005618 Bacteria 3712
89 Ga0068864_100381564 3300005618 Bacteria 1336
90 Ga0068864_101901056 3300005618 Bacteria 601
91 Ga0068861_100089133 3300005719 Bacteria 2431
92 Ga0068861_100818762 3300005719 Bacteria 875
93 Ga0068861_101224982 3300005719 Bacteria 727
94 Ga0068851_10651031 3300005834 Bacteria 645
95 Ga0068863_100000091 3300005841 Bacteria 98724
96 Ga0068863_100001727 3300005841 Bacteria 21641
97 Ga0068863_100006424 3300005841 Bacteria 11527
98 Ga0068863_100053093 3300005841 Bacteria 3841
99 Ga0068863_101131007 3300005841 Bacteria 788
100 Ga0068863_102714367 3300005841 Bacteria 504
101 Ga0068858_100000059 3300005842 Bacteria 117158
102 Ga0068858_100003007 3300005842 Bacteria 16907
103 Ga0068858_100005005 3300005842 Bacteria 12987
104 Ga0068858_100220377 3300005842 Bacteria 1796
105 Ga0068858_100556969 3300005842 Bacteria 1110
106 Ga0068858_102489608 3300005842 Unclassified 511
107 Ga0068860_100000421 3300005843 Bacteria 54601
108 Ga0068860_100067464 3300005843 Bacteria 3399
109 Ga0068860_102294003 3300005843 Bacteria 560
110 Ga0068862_100002318 3300005844 Bacteria 16991
111 Ga0068862_100075474 3300005844 Bacteria 2916
112 Ga0068862_100181547 3300005844 Bacteria 1889
113 Ga0068862_101622146 3300005844 Bacteria 654
114 Ga0070717_10077375 3300006028 Bacteria 2785
115 Ga0075365_10338326 3300006038 Bacteria 1060
116 Ga0075365_10876047 3300006038 Bacteria 633
117 Ga0075363_100406261 3300006048 Bacteria 801
118 Ga0075362_10092885 3300006177 Bacteria 1402
119 Ga0075367_10343226 3300006178 Bacteria 942
120 Ga0075369_10510267 3300006186 Bacteria 572
121 Ga0075370_10066744 3300006353 Bacteria 2052
122 Ga0068865_100003021 3300006881 Bacteria 10050
123 Ga0068865_101224048 3300006881 Bacteria 665
124 Ga0097620_100001153 3300006931 Bacteria 26984
125 Ga0097620_100234332 3300006931 Bacteria 1924
126 Ga0097620_101311018 3300006931 Bacteria 798
127 Ga0097620_102022905 3300006931 Bacteria 636
128 Ga0105251_10492391 3300009011 Bacteria 572
129 Ga0105250_10071613 3300009092 Bacteria 1400
130 Ga0105240_10048076 3300009093 Bacteria 5394
131 Ga0105240_10049464 3300009093 Bacteria 5305
132 Ga0105240_10248515 3300009093 Bacteria 2058
133 Ga0105240_10361437 3300009093 Bacteria 1644
134 Ga0105240_10450190 3300009093 Bacteria 1441
135 Ga0105240_11350965 3300009093 Bacteria 750
136 Ga0105240_11541023 3300009093 Bacteria 696
137 Ga0105240_11549365 3300009093 Bacteria 694
138 Ga0111539_12804793 3300009094 Bacteria 564
139 Ga0105245_12840030 3300009098 Bacteria 537
140 Ga0105247_10051022 3300009101 Bacteria 2547
141 Ga0105247_10064869 3300009101 Bacteria 2270
142 Ga0105247_10255325 3300009101 Bacteria 1200
143 Ga0105243_10895346 3300009148 Bacteria 882
144 Ga0105241_10262458 3300009174 Bacteria 1468
145 Ga0105242_10491723 3300009176 Bacteria 1165
146 Ga0105248_10000661 3300009177 Bacteria 39161
147 Ga0105248_10069829 3300009177 Bacteria 3945
148 Ga0105248_10086324 3300009177 Bacteria 3531
149 Ga0105248_10828931 3300009177 Bacteria 1044
150 Ga0105248_10865027 3300009177 Bacteria 1020
151 Ga0105248_12528118 3300009177 Bacteria 585
152 Ga0105237_10079308 3300009545 Bacteria 3273
153 Ga0105237_10491599 3300009545 Bacteria 1233
154 Ga0105237_10711885 3300009545 Bacteria 1011
155 Ga0105237_11469538 3300009545 Bacteria 688
156 Ga0105237_12642140 3300009545 Bacteria 513
157 Ga0105238_10008002 3300009551 Bacteria 10577
158 Ga0105238_10050801 3300009551 Bacteria 4173
159 Ga0105238_10055754 3300009551 Bacteria 3966
160 Ga0105238_10090103 3300009551 Bacteria 3054
161 Ga0105238_10604680 3300009551 Bacteria 1105
162 Ga0105238_10634583 3300009551 Bacteria 1078
163 Ga0105238_10721200 3300009551 Bacteria 1010
164 Ga0105238_11009822 3300009551 Bacteria 853
165 Ga0105238_12342020 3300009551 Bacteria 569
166 Ga0105238_12703364 3300009551 Bacteria 533
167 Ga0105249_10007963 3300009553 Bacteria 9239
168 Ga0105249_10072522 3300009553 Bacteria 3183
169 Ga0105249_10742142 3300009553 Bacteria 1044
170 Ga0105249_11482501 3300009553 Bacteria 751
171 Ga0105249_13017175 3300009553 Unclassified 541
172 Ga0105239_10113704 3300010375 Bacteria 3002
173 Ga0105239_10822075 3300010375 Bacteria 1065
174 Ga0105239_10986813 3300010375 Bacteria 968
175 Ga0105239_11765754 3300010375 Bacteria 716
176 Ga0105239_11853766 3300010375 Bacteria 699
177 Ga0105239_13208592 3300010375 Bacteria 532
178 Ga0105246_11482634 3300011119 Bacteria 636
179 Ga0157373_10383302 3300013100 Bacteria 1006
180 Ga0157370_10070380 3300013104 Bacteria 3302
181 Ga0157370_10091555 3300013104 Bacteria 2855
182 Ga0157370_10333344 3300013104 Bacteria 1399
183 Ga0157369_10975512 3300013105 Bacteria 868
184 Ga0157369_11315323 3300013105 Bacteria 736
185 Ga0157374_12153156 3300013296 Bacteria 585
186 Ga0163162_10033632 3300013306 Bacteria 5096
187 Ga0163162_10045038 3300013306 Bacteria 4420
188 Ga0163162_10334677 3300013306 Bacteria 1646
189 Ga0163162_10696064 3300013306 Bacteria 1138
190 Ga0163162_10870887 3300013306 Bacteria 1015
191 Ga0157372_10212652 3300013307 Bacteria 2241
192 Ga0157372_11902185 3300013307 Bacteria 684
193 Ga0157375_11402794 3300013308 Bacteria 823
194 Ga0157375_12161741 3300013308 Bacteria 663
195 Ga0163163_10005735 3300014325 Bacteria 10771
196 Ga0163163_10144454 3300014325 Bacteria 2422
197 Ga0163163_10173955 3300014325 Bacteria 2199
198 Ga0163163_11478089 3300014325 Bacteria 741
199 Ga0163163_12895698 3300014325 Unclassified 535
200 Ga0157380_11839280 3300014326 Bacteria 665
201 Ga0157379_10024827 3300014968 Bacteria 5321
202 Ga0157379_10031018 3300014968 Bacteria 4762
203 Ga0157379_10311510 3300014968 Bacteria 1436
204 Ga0157379_11622548 3300014968 Bacteria 632
205 Ga0157376_11110204 3300014969 Bacteria 817
206 Ga0157376_12106044 3300014969 Unclassified 602
207 Ga0157376_12736160 3300014969 Bacteria 533
208 Ga0163161_10457030 3300017792 Bacteria 1033
209 Ga0206356_10688762 3300020070 Bacteria 878
210 Ga0213876_10042874 3300021384 Bacteria 2391
211 Ga0209026_1005189 3300025250 Bacteria 3576
212 Ga0209148_1025493 3300025254 Bacteria 925
213 Ga0209233_1028898 3300025261 Bacteria 1324
214 Ga0209758_1002155 3300025297 Bacteria 20717
215 Ga0209050_1001136 3300025298 Bacteria 32037
216 Ga0209257_1001224 3300025304 Bacteria 32015
217 Ga0209257_1002160 3300025304 Bacteria 20420
218 Ga0207697_10082735 3300025315 Bacteria 1354
