F456263

General Info

Members Datasets Scaffolds Average Seq Length
504 336 493 235

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0012629|Ga0501034_0012629_1471_2298
Length 275
Sequence LRLAASLEANRRAAKALRSVTLTFRRAGFYANGILFPIGGFMKKVYPNAKAALDGIVKDGMMVLAAGFGLCGMPATLIEALRDSGVKNLTCVSNNAGIDGAGLGLLLETRQIKKMIASYVGENKLFAAQYLAGELEIEFNPQGTLAERMRAGGAGIPAFFTKTGVGTEIAKGKEERTFNGQRYIMETGLVGDIALVHAWKGDTEGNLVYRKTARNFNPVMATAAKITVAEVEHLVQPGELDGDMIHTPGVFVQRIIHTTAEKRIEVRTLRKRNAA

Samples

Sample ID Description Type Environment
1 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
4 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
5 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
6 2643221733 Bosea sp. Root381 Isolate Unclassified
7 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
8 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
9 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
10 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
11 2919085039 Luteibacter sp. 1214 Isolate Unclassified
12 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
13 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
17 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
21 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
22 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
23 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
100 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
101 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
113 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
144 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
146 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
213 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
221 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
222 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
223 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
226 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
227 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
231 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
234 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
235 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
236 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
237 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
238 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
239 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
240 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
241 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
242 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
243 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
245 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
246 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
247 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
248 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
256 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
257 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
258 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
259 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
260 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
261 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
262 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
263 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
264 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
267 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
268 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
269 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
300 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
305 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
306 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
307 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