219 Ga0207710_10040747 3300025900 Bacteria 2058
220 Ga0207710_10073159 3300025900 Bacteria 1575
221 Ga0207710_10163545 3300025900 Bacteria 1085
222 Ga0207680_10030084 3300025903 Bacteria 3058
223 Ga0207680_10926740 3300025903 Bacteria 624
224 Ga0207647_10595955 3300025904 Bacteria 610
225 Ga0207643_10763633 3300025908 Bacteria 626
226 Ga0207705_10001605 3300025909 Bacteria 17958
227 Ga0207705_10120978 3300025909 Bacteria 1942
228 Ga0207705_10691696 3300025909 Bacteria 793
229 Ga0207705_11205656 3300025909 Bacteria 580
230 Ga0207707_10021959 3300025912 Bacteria 5578
231 Ga0207707_10054056 3300025912 Bacteria 3495
232 Ga0207707_10058209 3300025912 Bacteria 3363
233 Ga0207695_10003703 3300025913 Bacteria 21297
234 Ga0207695_10005749 3300025913 Bacteria 16329
235 Ga0207695_10012854 3300025913 Bacteria 10022
236 Ga0207695_10346007 3300025913 Bacteria 1374
237 Ga0207695_10728133 3300025913 Bacteria 872
238 Ga0207695_11533571 3300025913 Bacteria 547
239 Ga0207671_10559165 3300025914 Bacteria 912
240 Ga0207671_11566860 3300025914 Bacteria 507
241 Ga0207660_10001381 3300025917 Bacteria 16280
242 Ga0207660_10018742 3300025917 Bacteria 4619
243 Ga0207660_10135520 3300025917 Bacteria 1878
244 Ga0207657_10031333 3300025919 Bacteria 4818
245 Ga0207657_10076849 3300025919 Bacteria 2816
246 Ga0207657_11210921 3300025919 Bacteria 574
247 Ga0207649_10143377 3300025920 Bacteria 1637
248 Ga0207652_10009245 3300025921 Bacteria 7927
249 Ga0207652_10684895 3300025921 Bacteria 915
250 Ga0207681_10137460 3300025923 Bacteria 1815
251 Ga0207681_11450348 3300025923 Bacteria 576
252 Ga0207694_10012978 3300025924 Bacteria 6272
253 Ga0207694_10021272 3300025924 Bacteria 4915
254 Ga0207694_10068397 3300025924 Bacteria 2773
255 Ga0207694_10439333 3300025924 Bacteria 1088
256 Ga0207694_10507610 3300025924 Bacteria 1010
257 Ga0207694_10612250 3300025924 Bacteria 916
258 Ga0207694_11198249 3300025924 Bacteria 642
259 Ga0207694_11774808 3300025924 Bacteria 519
260 Ga0207650_10003370 3300025925 Bacteria 10998
261 Ga0207650_10262275 3300025925 Bacteria 1402
262 Ga0207644_10002697 3300025931 Bacteria 11439
263 Ga0207644_10037200 3300025931 Bacteria 3423
264 Ga0207690_10000650 3300025932 Bacteria 22303
265 Ga0207690_10027003 3300025932 Bacteria 3623
266 Ga0207690_10259484 3300025932 Bacteria 1346
267 Ga0207706_10405831 3300025933 Bacteria 1181
268 Ga0207706_10905004 3300025933 Bacteria 745
269 Ga0207686_10370058 3300025934 Bacteria 1084
270 Ga0207686_10531624 3300025934 Bacteria 917
271 Ga0207669_10388444 3300025937 Bacteria 1090
272 Ga0207669_11889452 3300025937 Unclassified 510
273 Ga0207704_10000508 3300025938 Bacteria 17330
274 Ga0207711_10000316 3300025941 Bacteria 51683
275 Ga0207711_10010576 3300025941 Bacteria 7671
276 Ga0207711_10025718 3300025941 Bacteria 4936
277 Ga0207711_10585631 3300025941 Bacteria 1041
278 Ga0207661_10797845 3300025944 Bacteria 869
279 Ga0207679_11340481 3300025945 Bacteria 657
280 Ga0207679_11571215 3300025945 Bacteria 603
281 Ga0207667_10010216 3300025949 Bacteria 10995
282 Ga0207667_10265732 3300025949 Bacteria 1754
283 Ga0207667_11532673 3300025949 Bacteria 637
284 Ga0207651_11133083 3300025960 Bacteria 701
285 Ga0207712_10030460 3300025961 Bacteria 3628
286 Ga0207712_10095330 3300025961 Bacteria 2200
287 Ga0207712_10166955 3300025961 Bacteria 1716
288 Ga0207712_10209139 3300025961 Bacteria 1552
289 Ga0207668_10000001 3300025972 Bacteria 266091
290 Ga0207668_10000419 3300025972 Bacteria 26826
291 Ga0207668_10000936 3300025972 Bacteria 17552
292 Ga0207640_11262369 3300025981 Bacteria 658
293 Ga0207658_10001851 3300025986 Bacteria 15838
294 Ga0207658_10008252 3300025986 Bacteria 7095
295 Ga0207658_10030346 3300025986 Bacteria 3826
296 Ga0207703_10000049 3300026035 Bacteria 149817
297 Ga0207703_10006875 3300026035 Bacteria 9058
298 Ga0207703_10010904 3300026035 Bacteria 7084
299 Ga0207703_10295341 3300026035 Bacteria 1476
300 Ga0207703_10805331 3300026035 Bacteria 897
301 Ga0207639_10014988 3300026041 Bacteria 5462
302 Ga0207639_10028193 3300026041 Bacteria 4098
303 Ga0207639_10200991 3300026041 Bacteria 1709
304 Ga0207639_10668548 3300026041 Bacteria 962
305 Ga0207639_10729081 3300026041 Bacteria 921
306 Ga0207639_10935153 3300026041 Bacteria 811
307 Ga0207639_11018801 3300026041 Bacteria 776
308 Ga0207639_11806296 3300026041 Bacteria 572
309 Ga0207702_10382189 3300026078 Bacteria 1354
310 Ga0207702_10393651 3300026078 Bacteria 1335
311 Ga0207702_11006009 3300026078 Bacteria 827
312 Ga0207702_12504589 3300026078 Bacteria 502
313 Ga0207641_10000011 3300026088 Bacteria 384362
314 Ga0207641_10004115 3300026088 Bacteria 12681
315 Ga0207641_10004179 3300026088 Bacteria 12578
316 Ga0207641_10086187 3300026088 Bacteria 2738
317 Ga0207648_11297828 3300026089 Bacteria 684
318 Ga0207676_10000073 3300026095 Bacteria 101510
319 Ga0207676_10000503 3300026095 Bacteria 32970
320 Ga0207676_10023314 3300026095 Bacteria 4565
321 Ga0207676_10652807 3300026095 Bacteria 1015
322 Ga0207676_11130424 3300026095 Bacteria 775
323 Ga0207676_11783650 3300026095 Bacteria 614
324 Ga0207674_11017839 3300026116 Bacteria 798
325 Ga0207674_11827953 3300026116 Bacteria 574
326 Ga0207675_100045042 3300026118 Bacteria 4122
327 Ga0207675_100382510 3300026118 Unclassified 1384
328 Ga0207675_101007615 3300026118 Bacteria 851
329 Ga0207683_11079881 3300026121 Bacteria 745
330 Ga0207698_10806738 3300026142 Bacteria 941
331 Ga0207698_12490326 3300026142 Bacteria 528
332 Ga0209973_1026991 3300027252 Bacteria 793
333 Ga0209967_1039048 3300027364 Bacteria 720
334 Ga0209981_1006178 3300027378 Bacteria 1599
335 Ga0210000_1040605 3300027462 Bacteria 738
336 Ga0209999_1003700 3300027543 Bacteria 2739
337 Ga0209983_1050744 3300027665 Bacteria 908
338 Ga0268266_10000189 3300028379 Bacteria 109217
339 Ga0268266_10001279 3300028379 Bacteria 30711
340 Ga0268266_10004283 3300028379 Bacteria 13735
341 Ga0268266_10072209 3300028379 Bacteria 2992
342 Ga0268266_10232341 3300028379 Bacteria 1699
343 Ga0268266_11769173 3300028379 Bacteria 593
344 Ga0268265_10001948 3300028380 Bacteria 16397
345 Ga0268265_10013679 3300028380 Bacteria 5520
346 Ga0268265_10098309 3300028380 Bacteria 2357
347 Ga0268264_10000068 3300028381 Bacteria 275708
348 Ga0307517_10010570 3300028786 Bacteria 12908
349 Ga0307517_10044495 3300028786 Bacteria 4693
350 Ga0307517_10116615 3300028786 Bacteria 1998
351 Ga0307517_10242327 3300028786 Bacteria 1068
352 Ga0265338_10019378 3300028800 Bacteria 7220
353 Ga0307511_10034782 3300030521 Bacteria 4415
354 Ga0265327_10000198 3300031251 Bacteria 126077
355 Ga0307513_10003807 3300031456 Bacteria 20334
356 Ga0307513_10011018 3300031456 Bacteria 11279
357 Ga0307513_10414850 3300031456 Bacteria 1078
358 Ga0307513_10592868 3300031456 Bacteria 818
359 Ga0307508_10691170 3300031616 Bacteria 629
360 Ga0307516_10000035 3300031730 Bacteria 152658
361 Ga0307510_10007326 3300033180 Bacteria 13142
362 Ga0307510_10401998 3300033180 Bacteria 813
363 Ga0373938_0217763 3300034957 Bacteria 535
364 Ga0373936_0005003 3300035113 Bacteria 4993
365 Ga0395899_0065469 3300037312 Bacteria 2671
366 Ga0395900_0007156 3300037418 Bacteria 11565
367 Ga0395898_0061679 3300037466 Bacteria 3643
368 Ga0395905_0338600 3300037471 Bacteria 1395
369 Ga0395905_0580504 3300037471 Bacteria 1022
370 Ga0395905_0889753 3300037471 Bacteria 793
371 Ga0395905_1567189 3300037471 Bacteria 563
372 Ga0395905_1773009 3300037471 Unclassified 523
373 Ga0395901_0031220 3300038443 Bacteria 5493
374 Ga0395901_0463289 3300038443 Bacteria 1295
375 Ga0436365_0884578 3300039437 Bacteria 509
376 Ga0436365_1369582 3300039437 Bacteria 1581
377 Ga0453684_0605680 3300044712 Bacteria 1200
378 Ga0466968_0094532 3300044735 Bacteria 1329
379 Ga0495590_0334354 3300046457 Bacteria 574
380 Ga0495629_0028298 3300046459 Bacteria 3979
381 Ga0495629_0923539 3300046459 Bacteria 571
382 Ga0495638_0439213 3300046460 Bacteria 669
383 Ga0495583_0037225 3300046506 Bacteria 2308
384 Ga0495620_0015635 3300046515 Bacteria 3825
385 Ga0495620_0088003 3300046515 Bacteria 1249
386 Ga0495628_0521980 3300046516 Bacteria 855
387 Ga0495630_1191124 3300046517 Bacteria 576
388 Ga0495631_0355150 3300046518 Bacteria 624
389 Ga0495643_0030734 3300046522 Bacteria 2996
390 Ga0495648_0326644 3300046524 Bacteria 709
391 Ga0495663_0056108 3300046525 Bacteria 1230
392 Ga0495642_0324750 3300046528 Bacteria 675
393 Ga0495642_0566108 3300046528 Bacteria 504
394 Ga0495665_0193973 3300046531 Bacteria 1054
395 Ga0495609_0118500 3300046538 Bacteria 1139
396 Ga0495597_0001757 3300046542 Bacteria 14899
397 Ga0495645_0050115 3300046543 Bacteria 3040
398 Ga0495622_0000786 3300046557 Bacteria 17667
399 Ga0495668_0065851 3300046616 Bacteria 1994
400 Ga0495668_0126798 3300046616 Bacteria 1397
401 Ga0495668_0133627 3300046616 Bacteria 1358
402 Ga0495668_0158376 3300046616 Bacteria 1240
403 Ga0495668_0194696 3300046616 Bacteria 1110
404 Ga0495668_0250956 3300046616 Bacteria 969
405 Ga0495668_0561763 3300046616 Bacteria 630
406 Ga0495611_0571045 3300046648 Bacteria 512
407 Ga0495625_0062458 3300046660 Bacteria 2632
408 Ga0495625_0274893 3300046660 Bacteria 1086
409 Ga0495625_0275697 3300046660 Bacteria 1084
410 Ga0495625_0344087 3300046660 Bacteria 944
411 Ga0495625_0368330 3300046660 Bacteria 904
412 Ga0495625_0684335 3300046660 Bacteria 607
413 Ga0495625_0810420 3300046660 Bacteria 544
414 Ga0495659_0149164 3300046664 Bacteria 938
415 Ga0495588_0412217 3300046674 Bacteria 709
416 Ga0495623_0662563 3300046679 Unclassified 537
417 Ga0495669_0000002 3300046684 Bacteria 282777
418 Ga0495669_0001650 3300046684 Bacteria 9170
419 Ga0495669_0015332 3300046684 Bacteria 3282
420 Ga0495624_0186583 3300046690 Bacteria 1262
421 Ga0495670_0682261 3300046691 Bacteria 560
422 Ga0495649_0195214 3300046694 Bacteria 1053
423 Ga0495581_0330755 3300047315 Bacteria 890
424 Ga0495674_0570985 3300047319 Bacteria 898
425 Ga0495672_0093075 3300047320 Bacteria 1651
426 Ga0495676_0620290 3300047321 Bacteria 703
427 Ga0495687_015498 3300047443 Bacteria 3873
428 Ga0495677_0352746 3300047445 Bacteria 580
429 Ga0495673_0325402 3300047469 Bacteria 547
430 Ga0495681_0070413 3300047470 Bacteria 1586
431 Ga0495684_0995269 3300047471 Bacteria 533
432 Ga0495686_0030547 3300047472 Bacteria 3498
433 Ga0495686_0229231 3300047472 Bacteria 1053
434 Ga0495593_0220251 3300047673 Bacteria 952
435 Ga0495602_0378088 3300048088 Bacteria 1015
436 Ga0496100_0575428 3300048903 Bacteria 873
437 Ga0496100_0602741 3300048903 Bacteria 853
438 Ga0496100_0912894 3300048903 Bacteria 690
439 Ga0496101_0445415 3300048904 Bacteria 1022
440 Ga0496102_1598628 3300048905 Bacteria 570
441 Ga0496112_0060918 3300048915 Bacteria 3719
442 Ga0496115_0001097 3300048918 Bacteria 19591
443 Ga0496115_0009978 3300048918 Bacteria 7075
444 Ga0496115_0169845 3300048918 Bacteria 1803
445 Ga0496115_0170544 3300048918 Bacteria 1800
446 Ga0496116_0275716 3300048919 Bacteria 818
447 Ga0496117_0034239 3300048920 Bacteria 3830
448 Ga0496118_0017353 3300048921 Bacteria 6554
449 Ga0496119_0026476 3300048922 Bacteria 4020
450 Ga0496121_0044658 3300048924 Bacteria 3818
451 Ga0495682_0092638 3300049460 Bacteria 1085
452 Ga0501032_0043129 3300049569 Bacteria 3057
453 Ga0501032_0434236 3300049569 Bacteria 842
454 Ga0501033_0390250 3300049570 Bacteria 972
455 Ga0501034_0293330 3300049571 Bacteria 1564
456 Ga0501036_0910651 3300049572 Bacteria 721
457 Ga0501038_0672087 3300049574 Bacteria 778
458 Ga0501044_0026958 3300049823 Bacteria 6079
459 nmdc:mga03683_68568_c1 3300050489 Bacteria 1512
460 nmdc:mga03n38_100886_c1 3300050490 Bacteria 1392
461 nmdc:mga0yw44_1127832_c1 3300050492 Bacteria 530
462 nmdc:mga0k408_131714_c1 3300050493 Bacteria 1484
463 nmdc:mga06z11_292952_c1 3300050494 Bacteria 966
464 nmdc:mga0sz30_459021_c1 3300050516 Bacteria 572
465 Ga0500635_0000060 3300053080 Bacteria 72066
466 Ga0500578_0385594 3300053086 Bacteria 811
467 Ga0500644_0366601 3300053088 Bacteria 625
468 Ga0500647_0213454 3300053091 Bacteria 868
469 Ga0500583_0136382 3300053092 Bacteria 1218
470 Ga0500651_0208208 3300053093 Bacteria 1151
471 Ga0500566_0018872 3300053094 Bacteria 4049
472 Ga0500641_0235236 3300053096 Bacteria 773
473 Ga0500654_083800 3300053099 Bacteria 1467
474 Ga0500557_129438 3300053105 Bacteria 836
475 Ga0500562_002359 3300053108 Bacteria 4742
476 Ga0500569_000827 3300053109 Bacteria 5481
477 Ga0500572_244774 3300053111 Unclassified 584
478 Ga0500594_0202744 3300053118 Bacteria 652
479 Ga0500595_004593 3300053119 Bacteria 6161
480 Ga0500595_039529 3300053119 Bacteria 1526