310 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
313 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
314 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
315 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
316 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
317 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
323 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
324 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
325 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
326 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
327 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
328 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
329 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
330 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
331 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
332 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
333 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
334 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
335 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 0.2
Isolates 2.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.54
Nodule 0.6
Rhizoplane 3.37
Rhizosphere 83.13
Stem 0
Stem Tuber 0
Unclassified 5.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000187 3300001977 Bacteria 8222
2 JGI24747J21853_1005659 3300001978 Bacteria 1161
3 JGI24739J22299_10000841 3300001989 Bacteria 11280
4 JGI24737J22298_10000354 3300001990 Bacteria 15482
5 JGI24750J21931_1000271 3300002070 Bacteria 8864
6 JGI24745J21846_1000158 3300002073 Bacteria 5345
7 JGI24749J21850_1000812 3300002076 Bacteria 4489
8 JGI24744J21845_10006674 3300002077 Bacteria 2389
9 JGI24035J26624_1000301 3300002126 Bacteria 4584
10 JGI24033J26618_1016020 3300002155 Bacteria 929
11 JGI24751J29686_10011272 3300002459 Bacteria 1844
12 JGI24751J29686_10033145 3300002459 Bacteria 1071
13 JGI25406J46586_10010387 3300003203 Bacteria 4133
14 JGI26145J50221_1001271 3300003371 Bacteria 1998
15 Ga0055536_1012680 3300003781 Bacteria 3106
16 JGI25405J52794_10034128 3300003911 Bacteria 1063
17 Ga0065715_10089022 3300005293 Bacteria 16633
18 Ga0065715_10169532 3300005293 Bacteria 1558
19 Ga0070658_10159734 3300005327 Bacteria 1890
20 Ga0070676_10003948 3300005328 Bacteria 7786
21 Ga0070683_100008259 3300005329 Bacteria 8848
22 Ga0070690_100000577 3300005330 Bacteria 18482
23 Ga0070690_100134746 3300005330 Bacteria 1672
24 Ga0070670_100216634 3300005331 Bacteria 1665
25 Ga0070670_100228110 3300005331 Bacteria 1621
26 Ga0070677_10001438 3300005333 Bacteria 7555
27 Ga0070677_10217322 3300005333 Bacteria 931
28 Ga0068869_100006582 3300005334 Bacteria 7372
29 Ga0070666_10012088 3300005335 Bacteria 5436
30 Ga0070666_10147827 3300005335 Bacteria 1639
31 Ga0070680_100006307 3300005336 Bacteria 9007
32 Ga0070680_100226179 3300005336 Bacteria 1580
33 Ga0070682_100003225 3300005337 Bacteria 9046
34 Ga0068868_100405302 3300005338 Bacteria 1177
35 Ga0068868_100451612 3300005338 Bacteria 1118
36 Ga0070660_100004146 3300005339 Bacteria 10010
37 Ga0070689_100014858 3300005340 Bacteria 5665
38 Ga0070689_100091327 3300005340 Bacteria 2400
39 Ga0070689_100138102 3300005340 Bacteria 1958
40 Ga0070691_10005385 3300005341 Bacteria 5819
41 Ga0070691_10286075 3300005341 Bacteria 896
42 Ga0070687_100001224 3300005343 Bacteria 8906
43 Ga0070687_100044320 3300005343 Bacteria 2266
44 Ga0070661_100000804 3300005344 Bacteria 22558
45 Ga0070661_100268522 3300005344 Bacteria 1320
46 Ga0070692_10000837 3300005345 Bacteria 10325
47 Ga0070668_100006098 3300005347 Bacteria 8940
48 Ga0070669_100006161 3300005353 Bacteria 8659
49 Ga0070669_100412682 3300005353 Bacteria 1107
50 Ga0070675_100017427 3300005354 Bacteria 5707
51 Ga0070671_100009037 3300005355 Bacteria 7995
52 Ga0070671_100048819 3300005355 Bacteria 3521
53 Ga0070674_100004299 3300005356 Bacteria 8105
54 Ga0070673_100006345 3300005364 Bacteria 7683
55 Ga0070688_100000558 3300005365 Bacteria 18862
56 Ga0070688_100251936 3300005365 Bacteria 1257
57 Ga0070659_100024392 3300005366 Bacteria 4636
58 Ga0070667_100008212 3300005367 Bacteria 8653
59 Ga0070703_10011177 3300005406 Bacteria 2535
60 Ga0070709_10098327 3300005434 Bacteria 1945
61 Ga0070714_100031220 3300005435 Bacteria 4444
62 Ga0070713_100077384 3300005436 Bacteria 2828
63 Ga0070713_100164081 3300005436 Bacteria 1985
64 Ga0070710_10053652 3300005437 Bacteria 2272
65 Ga0070710_10207862 3300005437 Bacteria 1239
66 Ga0070701_10001856 3300005438 Bacteria 8013
67 Ga0070701_10405603 3300005438 Bacteria 865
68 Ga0070711_100027090 3300005439 Bacteria 3760
69 Ga0070711_100111410 3300005439 Bacteria 2009
70 Ga0070705_100005648 3300005440 Bacteria 6105
71 Ga0070700_100003794 3300005441 Bacteria 7825
72 Ga0070700_100101699 3300005441 Bacteria 1894
73 Ga0070694_100041579 3300005444 Bacteria 3067
74 Ga0070708_100021889 3300005445 Bacteria 5416
75 Ga0070663_100003833 3300005455 Bacteria 8754
76 Ga0070678_100002855 3300005456 Bacteria 9561
77 Ga0070678_100095481 3300005456 Bacteria 2291
78 Ga0070662_100070943 3300005457 Bacteria 2567
79 Ga0070662_100126604 3300005457 Bacteria 1964
80 Ga0070681_10008839 3300005458 Bacteria 9895
81 Ga0068867_100012098 3300005459 Bacteria 6094
82 Ga0070685_10048175 3300005466 Bacteria 2453
83 Ga0070685_10061880 3300005466 Bacteria 2193
84 Ga0070685_10139263 3300005466 Bacteria 1526
85 Ga0070679_100010504 3300005530 Bacteria 8785
86 Ga0070684_100001753 3300005535 Bacteria 15811
87 Ga0070697_100341652 3300005536 Bacteria 1292
88 Ga0068853_100008092 3300005539 Bacteria 8437
89 Ga0070672_100004614 3300005543 Bacteria 9024
90 Ga0070686_100001565 3300005544 Bacteria 12859
91 Ga0070695_100217315 3300005545 Bacteria 1375
92 Ga0070696_100198575 3300005546 Bacteria 1496
93 Ga0070693_100002143 3300005547 Bacteria 9046
94 Ga0070665_100536717 3300005548 Bacteria 1182
95 Ga0070704_100004087 3300005549 Bacteria 8421
96 Ga0068855_100074740 3300005563 Bacteria 3935
97 Ga0070664_100028636 3300005564 Bacteria 4636
98 Ga0068857_100004864 3300005577 Bacteria 11393
99 Ga0068854_100005702 3300005578 Bacteria 7869
100 Ga0068856_100014335 3300005614 Bacteria 7665
101 Ga0068856_100061308 3300005614 Bacteria 3715
102 Ga0068856_100731318 3300005614 Bacteria 1010
103 Ga0070702_100007505 3300005615 Bacteria 5225
104 Ga0068852_100002326 3300005616 Bacteria 13065
105 Ga0068852_100147280 3300005616 Bacteria 2185
106 Ga0068859_100040171 3300005617 Bacteria 4696
107 Ga0068864_100006005 3300005618 Bacteria 9968
108 Ga0068864_100439536 3300005618 Bacteria 1246
109 Ga0068866_10000301 3300005718 Bacteria 23583
110 Ga0068866_10228290 3300005718 Bacteria 1127
111 Ga0068861_100005394 3300005719 Bacteria 8652
112 Ga0068851_10449435 3300005834 Bacteria 766
113 Ga0068870_10000419 3300005840 Bacteria 15983
114 Ga0068863_100000340 3300005841 Bacteria 47641
115 Ga0068858_100036890 3300005842 Bacteria 4531
116 Ga0068858_100625117 3300005842 Bacteria 1046
117 Ga0068860_100037560 3300005843 Bacteria 4636
118 Ga0068860_100151051 3300005843 Bacteria 2237
119 Ga0068862_100009969 3300005844 Bacteria 7849
120 Ga0081455_10010585 3300005937 Bacteria 9338
121 Ga0081455_10111172 3300005937 Bacteria 2177
122 Ga0081540_1076063 3300005983 Bacteria 1531
123 Ga0081540_1159726 3300005983 Bacteria 876
124 Ga0081539_10016778 3300005985 Bacteria 5198
125 Ga0070717_10040793 3300006028 Bacteria 3783
126 Ga0075363_100022049 3300006048 Bacteria 3216
127 Ga0075364_10020890 3300006051 Bacteria 4122
128 Ga0070712_100256184 3300006175 Bacteria 1400
129 Ga0075362_10049429 3300006177 Bacteria 1878
130 Ga0075369_10077093 3300006186 Bacteria 1474
131 Ga0075366_10012093 3300006195 Bacteria 4888
132 Ga0097621_100000880 3300006237 Bacteria 21059