481 Ga0500595_065564 3300053119 Bacteria 1087
482 Ga0500597_147773 3300053120 Bacteria 1010
483 Ga0500607_268146 3300053121 Bacteria 662
484 Ga0500608_055890 3300053122 Bacteria 1891
485 Ga0500614_001585 3300053123 Bacteria 5373
486 Ga0500642_0027509 3300053130 Bacteria 2335
487 Ga0500655_135021 3300053133 Bacteria 528
488 Ga0500658_0162569 3300053134 Bacteria 1011
489 Ga0500559_0002573 3300053136 Bacteria 9292
490 Ga0500590_165467 3300053148 Bacteria 979
491 Ga0500616_0048989 3300053153 Bacteria 2237
492 Ga0500619_067366 3300053154 Bacteria 1186
493 Ga0500620_119489 3300053155 Bacteria 923
494 Ga0500624_128076 3300053157 Unclassified 536
495 Ga0500636_0015775 3300053177 Bacteria 4452
496 Ga0500637_0025320 3300053178 Bacteria 3259
497 Ga0500637_0272463 3300053178 Bacteria 935
498 Ga0500576_172932 3300053725 Bacteria 774
499 Ga0500645_049285 3300053730 Bacteria 1232
500 Ga0500596_001191 3300053735 Bacteria 5253
501 Ga0500661_036823 3300055283 Bacteria 866
502 Ga0587111_0141101 3300060346 Bacteria 639

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025913 Ga0207695_10346007 Ga0207695_103460072 60
2 3300046684 Ga0495669_0001650 Ga0495669_0001650_1814_2023 62
3 3300047445 Ga0495677_0352746 Ga0495677_0352746_251_460 62
4 iso_pu_bacteria 2643221614 2644087180 63
5 iso_pu_bacteria 2643221661 2644342134 63
6 iso_pu_bacteria 2643221666 2644368420 63
7 3300005530 Ga0070679_100084190 Ga0070679_1000841903 64
8 3300005539 Ga0068853_101524579 Ga0068853_1015245792 64
9 3300005841 Ga0068863_101131007 Ga0068863_1011310072 64
10 3300006028 Ga0070717_10077375 Ga0070717_100773753 64
11 3300009176 Ga0105242_10491723 Ga0105242_104917232 64
12 3300009177 Ga0105248_10000661 Ga0105248_1000066132 64
13 3300010375 Ga0105239_11765754 Ga0105239_117657542 64
14 3300011119 Ga0105246_11482634 Ga0105246_114826342 64
15 3300013306 Ga0163162_10870887 Ga0163162_108708872 64
16 3300014969 Ga0157376_11110204 Ga0157376_111102042 64
17 3300025934 Ga0207686_10370058 Ga0207686_103700582 64
18 3300025934 Ga0207686_10531624 Ga0207686_105316242 64
19 3300025941 Ga0207711_10000316 Ga0207711_1000031648 64
20 3300026041 Ga0207639_10668548 Ga0207639_106685482 64
21 3300026121 Ga0207683_11079881 Ga0207683_110798812 64
22 3300027252 Ga0209973_1026991 Ga0209973_10269911 64
23 3300027364 Ga0209967_1039048 Ga0209967_10390481 64
24 3300027378 Ga0209981_1006178 Ga0209981_10061782 64
25 3300027462 Ga0210000_1040605 Ga0210000_10406051 64
26 3300027543 Ga0209999_1003700 Ga0209999_10037004 64
27 3300027665 Ga0209983_1050744 Ga0209983_10507442 64
28 3300031616 Ga0307508_10691170 Ga0307508_106911702 64
29 3300035113 Ga0373936_0005003 Ga0373936_0005003_4357_4551 64
30 3300048918 Ga0496115_0001097 Ga0496115_0001097_2800_2994 64
31 3300049569 Ga0501032_0043129 Ga0501032_0043129_155_349 64
32 3300049574 Ga0501038_0672087 Ga0501038_0672087_524_718 64
33 3300053119 Ga0500595_065564 Ga0500595_065564_211_405 64
34 3300005327 Ga0070658_11522667 Ga0070658_115226672 65
35 3300005328 Ga0070676_11219326 Ga0070676_112193262 65
36 3300005337 Ga0070682_100812114 Ga0070682_1008121142 65
37 3300005459 Ga0068867_101758288 Ga0068867_1017582882 65
38 3300005617 Ga0068859_101311188 Ga0068859_1013111882 65
39 3300006931 Ga0097620_101311018 Ga0097620_1013110182 65
40 3300009098 Ga0105245_12840030 Ga0105245_128400302 65
41 3300009177 Ga0105248_12528118 Ga0105248_125281181 65
42 3300014969 Ga0157376_12736160 Ga0157376_127361602 65
43 3300025909 Ga0207705_11205656 Ga0207705_112056562 65
44 3300026142 Ga0207698_12490326 Ga0207698_124903262 65
45 3300049571 Ga0501034_0293330 Ga0501034_0293330_40_240 65
46 3300053105 Ga0500557_129438 Ga0500557_129438_88_288 65
47 3300053153 Ga0500616_0048989 Ga0500616_0048989_1923_2123 65
48 3300005295 Ga0065707_10984542 Ga0065707_109845422 66
49 3300005347 Ga0070668_101792022 Ga0070668_1017920221 66
50 3300005844 Ga0068862_101622146 Ga0068862_1016221461 66
51 3300005327 Ga0070658_11823822 Ga0070658_118238221 67
52 3300005328 Ga0070676_11333266 Ga0070676_113332662 67
53 3300005331 Ga0070670_100052230 Ga0070670_1000522305 67
54 3300005335 Ga0070666_10407853 Ga0070666_104078532 67
55 3300005347 Ga0070668_100001526 Ga0070668_10000152611 67
56 3300005353 Ga0070669_100018780 Ga0070669_1000187803 67
57 3300005353 Ga0070669_101611341 Ga0070669_1016113411 67
58 3300005355 Ga0070671_100003043 Ga0070671_10000304311 67
59 3300005355 Ga0070671_100132630 Ga0070671_1001326302 67
60 3300005367 Ga0070667_100060263 Ga0070667_1000602635 67
61 3300005467 Ga0070706_102025802 Ga0070706_1020258022 67
62 3300005548 Ga0070665_100021088 Ga0070665_1000210883 67
63 3300005564 Ga0070664_100363245 Ga0070664_1003632452 67
64 3300005617 Ga0068859_100001153 Ga0068859_10000115312 67
65 3300005618 Ga0068864_100046803 Ga0068864_1000468031 67
66 3300005618 Ga0068864_100381564 Ga0068864_1003815642 67
67 3300005719 Ga0068861_100818762 Ga0068861_1008187622 67
68 3300005841 Ga0068863_100006424 Ga0068863_1000064244 67
69 3300005841 Ga0068863_100053093 Ga0068863_1000530933 67
70 3300005841 Ga0068863_102714367 Ga0068863_1027143672 67
71 3300005842 Ga0068858_100003007 Ga0068858_1000030078 67
72 3300005842 Ga0068858_100220377 Ga0068858_1002203774 67
73 3300005842 Ga0068858_102489608 Ga0068858_1024896081 67
74 3300005843 Ga0068860_100067464 Ga0068860_1000674645 67
75 3300005844 Ga0068862_100075474 Ga0068862_1000754742 67
76 3300006931 Ga0097620_100001153 Ga0097620_10000115312 67
77 3300009101 Ga0105247_10255325 Ga0105247_102553253 67
78 3300009177 Ga0105248_10086324 Ga0105248_100863245 67
79 3300009177 Ga0105248_10865027 Ga0105248_108650272 67
80 3300009553 Ga0105249_10742142 Ga0105249_107421422 67
81 3300010375 Ga0105239_11853766 Ga0105239_118537662 67
82 3300013296 Ga0157374_12153156 Ga0157374_121531562 67
83 3300013306 Ga0163162_10033632 Ga0163162_100336325 67
84 3300013306 Ga0163162_10334677 Ga0163162_103346772 67
85 3300013308 Ga0157375_11402794 Ga0157375_114027942 67
86 3300014325 Ga0163163_10005735 Ga0163163_1000573512 67
87 3300014325 Ga0163163_11478089 Ga0163163_114780892 67
88 3300014968 Ga0157379_10024827 Ga0157379_100248274 67
89 3300025261 Ga0209233_1028898 Ga0209233_10288982 67
90 3300025900 Ga0207710_10163545 Ga0207710_101635451 67
91 3300025923 Ga0207681_10137460 Ga0207681_101374603 67
92 3300025923 Ga0207681_11450348 Ga0207681_114503482 67
93 3300025931 Ga0207644_10002697 Ga0207644_100026974 67
94 3300025931 Ga0207644_10037200 Ga0207644_100372003 67
95 3300025941 Ga0207711_10025718 Ga0207711_100257185 67
96 3300025945 Ga0207679_11571215 Ga0207679_115712152 67
97 3300025960 Ga0207651_11133083 Ga0207651_111330832 67
98 3300025961 Ga0207712_10095330 Ga0207712_100953303 67
99 3300025961 Ga0207712_10209139 Ga0207712_102091393 67
100 3300025972 Ga0207668_10000936 Ga0207668_100009368 67
101 3300025986 Ga0207658_10030346 Ga0207658_100303465 67
102 3300026035 Ga0207703_10010904 Ga0207703_100109048 67
103 3300026035 Ga0207703_10295341 Ga0207703_102953413 67
104 3300026088 Ga0207641_10004115 Ga0207641_100041156 67
105 3300026088 Ga0207641_10086187 Ga0207641_100861873 67
106 3300026095 Ga0207676_10023314 Ga0207676_100233145 67
107 3300026095 Ga0207676_10652807 Ga0207676_106528072 67
108 3300026095 Ga0207676_11130424 Ga0207676_111304242 67
109 3300026118 Ga0207675_100045042 Ga0207675_1000450422 67
110 3300028379 Ga0268266_10072209 Ga0268266_100722093 67
111 3300028379 Ga0268266_10232341 Ga0268266_102323412 67
112 3300028380 Ga0268265_10098309 Ga0268265_100983094 67
113 3300028786 Ga0307517_10010570 Ga0307517_100105707 67
114 3300028786 Ga0307517_10044495 Ga0307517_100444953 67
115 3300028786 Ga0307517_10242327 Ga0307517_102423272 67
116 3300031251 Ga0265327_10000198 Ga0265327_1000019889 67
117 3300031456 Ga0307513_10003807 Ga0307513_1000380712 67
118 3300031456 Ga0307513_10011018 Ga0307513_100110187 67
119 3300033180 Ga0307510_10007326 Ga0307510_100073265 67
120 3300034957 Ga0373938_0217763 Ga0373938_0217763_289_492 67
121 3300037471 Ga0395905_1773009 Ga0395905_1773009_189_392 67
122 3300038443 Ga0395901_0463289 Ga0395901_0463289_590_796 67
123 3300046457 Ga0495590_0334354 Ga0495590_0334354_361_564 67
124 3300046460 Ga0495638_0439213 Ga0495638_0439213_82_285 67
125 3300046506 Ga0495583_0037225 Ga0495583_0037225_670_873 67
126 3300046517 Ga0495630_1191124 Ga0495630_1191124_264_473 67
127 3300046518 Ga0495631_0355150 Ga0495631_0355150_36_239 67
128 3300046524 Ga0495648_0326644 Ga0495648_0326644_270_473 67
129 3300046528 Ga0495642_0324750 Ga0495642_0324750_18_221 67
130 3300046528 Ga0495642_0566108 Ga0495642_0566108_116_319 67
131 3300046616 Ga0495668_0065851 Ga0495668_0065851_522_725 67
132 3300046616 Ga0495668_0250956 Ga0495668_0250956_727_930 67
133 3300046648 Ga0495611_0571045 Ga0495611_0571045_82_285 67
134 3300046660 Ga0495625_0062458 Ga0495625_0062458_852_1055 67
135 3300046660 Ga0495625_0274893 Ga0495625_0274893_522_725 67
136 3300046660 Ga0495625_0684335 Ga0495625_0684335_324_527 67
137 3300046664 Ga0495659_0149164 Ga0495659_0149164_19_222 67
138 3300046684 Ga0495669_0015332 Ga0495669_0015332_1840_2043 67
139 3300047320 Ga0495672_0093075 Ga0495672_0093075_504_707 67
140 3300047469 Ga0495673_0325402 Ga0495673_0325402_282_485 67
141 3300047470 Ga0495681_0070413 Ga0495681_0070413_742_945 67
142 3300047471 Ga0495684_0995269 Ga0495684_0995269_160_369 67
143 3300047472 Ga0495686_0229231 Ga0495686_0229231_386_589 67
144 3300048903 Ga0496100_0602741 Ga0496100_0602741_28_234 67
145 3300048915 Ga0496112_0060918 Ga0496112_0060918_2291_2494 67
146 3300048918 Ga0496115_0170544 Ga0496115_0170544_134_337 67
147 3300053118 Ga0500594_0202744 Ga0500594_0202744_182_385 67
148 3300060346 Ga0587111_0141101 Ga0587111_0141101_321_527 67
149 3300002459 JGI24751J29686_10139656 JGI24751J29686_101396561 68
150 3300002741 JGI25157J39369_1004666 JGI25157J39369_10046665 68
151 3300003791 Ga0055530_10000571 Ga0055530_1000057120 68
152 3300003794 Ga0055531_10010712 Ga0055531_100107125 68
153 3300004625 Ga0055543_1031511 Ga0055543_10315112 68
154 3300005262 Ga0065165_1003949 Ga0065165_10039496 68
155 3300005327 Ga0070658_10301182 Ga0070658_103011822 68
156 3300005327 Ga0070658_10387511 Ga0070658_103875112 68
157 3300005329 Ga0070683_101067175 Ga0070683_1010671752 68
158 3300005330 Ga0070690_101776173 Ga0070690_1017761731 68
159 3300005331 Ga0070670_100000013 Ga0070670_100000013180 68
160 3300005335 Ga0070666_10112866 Ga0070666_101128662 68
161 3300005336 Ga0070680_100082776 Ga0070680_1000827762 68
162 3300005336 Ga0070680_100114065 Ga0070680_1001140652 68
163 3300005336 Ga0070680_100238896 Ga0070680_1002388962 68
164 3300005336 Ga0070680_101808433 Ga0070680_1018084332 68
165 3300005339 Ga0070660_100060427 Ga0070660_1000604273 68
166 3300005339 Ga0070660_100627543 Ga0070660_1006275431 68
167 3300005339 Ga0070660_100955062 Ga0070660_1009550622 68
168 3300005339 Ga0070660_101562998 Ga0070660_1015629982 68
169 3300005340 Ga0070689_100103639 Ga0070689_1001036393 68
170 3300005341 Ga0070691_10018090 Ga0070691_100180903 68
171 3300005347 Ga0070668_100003606 Ga0070668_10000360610 68
172 3300005347 Ga0070668_100013026 Ga0070668_1000130267 68
173 3300005356 Ga0070674_100600093 Ga0070674_1006000932 68
174 3300005356 Ga0070674_101169521 Ga0070674_1011695211 68
175 3300005366 Ga0070659_100004901 Ga0070659_1000049015 68
176 3300005366 Ga0070659_100031856 Ga0070659_1000318563 68
177 3300005366 Ga0070659_100297471 Ga0070659_1002974712 68
178 3300005367 Ga0070667_100013998 Ga0070667_1000139986 68
179 3300005457 Ga0070662_100961971 Ga0070662_1009619711 68
180 3300005458 Ga0070681_10008232 Ga0070681_100082322 68
181 3300005458 Ga0070681_10047452 Ga0070681_100474524 68
182 3300005458 Ga0070681_10131168 Ga0070681_101311682 68
183 3300005458 Ga0070681_11076158 Ga0070681_110761581 68
184 3300005459 Ga0068867_100922049 Ga0068867_1009220492 68
185 3300005459 Ga0068867_101180646 Ga0068867_1011806462 68
186 3300005530 Ga0070679_100568431 Ga0070679_1005684312 68
187 3300005535 Ga0070684_100508599 Ga0070684_1005085992 68
188 3300005535 Ga0070684_101930439 Ga0070684_1019304392 68
189 3300005539 Ga0068853_100082770 Ga0068853_1000827703 68
190 3300005539 Ga0068853_100082771 Ga0068853_1000827713 68
191 3300005539 Ga0068853_101328630 Ga0068853_1013286301 68
192 3300005539 Ga0068853_101900890 Ga0068853_1019008901 68
193 3300005544 Ga0070686_101826647 Ga0070686_1018266472 68
194 3300005548 Ga0070665_100001028 Ga0070665_10000102834 68
195 3300005548 Ga0070665_100007680 Ga0070665_10000768011 68
196 3300005548 Ga0070665_100029272 Ga0070665_1000292724 68
197 3300005548 Ga0070665_101629875 Ga0070665_1016298752 68