133 Ga0075370_10096540 3300006353 Bacteria 1708
134 Ga0075370_10113281 3300006353 Bacteria 1576
135 Ga0075370_10169307 3300006353 Bacteria 1284
136 Ga0068871_100000301 3300006358 Bacteria 34368
137 Ga0068871_100526067 3300006358 Bacteria 1068
138 Ga0075433_10006405 3300006852 Bacteria 9308
139 Ga0075434_100007954 3300006871 Bacteria 9826
140 Ga0068865_100003905 3300006881 Bacteria 8939
141 Ga0097620_100040169 3300006931 Bacteria 4696
142 Ga0105250_10027060 3300009092 Bacteria 2310
143 Ga0105240_10043237 3300009093 Bacteria 5734
144 Ga0105240_10266730 3300009093 Bacteria 1973
145 Ga0111539_10020700 3300009094 Bacteria 8100
146 Ga0105245_10018996 3300009098 Bacteria 6016
147 Ga0105247_10002113 3300009101 Bacteria 13737
148 Ga0105243_10012907 3300009148 Bacteria 6313
149 Ga0105241_10001943 3300009174 Bacteria 15638
150 Ga0105248_10003102 3300009177 Bacteria 18407
151 Ga0105248_10126415 3300009177 Bacteria 2884
152 Ga0105237_10017102 3300009545 Bacteria 7523
153 Ga0105249_10001599 3300009553 Bacteria 19830
154 Ga0105249_10506316 3300009553 Bacteria 1253
155 Ga0105239_10024058 3300010375 Bacteria 6709
156 Ga0105239_10390121 3300010375 Bacteria 1575
157 Ga0105246_10017880 3300011119 Bacteria 4511
158 Ga0157373_10007508 3300013100 Bacteria 8107
159 Ga0157371_10008631 3300013102 Bacteria 8095
160 Ga0157370_10002130 3300013104 Bacteria 24167
161 Ga0157370_10442135 3300013104 Bacteria 1196
162 Ga0157374_10001695 3300013296 Bacteria 18451
163 Ga0157378_10003374 3300013297 Bacteria 14202
164 Ga0157378_10199685 3300013297 Bacteria 1891
165 Ga0163162_10055943 3300013306 Bacteria 3973
166 Ga0163162_10801502 3300013306 Bacteria 1059
167 Ga0157372_10004321 3300013307 Bacteria 15190
168 Ga0157372_10768335 3300013307 Bacteria 1120
169 Ga0157375_10019602 3300013308 Bacteria 6156
170 Ga0163163_10229268 3300014325 Bacteria 1906
171 Ga0163163_10539003 3300014325 Bacteria 1229
172 Ga0157380_10006382 3300014326 Bacteria 8300
173 Ga0157379_10006391 3300014968 Bacteria 10151
174 Ga0182005_1000055 3300015265 Bacteria 111824
175 Ga0163161_10009345 3300017792 Bacteria 6784
176 Ga0206356_11653084 3300020070 Bacteria 868
177 Ga0213876_10011887 3300021384 Bacteria 4640
178 Ga0213876_10036527 3300021384 Bacteria 2591
179 Ga0213876_10117761 3300021384 Bacteria 1410
180 Ga0213875_10002533 3300021388 Bacteria 10899
181 Ga0207666_1000059 3300025271 Bacteria 19909
182 Ga0207673_1009757 3300025290 Bacteria 1229
183 Ga0209675_1000970 3300025291 Bacteria 18131
184 Ga0209676_1000089 3300025292 Bacteria 260196
185 Ga0209050_1008016 3300025298 Bacteria 5759
186 Ga0207697_10002326 3300025315 Bacteria 9897
187 Ga0207696_1021692 3300025711 Bacteria 2053
188 Ga0207653_10009705 3300025885 Bacteria 3001
189 Ga0207682_10002173 3300025893 Bacteria 8857
190 Ga0207682_10023530 3300025893 Bacteria 2434
191 Ga0207642_10012159 3300025899 Bacteria 3098
192 Ga0207710_10004879 3300025900 Bacteria 5815
193 Ga0207688_10000167 3300025901 Bacteria 28809
194 Ga0207688_10024680 3300025901 Bacteria 3299
195 Ga0207680_10025573 3300025903 Bacteria 3258
196 Ga0207647_10002561 3300025904 Bacteria 13747
197 Ga0207699_10283810 3300025906 Bacteria 1151
198 Ga0207645_10005337 3300025907 Bacteria 9341
199 Ga0207643_10000007 3300025908 Bacteria 171706
200 Ga0207654_10002202 3300025911 Bacteria 9986
201 Ga0207707_10014147 3300025912 Bacteria 6952
202 Ga0207707_10176301 3300025912 Bacteria 1867
203 Ga0207671_10173593 3300025914 Bacteria 1675
204 Ga0207693_10000563 3300025915 Bacteria 33538
205 Ga0207693_10405164 3300025915 Bacteria 1066
206 Ga0207660_10002332 3300025917 Bacteria 12496
207 Ga0207662_10000195 3300025918 Bacteria 28315
208 Ga0207662_10016418 3300025918 Bacteria 4179
209 Ga0207662_10101989 3300025918 Bacteria 1779
210 Ga0207657_10002386 3300025919 Bacteria 20326
211 Ga0207657_10373847 3300025919 Bacteria 1123
212 Ga0207649_10000944 3300025920 Bacteria 18174
213 Ga0207652_10009630 3300025921 Bacteria 7771
214 Ga0207681_10056284 3300025923 Bacteria 2682
215 Ga0207694_10090984 3300025924 Bacteria 2408
216 Ga0207650_10012289 3300025925 Bacteria 5908
217 Ga0207650_10226048 3300025925 Bacteria 1508
218 Ga0207650_10565010 3300025925 Bacteria 954
219 Ga0207659_10002481 3300025926 Bacteria 10998
220 Ga0207687_10000072 3300025927 Bacteria 76222
221 Ga0207664_10161248 3300025929 Bacteria 1913
222 Ga0207644_10022392 3300025931 Bacteria 4318
223 Ga0207644_10125661 3300025931 Bacteria 1957
224 Ga0207690_10029980 3300025932 Bacteria 3464
225 Ga0207706_10008634 3300025933 Bacteria 9387
226 Ga0207706_10009459 3300025933 Bacteria 8953
227 Ga0207706_10437140 3300025933 Bacteria 1133
228 Ga0207686_10009296 3300025934 Bacteria 5334
229 Ga0207709_10002480 3300025935 Bacteria 11563
230 Ga0207670_10000792 3300025936 Bacteria 16529
231 Ga0207670_10094500 3300025936 Bacteria 2121
232 Ga0207669_10001742 3300025937 Bacteria 9239
233 Ga0207669_10044599 3300025937 Bacteria 2606
234 Ga0207704_10003278 3300025938 Bacteria 7351
235 Ga0207704_10285417 3300025938 Bacteria 1257
236 Ga0207665_10400739 3300025939 Bacteria 1045
237 Ga0207691_10009483 3300025940 Bacteria 9347
238 Ga0207691_10085978 3300025940 Bacteria 2822
239 Ga0207711_10001106 3300025941 Bacteria 25759
240 Ga0207711_10349899 3300025941 Bacteria 1368
241 Ga0207689_10000366 3300025942 Bacteria 42711
242 Ga0207689_10177914 3300025942 Bacteria 1754
243 Ga0207661_10010227 3300025944 Bacteria 6746
244 Ga0207661_10214140 3300025944 Bacteria 1699
245 Ga0207679_10000029 3300025945 Bacteria 183002
246 Ga0207667_10111576 3300025949 Bacteria 2820
247 Ga0207651_10000292 3300025960 Bacteria 21406
248 Ga0207651_10416019 3300025960 Bacteria 1146
249 Ga0207712_10010471 3300025961 Bacteria 5887
250 Ga0207668_10010650 3300025972 Bacteria 5563
251 Ga0207640_10001667 3300025981 Bacteria 11922
252 Ga0207658_10038839 3300025986 Bacteria 3432
253 Ga0207677_10042618 3300026023 Bacteria 3011
254 Ga0207703_10009816 3300026035 Bacteria 7509
255 Ga0207639_10013289 3300026041 Bacteria 5758
256 Ga0207678_10006759 3300026067 Bacteria 10172
257 Ga0207678_10763844 3300026067 Bacteria 852
258 Ga0207708_10004100 3300026075 Bacteria 10722
259 Ga0207702_10011803 3300026078 Bacteria 7274
260 Ga0207702_10016294 3300026078 Bacteria 6151
261 Ga0207641_10004156 3300026088 Bacteria 12612
262 Ga0207648_10008435 3300026089 Bacteria 9983
263 Ga0207648_10020005 3300026089 Bacteria 6038
264 Ga0207676_10000182 3300026095 Bacteria 55544
265 Ga0207676_10248790 3300026095 Bacteria 1599
266 Ga0207674_10007304 3300026116 Bacteria 12874
267 Ga0207674_10116041 3300026116 Bacteria 2649
268 Ga0207675_100011726 3300026118 Bacteria 8195
269 Ga0207675_100712662 3300026118 Bacteria 1013
270 Ga0207683_10007517 3300026121 Bacteria 9341
271 Ga0207698_10005197 3300026142 Bacteria 8003
272 Ga0207698_10027150 3300026142 Bacteria 4061
273 Ga0209967_1016452 3300027364 Bacteria 1063
274 Ga0209970_1027402 3300027614 Bacteria 981
275 Ga0209998_10000962 3300027717 Bacteria 7298
276 Ga0209813_10067392 3300027866 Bacteria 1156
277 Ga0209974_10000736 3300027876 Bacteria 11197
278 Ga0207428_10001793 3300027907 Bacteria 21978
279 Ga0268265_10004249 3300028380 Bacteria 10001
280 Ga0268264_10013946 3300028381 Bacteria 6607
281 Ga0307517_10020056 3300028786 Bacteria 8540
282 Ga0265332_10000732 3300031238 Bacteria 20494
283 Ga0265325_10001518 3300031241 Bacteria 16310
284 Ga0265325_10005918 3300031241 Bacteria 7494
285 Ga0265325_10071293 3300031241 Bacteria 1744
286 Ga0265325_10100954 3300031241 Bacteria 1412
287 Ga0265329_10010307 3300031242 Bacteria 3438
288 Ga0265340_10003622 3300031247 Bacteria 8687
289 Ga0265340_10095553 3300031247 Bacteria 1385
290 Ga0265339_10001116 3300031249 Bacteria 20311