198 3300005563 Ga0068855_100074031 Ga0068855_1000740312 68
199 3300005563 Ga0068855_100086104 Ga0068855_1000861044 68
200 3300005563 Ga0068855_100694398 Ga0068855_1006943982 68
201 3300005564 Ga0070664_101532649 Ga0070664_1015326492 68
202 3300005577 Ga0068857_101643730 Ga0068857_1016437301 68
203 3300005577 Ga0068857_101725664 Ga0068857_1017256641 68
204 3300005578 Ga0068854_100534306 Ga0068854_1005343062 68
205 3300005614 Ga0068856_100756351 Ga0068856_1007563512 68
206 3300005614 Ga0068856_100873650 Ga0068856_1008736502 68
207 3300005616 Ga0068852_100058837 Ga0068852_1000588371 68
208 3300005616 Ga0068852_101267663 Ga0068852_1012676632 68
209 3300005617 Ga0068859_100234342 Ga0068859_1002343423 68
210 3300005617 Ga0068859_102022835 Ga0068859_1020228351 68
211 3300005618 Ga0068864_100000142 Ga0068864_10000014212 68
212 3300005618 Ga0068864_100000283 Ga0068864_10000028325 68
213 3300005618 Ga0068864_101901056 Ga0068864_1019010561 68
214 3300005719 Ga0068861_100089133 Ga0068861_1000891332 68
215 3300005719 Ga0068861_101224982 Ga0068861_1012249822 68
216 3300005834 Ga0068851_10651031 Ga0068851_106510312 68
217 3300005841 Ga0068863_100000091 Ga0068863_10000009179 68
218 3300005841 Ga0068863_100001727 Ga0068863_10000172712 68
219 3300005842 Ga0068858_100000059 Ga0068858_10000005944 68
220 3300005842 Ga0068858_100005005 Ga0068858_1000050059 68
221 3300005842 Ga0068858_100556969 Ga0068858_1005569692 68
222 3300005843 Ga0068860_100000421 Ga0068860_10000042147 68
223 3300005843 Ga0068860_102294003 Ga0068860_1022940032 68
224 3300005844 Ga0068862_100002318 Ga0068862_1000023186 68
225 3300005844 Ga0068862_100181547 Ga0068862_1001815472 68
226 3300006038 Ga0075365_10338326 Ga0075365_103383262 68
227 3300006038 Ga0075365_10876047 Ga0075365_108760472 68
228 3300006048 Ga0075363_100406261 Ga0075363_1004062612 68
229 3300006177 Ga0075362_10092885 Ga0075362_100928852 68
230 3300006178 Ga0075367_10343226 Ga0075367_103432262 68
231 3300006186 Ga0075369_10510267 Ga0075369_105102671 68
232 3300006353 Ga0075370_10066744 Ga0075370_100667442 68
233 3300006881 Ga0068865_100003021 Ga0068865_1000030215 68
234 3300006881 Ga0068865_101224048 Ga0068865_1012240482 68
235 3300006931 Ga0097620_100234332 Ga0097620_1002343323 68
236 3300006931 Ga0097620_102022905 Ga0097620_1020229052 68
237 3300009011 Ga0105251_10492391 Ga0105251_104923912 68
238 3300009092 Ga0105250_10071613 Ga0105250_100716133 68
239 3300009093 Ga0105240_10048076 Ga0105240_100480765 68
240 3300009093 Ga0105240_10049464 Ga0105240_100494644 68
241 3300009093 Ga0105240_10248515 Ga0105240_102485153 68
242 3300009093 Ga0105240_10361437 Ga0105240_103614372 68
243 3300009093 Ga0105240_10450190 Ga0105240_104501902 68
244 3300009093 Ga0105240_11350965 Ga0105240_113509652 68
245 3300009093 Ga0105240_11541023 Ga0105240_115410231 68
246 3300009093 Ga0105240_11549365 Ga0105240_115493652 68
247 3300009094 Ga0111539_12804793 Ga0111539_128047932 68
248 3300009101 Ga0105247_10051022 Ga0105247_100510223 68
249 3300009101 Ga0105247_10064869 Ga0105247_100648692 68
250 3300009148 Ga0105243_10895346 Ga0105243_108953462 68
251 3300009174 Ga0105241_10262458 Ga0105241_102624582 68
252 3300009177 Ga0105248_10069829 Ga0105248_100698293 68
253 3300009177 Ga0105248_10828931 Ga0105248_108289312 68
254 3300009545 Ga0105237_10079308 Ga0105237_100793085 68
255 3300009545 Ga0105237_10491599 Ga0105237_104915992 68
256 3300009545 Ga0105237_10711885 Ga0105237_107118851 68
257 3300009545 Ga0105237_11469538 Ga0105237_114695381 68
258 3300009545 Ga0105237_12642140 Ga0105237_126421401 68
259 3300009551 Ga0105238_10008002 Ga0105238_100080025 68
260 3300009551 Ga0105238_10050801 Ga0105238_100508014 68
261 3300009551 Ga0105238_10055754 Ga0105238_100557541 68
262 3300009551 Ga0105238_10090103 Ga0105238_100901034 68
263 3300009551 Ga0105238_10604680 Ga0105238_106046802 68
264 3300009551 Ga0105238_10634583 Ga0105238_106345832 68
265 3300009551 Ga0105238_10721200 Ga0105238_107212002 68
266 3300009551 Ga0105238_11009822 Ga0105238_110098221 68
267 3300009551 Ga0105238_12342020 Ga0105238_123420202 68
268 3300009551 Ga0105238_12703364 Ga0105238_127033641 68
269 3300009553 Ga0105249_10007963 Ga0105249_100079636 68
270 3300009553 Ga0105249_10072522 Ga0105249_100725224 68
271 3300009553 Ga0105249_11482501 Ga0105249_114825012 68
272 3300009553 Ga0105249_13017175 Ga0105249_130171752 68
273 3300010375 Ga0105239_10113704 Ga0105239_101137044 68
274 3300010375 Ga0105239_10822075 Ga0105239_108220752 68
275 3300010375 Ga0105239_10986813 Ga0105239_109868132 68
276 3300010375 Ga0105239_13208592 Ga0105239_132085922 68
277 3300013100 Ga0157373_10383302 Ga0157373_103833022 68
278 3300013104 Ga0157370_10070380 Ga0157370_100703803 68
279 3300013104 Ga0157370_10091555 Ga0157370_100915554 68
280 3300013104 Ga0157370_10333344 Ga0157370_103333442 68
281 3300013105 Ga0157369_10975512 Ga0157369_109755121 68
282 3300013105 Ga0157369_11315323 Ga0157369_113153231 68
283 3300013306 Ga0163162_10045038 Ga0163162_100450384 68
284 3300013306 Ga0163162_10696064 Ga0163162_106960641 68
285 3300013307 Ga0157372_10212652 Ga0157372_102126522 68
286 3300013307 Ga0157372_11902185 Ga0157372_119021852 68
287 3300013308 Ga0157375_12161741 Ga0157375_121617412 68
288 3300014325 Ga0163163_10144454 Ga0163163_101444543 68
289 3300014325 Ga0163163_10173955 Ga0163163_101739553 68
290 3300014325 Ga0163163_12895698 Ga0163163_128956981 68
291 3300014326 Ga0157380_11839280 Ga0157380_118392802 68
292 3300014968 Ga0157379_10031018 Ga0157379_100310182 68
293 3300014968 Ga0157379_10311510 Ga0157379_103115102 68
294 3300014968 Ga0157379_11622548 Ga0157379_116225481 68
295 3300014969 Ga0157376_12106044 Ga0157376_121060441 68
296 3300017792 Ga0163161_10457030 Ga0163161_104570302 68
297 3300020070 Ga0206356_10688762 Ga0206356_106887621 68
298 3300021384 Ga0213876_10042874 Ga0213876_100428742 68
299 3300025250 Ga0209026_1005189 Ga0209026_10051895 68
300 3300025254 Ga0209148_1025493 Ga0209148_10254932 68
301 3300025297 Ga0209758_1002155 Ga0209758_10021555 68
302 3300025298 Ga0209050_1001136 Ga0209050_100113612 68
303 3300025304 Ga0209257_1001224 Ga0209257_100122412 68
304 3300025304 Ga0209257_1002160 Ga0209257_100216018 68
305 3300025315 Ga0207697_10082735 Ga0207697_100827352 68