291 Ga0265339_10011954 3300031249 Bacteria 5320
292 Ga0265331_10006555 3300031250 Bacteria 6866
293 Ga0265331_10109471 3300031250 Bacteria 1267
294 Ga0265316_10137477 3300031344 Bacteria 1838
295 Ga0265316_10161230 3300031344 Bacteria 1676
296 Ga0307513_10176719 3300031456 Bacteria 2004
297 Ga0307408_100210532 3300031548 Bacteria 1580
298 Ga0265313_10003835 3300031595 Bacteria 11864
299 Ga0265313_10007507 3300031595 Bacteria 7427
300 Ga0265313_10055829 3300031595 Bacteria 1869
301 Ga0265314_10003835 3300031711 Bacteria 14352
302 Ga0265342_10000258 3300031712 Bacteria 59570
303 Ga0265342_10025712 3300031712 Bacteria 3696
304 Ga0307413_10405823 3300031824 Bacteria 1069
305 Ga0307407_10067094 3300031903 Bacteria 2119
306 Ga0307409_100262057 3300031995 Bacteria 1587
307 Ga0307411_10212861 3300032005 Bacteria 1494
308 Ga0307415_100272701 3300032126 Bacteria 1387
309 Ga0373930_0010963 3300034816 Bacteria 1629
310 Ga0373950_0009099 3300034818 Bacteria 1577
311 Ga0373959_0006771 3300034820 Bacteria 1912
312 Ga0373938_0001079 3300034957 Bacteria 4392
313 Ga0373929_0002864 3300035085 Bacteria 3152
314 Ga0373940_0002243 3300035088 Bacteria 3718
315 Ga0373949_0002153 3300035090 Bacteria 5166
316 Ga0373952_0002050 3300035092 Bacteria 3628
317 Ga0373936_0190380 3300035113 Bacteria 903
318 Ga0373939_0001680 3300035114 Bacteria 5354
319 Ga0373941_0008396 3300035115 Bacteria 2562
320 Ga0373945_0030446 3300035116 Bacteria 1903
321 Ga0373960_0011101 3300035121 Bacteria 2212
322 Ga0373943_0324557 3300035170 Bacteria 878
323 Ga0373935_0316604 3300035692 Bacteria 1106
324 Ga0373935_0544383 3300035692 Bacteria 846
325 Ga0373927_0108287 3300035695 Bacteria 1810
326 Ga0373937_0881888 3300036401 Bacteria 843
327 Ga0373925_0271086 3300037068 Bacteria 1365
328 Ga0395900_0016660 3300037418 Bacteria 7496
329 Ga0395905_0000704 3300037471 Bacteria 44377
330 Ga0436364_0167179 3300037853 Bacteria 17951
331 Ga0436364_0317277 3300037853 Bacteria 900
332 Ga0436364_0335253 3300037853 Bacteria 76277
333 Ga0436364_1247966 3300037853 Bacteria 12498
334 Ga0395901_0010912 3300038443 Bacteria 9206
335 Ga0436365_0240233 3300039437 Bacteria 6675
336 Ga0436365_0302959 3300039437 Bacteria 2544
337 Ga0436365_0665259 3300039437 Bacteria 1025
338 Ga0436365_1069579 3300039437 Bacteria 1530
339 Ga0436365_1114955 3300039437 Bacteria 4490
340 Ga0436365_1646101 3300039437 Bacteria 1139
341 Ga0436360_0020476 3300039438 Bacteria 3853
342 Ga0436361_0136044 3300039447 Bacteria 7469
343 Ga0436363_0251431 3300039450 Bacteria 1885
344 Ga0436363_0490009 3300039450 Bacteria 2638
345 Ga0436363_1384763 3300039450 Bacteria 3301
346 Ga0436362_0280123 3300039453 Bacteria 1492
347 Ga0451576_0732102 3300045051 Bacteria 1039
348 Ga0495638_0041000 3300046460 Bacteria 2931
349 Ga0495638_0046573 3300046460 Bacteria 2724
350 Ga0495605_0056087 3300046474 Bacteria 1901
351 Ga0495605_0243317 3300046474 Bacteria 772
352 Ga0495630_0481330 3300046517 Bacteria 952
353 Ga0495621_0080442 3300046539 Bacteria 1214
354 Ga0495659_0125286 3300046664 Bacteria 1015
355 Ga0495658_0502899 3300046683 Bacteria 775
356 Ga0495669_0082359 3300046684 Bacteria 1478
357 Ga0495680_0094552 3300047322 Bacteria 2236
358 Ga0495685_079103 3300047447 Bacteria 1096
359 Ga0496100_0037625 3300048903 Bacteria 3060
360 Ga0496100_0084811 3300048903 Bacteria 2148
361 Ga0496101_0108779 3300048904 Bacteria 2084
362 Ga0496103_0002596 3300048906 Bacteria 11311
363 Ga0496104_0166362 3300048907 Bacteria 2115
364 Ga0496104_0301403 3300048907 Bacteria 1515
365 Ga0496105_0185260 3300048908 Bacteria 1704
366 Ga0496106_0035717 3300048909 Bacteria 3716
367 Ga0496107_0040869 3300048910 Bacteria 3329
368 Ga0496108_0028028 3300048911 Bacteria 4658
369 Ga0496109_0008888 3300048912 Bacteria 8555
370 Ga0496110_0176925 3300048913 Bacteria 1937
371 Ga0496110_0350514 3300048913 Bacteria 1345
372 Ga0496111_0294123 3300048914 Bacteria 1204
373 Ga0496114_0005989 3300048917 Bacteria 9574
374 Ga0496115_0031731 3300048918 Bacteria 4164
375 Ga0496115_0091671 3300048918 Bacteria 2484
376 Ga0496125_0034764 3300048928 Bacteria 4436
377 Ga0501031_0018531 3300049568 Bacteria 4531
378 Ga0501032_0003564 3300049569 Bacteria 11867
379 Ga0501032_0030094 3300049569 Bacteria 3724
380 Ga0501032_0032988 3300049569 Bacteria 3548
381 Ga0501032_0198538 3300049569 Bacteria 1309
382 Ga0501033_0022180 3300049570 Bacteria 4791
383 Ga0501033_0061658 3300049570 Bacteria 2763
384 Ga0501033_0260458 3300049570 Bacteria 1227
385 Ga0501034_0000516 3300049571 Bacteria 62005
386 Ga0501034_0000850 3300049571 Bacteria 45243
387 Ga0501034_0007739 3300049571 Bacteria 11422
388 Ga0501034_0012629 3300049571 Bacteria 8715
389 Ga0501034_0025429 3300049571 Bacteria 6027
390 Ga0501034_0195360 3300049571 Bacteria 1983
391 Ga0501034_0242712 3300049571 Bacteria 1747
392 Ga0501034_0418243 3300049571 Bacteria 1262
393 Ga0501036_0000547 3300049572 Bacteria 26976
394 Ga0501036_0017164 3300049572 Bacteria 6051
395 Ga0501036_0038161 3300049572 Bacteria 4065
396 Ga0501036_0129334 3300049572 Bacteria 2132
397 Ga0501036_0319429 3300049572 Bacteria 1297
398 Ga0501036_0348534 3300049572 Bacteria 1236
399 Ga0501037_0017976 3300049573 Bacteria 5204
400 Ga0501037_0024616 3300049573 Bacteria 4451
401 Ga0501037_0082125 3300049573 Bacteria 2335
402 Ga0501037_0150685 3300049573 Bacteria 1662
403 Ga0501037_0289992 3300049573 Bacteria 1138
404 Ga0501037_0318904 3300049573 Bacteria 1076
405 Ga0501038_0045667 3300049574 Bacteria 3801
406 Ga0501038_0131386 3300049574 Bacteria 2055
407 Ga0501038_0315661 3300049574 Bacteria 1223
408 Ga0501039_0003067 3300049575 Bacteria 12495
409 Ga0501039_0076329 3300049575 Bacteria 2605
410 Ga0501040_0278221 3300049576 Bacteria 1195
411 Ga0501043_0003257 3300049579 Bacteria 13387
412 Ga0501043_0003673 3300049579 Bacteria 12604
413 Ga0501043_0018936 3300049579 Bacteria 5403
414 Ga0501043_0091383 3300049579 Bacteria 2393
415 Ga0501046_0092974 3300049580 Bacteria 2318
416 Ga0501046_0386307 3300049580 Bacteria 1012
417 Ga0501047_0000455 3300049581 Bacteria 45200
418 Ga0501047_0024148 3300049581 Bacteria 5839
419 Ga0501047_0128575 3300049581 Bacteria 2413
420 Ga0501047_0142177 3300049581 Bacteria 2277
421 Ga0501047_0801627 3300049581 Bacteria 757
422 Ga0501048_0002034 3300049582 Bacteria 15361
423 Ga0501048_0158484 3300049582 Bacteria 1601
424 Ga0501068_0118921 3300049584 Bacteria 1646
425 Ga0501068_0137882 3300049584 Bacteria 1528
426 Ga0501068_0328061 3300049584 Bacteria 982
427 Ga0501069_0005711 3300049585 Bacteria 6483
428 Ga0501070_0003722 3300049586 Bacteria 13172
429 Ga0501070_0020920 3300049586 Bacteria 5488
430 Ga0501070_0038661 3300049586 Bacteria 3981
431 Ga0501070_0076879 3300049586 Bacteria 2763
432 Ga0501071_0195691 3300049587 Bacteria 1517
433 Ga0501072_0003523 3300049588 Bacteria 11791
434 Ga0501073_0011899 3300049589 Bacteria 6352
435 Ga0501073_0036690 3300049589 Bacteria 3481
436 Ga0501073_0305903 3300049589 Bacteria 1097
437 Ga0501073_0521637 3300049589 Bacteria 821
438 Ga0501074_0024490 3300049590 Bacteria 4387
439 Ga0501076_0319178 3300049592 Bacteria 1274
440 Ga0501079_0334186 3300049741 Bacteria 1187
441 Ga0501080_0001026 3300049742 Bacteria 22970
442 Ga0501080_0012079 3300049742 Bacteria 7910
443 Ga0501080_0094108 3300049742 Bacteria 2782
444 Ga0501083_0010516 3300049744 Bacteria 6511
445 Ga0501083_0026213 3300049744 Bacteria 4031
446 Ga0501083_0030240 3300049744 Bacteria 3721
447 Ga0501083_0066710 3300049744 Bacteria 2396
448 Ga0501083_0457591 3300049744 Bacteria 830
449 Ga0501035_0001156 3300049822 Bacteria 27546
450 Ga0501035_0029743 3300049822 Bacteria 4981
451 Ga0501035_0315892 3300049822 Bacteria 1313
452 Ga0501035_0428939 3300049822 Bacteria 1096