306 3300025900 Ga0207710_10040747 Ga0207710_100407472 68
307 3300025900 Ga0207710_10073159 Ga0207710_100731591 68
308 3300025903 Ga0207680_10030084 Ga0207680_100300845 68
309 3300025903 Ga0207680_10926740 Ga0207680_109267402 68
310 3300025904 Ga0207647_10595955 Ga0207647_105959552 68
311 3300025908 Ga0207643_10763633 Ga0207643_107636331 68
312 3300025909 Ga0207705_10001605 Ga0207705_100016058 68
313 3300025909 Ga0207705_10120978 Ga0207705_101209782 68
314 3300025909 Ga0207705_10691696 Ga0207705_106916962 68
315 3300025912 Ga0207707_10021959 Ga0207707_100219596 68
316 3300025912 Ga0207707_10054056 Ga0207707_100540564 68
317 3300025912 Ga0207707_10058209 Ga0207707_100582092 68
318 3300025913 Ga0207695_10003703 Ga0207695_1000370321 68
319 3300025913 Ga0207695_10005749 Ga0207695_100057498 68
320 3300025913 Ga0207695_10012854 Ga0207695_100128547 68
321 3300025913 Ga0207695_10728133 Ga0207695_107281332 68
322 3300025913 Ga0207695_11533571 Ga0207695_115335712 68
323 3300025914 Ga0207671_10559165 Ga0207671_105591652 68
324 3300025914 Ga0207671_11566860 Ga0207671_115668601 68
325 3300025917 Ga0207660_10001381 Ga0207660_100013818 68
326 3300025917 Ga0207660_10018742 Ga0207660_100187424 68
327 3300025917 Ga0207660_10135520 Ga0207660_101355203 68
328 3300025919 Ga0207657_10031333 Ga0207657_100313333 68
329 3300025919 Ga0207657_10076849 Ga0207657_100768493 68
330 3300025919 Ga0207657_11210921 Ga0207657_112109211 68
331 3300025920 Ga0207649_10143377 Ga0207649_101433772 68
332 3300025921 Ga0207652_10009245 Ga0207652_100092454 68
333 3300025921 Ga0207652_10684895 Ga0207652_106848952 68
334 3300025924 Ga0207694_10012978 Ga0207694_100129784 68
335 3300025924 Ga0207694_10021272 Ga0207694_100212725 68
336 3300025924 Ga0207694_10068397 Ga0207694_100683975 68
337 3300025924 Ga0207694_10439333 Ga0207694_104393332 68
338 3300025924 Ga0207694_10507610 Ga0207694_105076102 68
339 3300025924 Ga0207694_10612250 Ga0207694_106122502 68
340 3300025924 Ga0207694_11198249 Ga0207694_111982492 68
341 3300025924 Ga0207694_11774808 Ga0207694_117748081 68
342 3300025925 Ga0207650_10003370 Ga0207650_1000337010 68
343 3300025925 Ga0207650_10262275 Ga0207650_102622753 68
344 3300025932 Ga0207690_10000650 Ga0207690_100006505 68
345 3300025932 Ga0207690_10027003 Ga0207690_100270032 68
346 3300025932 Ga0207690_10259484 Ga0207690_102594842 68
347 3300025933 Ga0207706_10405831 Ga0207706_104058312 68
348 3300025933 Ga0207706_10905004 Ga0207706_109050042 68
349 3300025937 Ga0207669_10388444 Ga0207669_103884442 68
350 3300025937 Ga0207669_11889452 Ga0207669_118894522 68
351 3300025938 Ga0207704_10000508 Ga0207704_100005089 68
352 3300025941 Ga0207711_10010576 Ga0207711_100105765 68
353 3300025941 Ga0207711_10585631 Ga0207711_105856311 68
354 3300025944 Ga0207661_10797845 Ga0207661_107978452 68
355 3300025945 Ga0207679_11340481 Ga0207679_113404811 68
356 3300025949 Ga0207667_10010216 Ga0207667_100102165 68
357 3300025949 Ga0207667_10265732 Ga0207667_102657322 68
358 3300025949 Ga0207667_11532673 Ga0207667_115326732 68
359 3300025961 Ga0207712_10030460 Ga0207712_100304605 68
360 3300025961 Ga0207712_10166955 Ga0207712_101669552 68
361 3300025972 Ga0207668_10000001 Ga0207668_1000000165 68
362 3300025972 Ga0207668_10000419 Ga0207668_100004195 68
363 3300025981 Ga0207640_11262369 Ga0207640_112623691 68
364 3300025986 Ga0207658_10001851 Ga0207658_1000185110 68
365 3300025986 Ga0207658_10008252 Ga0207658_100082526 68
366 3300026035 Ga0207703_10000049 Ga0207703_1000004951 68
367 3300026035 Ga0207703_10006875 Ga0207703_100068751 68
368 3300026035 Ga0207703_10805331 Ga0207703_108053312 68
369 3300026041 Ga0207639_10014988 Ga0207639_100149884 68
370 3300026041 Ga0207639_10028193 Ga0207639_100281935 68
371 3300026041 Ga0207639_10200991 Ga0207639_102009912 68
372 3300026041 Ga0207639_10729081 Ga0207639_107290812 68
373 3300026041 Ga0207639_10935153 Ga0207639_109351532 68
374 3300026041 Ga0207639_11018801 Ga0207639_110188012 68
375 3300026041 Ga0207639_11806296 Ga0207639_118062961 68
376 3300026078 Ga0207702_10382189 Ga0207702_103821891 68
377 3300026078 Ga0207702_10393651 Ga0207702_103936512 68
378 3300026078 Ga0207702_11006009 Ga0207702_110060092 68
379 3300026078 Ga0207702_12504589 Ga0207702_125045891 68
380 3300026088 Ga0207641_10000011 Ga0207641_10000011183 68
381 3300026088 Ga0207641_10004179 Ga0207641_100041795 68
382 3300026089 Ga0207648_11297828 Ga0207648_112978281 68
383 3300026095 Ga0207676_10000073 Ga0207676_1000007364 68
384 3300026095 Ga0207676_10000503 Ga0207676_1000050311 68
385 3300026095 Ga0207676_11783650 Ga0207676_117836502 68
386 3300026116 Ga0207674_11017839 Ga0207674_110178392 68
387 3300026116 Ga0207674_11827953 Ga0207674_118279531 68
388 3300026118 Ga0207675_100382510 Ga0207675_1003825101 68
389 3300026118 Ga0207675_101007615 Ga0207675_1010076152 68
390 3300026142 Ga0207698_10806738 Ga0207698_108067382 68
391 3300028379 Ga0268266_10000189 Ga0268266_1000018934 68
392 3300028379 Ga0268266_10001279 Ga0268266_1000127928 68
393 3300028379 Ga0268266_10004283 Ga0268266_100042833 68
394 3300028379 Ga0268266_11769173 Ga0268266_117691732 68
395 3300028380 Ga0268265_10001948 Ga0268265_100019488 68
396 3300028380 Ga0268265_10013679 Ga0268265_100136796 68
397 3300028381 Ga0268264_10000068 Ga0268264_10000068136 68
398 3300028786 Ga0307517_10116615 Ga0307517_101166153 68
399 3300028800 Ga0265338_10019378 Ga0265338_100193787 68
400 3300030521 Ga0307511_10034782 Ga0307511_100347822 68
401 3300031456 Ga0307513_10414850 Ga0307513_104148502 68
402 3300031456 Ga0307513_10592868 Ga0307513_105928681 68
403 3300031730 Ga0307516_10000035 Ga0307516_10000035114 68
404 3300033180 Ga0307510_10401998 Ga0307510_104019982 68
405 3300037312 Ga0395899_0065469 Ga0395899_0065469_2146_2352 68
406 3300037418 Ga0395900_0007156 Ga0395900_0007156_2801_3007 68
407 3300037466 Ga0395898_0061679 Ga0395898_0061679_1801_2007 68
408 3300037471 Ga0395905_0338600 Ga0395905_0338600_422_628 68
409 3300037471 Ga0395905_0580504 Ga0395905_0580504_351_557 68
410 3300037471 Ga0395905_0889753 Ga0395905_0889753_511_717 68
411 3300037471 Ga0395905_1567189 Ga0395905_1567189_272_478 68
412 3300038443 Ga0395901_0031220 Ga0395901_0031220_2749_2955 68
413 3300039437 Ga0436365_0884578 Ga0436365_0884578_183_389 68
414 3300039437 Ga0436365_1369582 Ga0436365_1369582_231_437 68
415 3300044712 Ga0453684_0605680 Ga0453684_0605680_389_595 68
416 3300044735 Ga0466968_0094532 Ga0466968_0094532_669_875 68
417 3300046459 Ga0495629_0028298 Ga0495629_0028298_1343_1552 68
418 3300046459 Ga0495629_0923539 Ga0495629_0923539_23_229 68
419 3300046515 Ga0495620_0015635 Ga0495620_0015635_3054_3263 68
420 3300046515 Ga0495620_0088003 Ga0495620_0088003_136_342 68
421 3300046516 Ga0495628_0521980 Ga0495628_0521980_539_748 68
422 3300046522 Ga0495643_0030734 Ga0495643_0030734_2354_2563 68
423 3300046525 Ga0495663_0056108 Ga0495663_0056108_147_353 68
424 3300046531 Ga0495665_0193973 Ga0495665_0193973_27_233 68
425 3300046538 Ga0495609_0118500 Ga0495609_0118500_755_964 68
426 3300046542 Ga0495597_0001757 Ga0495597_0001757_10508_10717 68
427 3300046543 Ga0495645_0050115 Ga0495645_0050115_265_474 68
428 3300046557 Ga0495622_0000786 Ga0495622_0000786_3226_3435 68
429 3300046616 Ga0495668_0126798 Ga0495668_0126798_243_452 68
430 3300046616 Ga0495668_0133627 Ga0495668_0133627_585_791 68
431 3300046616 Ga0495668_0158376 Ga0495668_0158376_451_660 68
432 3300046616 Ga0495668_0194696 Ga0495668_0194696_141_350 68
433 3300046616 Ga0495668_0561763 Ga0495668_0561763_34_243 68
434 3300046660 Ga0495625_0275697 Ga0495625_0275697_408_614 68
435 3300046660 Ga0495625_0344087 Ga0495625_0344087_254_481 68
436 3300046660 Ga0495625_0368330 Ga0495625_0368330_230_439 68
437 3300046660 Ga0495625_0810420 Ga0495625_0810420_17_226 68
438 3300046674 Ga0495588_0412217 Ga0495588_0412217_144_350 68
439 3300046679 Ga0495623_0662563 Ga0495623_0662563_204_410 68
440 3300046684 Ga0495669_0000002 Ga0495669_0000002_53486_53713 68
441 3300046690 Ga0495624_0186583 Ga0495624_0186583_152_361 68
442 3300046691 Ga0495670_0682261 Ga0495670_0682261_238_444 68
443 3300046694 Ga0495649_0195214 Ga0495649_0195214_444_653 68
444 3300047315 Ga0495581_0330755 Ga0495581_0330755_660_869 68
445 3300047319 Ga0495674_0570985 Ga0495674_0570985_572_781 68
446 3300047321 Ga0495676_0620290 Ga0495676_0620290_405_614 68
447 3300047443 Ga0495687_015498 Ga0495687_015498_757_966 68
448 3300047472 Ga0495686_0030547 Ga0495686_0030547_1785_1994 68
449 3300047673 Ga0495593_0220251 Ga0495593_0220251_122_331 68
450 3300048088 Ga0495602_0378088 Ga0495602_0378088_327_536 68
451 3300048903 Ga0496100_0575428 Ga0496100_0575428_229_435 68
452 3300048903 Ga0496100_0912894 Ga0496100_0912894_185_391 68
453 3300048904 Ga0496101_0445415 Ga0496101_0445415_140_346 68
454 3300048905 Ga0496102_1598628 Ga0496102_1598628_61_267 68
455 3300048918 Ga0496115_0009978 Ga0496115_0009978_1066_1272 68
456 3300048918 Ga0496115_0169845 Ga0496115_0169845_676_882 68
457 3300048919 Ga0496116_0275716 Ga0496116_0275716_82_288 68
458 3300048920 Ga0496117_0034239 Ga0496117_0034239_2914_3120 68
459 3300048921 Ga0496118_0017353 Ga0496118_0017353_5616_5822 68
460 3300048922 Ga0496119_0026476 Ga0496119_0026476_2186_2392 68
461 3300048924 Ga0496121_0044658 Ga0496121_0044658_771_977 68
462 3300049460 Ga0495682_0092638 Ga0495682_0092638_259_468 68
463 3300049569 Ga0501032_0434236 Ga0501032_0434236_178_384 68
464 3300049570 Ga0501033_0390250 Ga0501033_0390250_339_545 68
465 3300049572 Ga0501036_0910651 Ga0501036_0910651_393_599 68
466 3300049823 Ga0501044_0026958 Ga0501044_0026958_3830_4036 68
467 3300050489 nmdc:mga03683_68568_c1 nmdc:mga03683_68568_c1_540_746 68
468 3300050490 nmdc:mga03n38_100886_c1 nmdc:mga03n38_100886_c1_1101_1307 68
469 3300050492 nmdc:mga0yw44_1127832_c1 nmdc:mga0yw44_1127832_c1_189_395 68
470 3300050493 nmdc:mga0k408_131714_c1 nmdc:mga0k408_131714_c1_540_746 68
471 3300050494 nmdc:mga06z11_292952_c1 nmdc:mga06z11_292952_c1_270_476 68
472 3300050516 nmdc:mga0sz30_459021_c1 nmdc:mga0sz30_459021_c1_309_515 68
473 3300053080 Ga0500635_0000060 Ga0500635_0000060_51909_52115 68
474 3300053086 Ga0500578_0385594 Ga0500578_0385594_92_301 68
475 3300053088 Ga0500644_0366601 Ga0500644_0366601_97_306 68
476 3300053091 Ga0500647_0213454 Ga0500647_0213454_159_365 68
477 3300053092 Ga0500583_0136382 Ga0500583_0136382_713_922 68
478 3300053093 Ga0500651_0208208 Ga0500651_0208208_380_589 68
479 3300053094 Ga0500566_0018872 Ga0500566_0018872_2251_2460 68
480 3300053096 Ga0500641_0235236 Ga0500641_0235236_326_535 68
481 3300053099 Ga0500654_083800 Ga0500654_083800_270_479 68
482 3300053108 Ga0500562_002359 Ga0500562_002359_812_1018 68
483 3300053109 Ga0500569_000827 Ga0500569_000827_950_1159 68
484 3300053111 Ga0500572_244774 Ga0500572_244774_127_333 68
485 3300053119 Ga0500595_004593 Ga0500595_004593_5212_5421 68
486 3300053119 Ga0500595_039529 Ga0500595_039529_828_1037 68
487 3300053120 Ga0500597_147773 Ga0500597_147773_199_408 68
488 3300053121 Ga0500607_268146 Ga0500607_268146_357_563 68
489 3300053122 Ga0500608_055890 Ga0500608_055890_823_1032 68
490 3300053123 Ga0500614_001585 Ga0500614_001585_1110_1319 68
491 3300053130 Ga0500642_0027509 Ga0500642_0027509_944_1153 68
492 3300053133 Ga0500655_135021 Ga0500655_135021_101_310 68
493 3300053134 Ga0500658_0162569 Ga0500658_0162569_472_681 68
494 3300053136 Ga0500559_0002573 Ga0500559_0002573_5156_5365 68
495 3300053148 Ga0500590_165467 Ga0500590_165467_17_226 68
496 3300053154 Ga0500619_067366 Ga0500619_067366_243_452 68
497 3300053155 Ga0500620_119489 Ga0500620_119489_650_859 68
498 3300053157 Ga0500624_128076 Ga0500624_128076_165_371 68
499 3300053177 Ga0500636_0015775 Ga0500636_0015775_1310_1516 68
500 3300053178 Ga0500637_0025320 Ga0500637_0025320_1782_1988 68
501 3300053178 Ga0500637_0272463 Ga0500637_0272463_47_256 68
502 3300053725 Ga0500576_172932 Ga0500576_172932_242_451 68
503 3300053730 Ga0500645_049285 Ga0500645_049285_430_639 68
504 3300053735 Ga0500596_001191 Ga0500596_001191_4057_4266 68
505 3300055283 Ga0500661_036823 Ga0500661_036823_491_700 68

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06698

DUF1192

Protein of unknown function (DUF1192)

4

65

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End Superfamily
af_O60437_131_316_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5415 1 48 1.20.58.60
af_O60437_131_316_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3538 1 48 1.20.58.60

Feature Viewer

pLDDT pTM Quality
89.02 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map