453 Ga0501044_0024576 3300049823 Bacteria 6393
454 Ga0501044_0057824 3300049823 Bacteria 3978
455 Ga0501044_0237298 3300049823 Bacteria 1768
456 Ga0501044_0242762 3300049823 Bacteria 1744
457 Ga0501044_0551295 3300049823 Bacteria 1050
458 Ga0501044_0576450 3300049823 Bacteria 1020
459 Ga0501045_0347879 3300049824 Bacteria 1103
460 nmdc:mga00v17_82170_c1 3300050491 Bacteria 2013
461 nmdc:mga0yw44_107588_c1 3300050492 Bacteria 1784
462 nmdc:mga06z11_182691_c1 3300050494 Bacteria 1210
463 nmdc:mga06z11_372957_c1 3300050494 Bacteria 856
464 nmdc:mga04h51_148759_c1 3300050495 Bacteria 893
465 nmdc:mga07m45_165553_c1 3300050496 Bacteria 1284
466 nmdc:mga07m45_32490_c1 3300050496 Bacteria 2706
467 nmdc:mga07m45_85170_c1 3300050496 Bacteria 1807
468 nmdc:mga08y16_439554_c1 3300050511 Bacteria 1332
469 nmdc:mga0n895_1284_c1 3300050512 Bacteria 18562
470 nmdc:mga0n895_574709_c1 3300050512 Bacteria 1131
471 nmdc:mga0rr50_366859_c1 3300050513 Bacteria 1213
472 nmdc:mga0a205_1140_c1 3300050515 Bacteria 22064
473 Ga0500578_0247208 3300053086 Bacteria 1076
474 Ga0500644_0000616 3300053088 Bacteria 13364
475 Ga0500651_0032245 3300053093 Bacteria 3302
476 Ga0500566_0141170 3300053094 Bacteria 1278
477 Ga0500641_0015291 3300053096 Bacteria 2845
478 Ga0500641_0038549 3300053096 Bacteria 1921
479 Ga0500572_080261 3300053111 Bacteria 1021
480 Ga0500593_003255 3300053117 Bacteria 6114
481 Ga0500594_0046216 3300053118 Bacteria 1211
482 Ga0500595_000002 3300053119 Bacteria 1074388
483 Ga0500577_0246005 3300053142 Bacteria 777
484 Ga0500577_0261134 3300053142 Bacteria 753
485 Ga0500616_0000002 3300053153 Bacteria 1611257
486 Ga0500616_0049676 3300053153 Bacteria 2218
487 Ga0500625_045483 3300053729 Bacteria 2049
488 Ga0500645_000012 3300053730 Bacteria 168579
489 Ga0500601_001022 3300053737 Bacteria 3218
490 Ga0501082_0000016 3300060353 Bacteria 115081
491 Ga0501082_0070028 3300060353 Bacteria 3020
492 Ga0501082_0139293 3300060353 Bacteria 2106
493 Ga0501082_0172625 3300060353 Bacteria 1880

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035113 Ga0373936_0190380 Ga0373936_0190380_11_679 222
2 3300020070 Ga0206356_11653084 Ga0206356_116530841 223
3 3300005983 Ga0081540_1076063 Ga0081540_10760631 225
4 3300005843 Ga0068860_100151051 Ga0068860_1001510512 226
5 3300037853 Ga0436364_0317277 Ga0436364_0317277_67_768 226
6 3300039437 Ga0436365_1646101 Ga0436365_1646101_144_845 226
7 3300047322 Ga0495680_0094552 Ga0495680_0094552_434_1135 226
8 iso_pu_bacteria 2643221541 2643730102 228
9 iso_pu_bacteria 2643221547 2643757154 228
10 iso_pu_bacteria 2643221606 2644045588 228
11 iso_pu_bacteria 2643221671 2644392786 228
12 iso_pu_bacteria 2643221699 2644549578 228
13 iso_pu_bacteria 2869256925 2869257047 228
14 iso_pu_bacteria 2643221733 2644732516 229
15 iso_pu_bacteria 2841911363 2841915662 229
16 iso_pu_bacteria 2841917233 2841920864 229
17 iso_pu_bacteria 2919085039 2919085884 229
18 3300037471 Ga0395905_0000704 Ga0395905_0000704_13124_13816 230
19 iso_pu_bacteria 2830075706 2830079190 230
20 3300009093 Ga0105240_10266730 Ga0105240_102667303 231
21 3300046460 Ga0495638_0046573 Ga0495638_0046573_1961_2668 231
22 3300053153 Ga0500616_0049676 Ga0500616_0049676_283_990 231
23 3300002459 JGI24751J29686_10033145 JGI24751J29686_100331452 232
24 3300003203 JGI25406J46586_10010387 JGI25406J46586_100103872 232
25 3300003911 JGI25405J52794_10034128 JGI25405J52794_100341282 232
26 3300005293 Ga0065715_10169532 Ga0065715_101695322 232
27 3300005327 Ga0070658_10159734 Ga0070658_101597341 232
28 3300005330 Ga0070690_100134746 Ga0070690_1001347462 232
29 3300005331 Ga0070670_100216634 Ga0070670_1002166341 232
30 3300005331 Ga0070670_100228110 Ga0070670_1002281101 232
31 3300005333 Ga0070677_10217322 Ga0070677_102173221 232
32 3300005338 Ga0068868_100405302 Ga0068868_1004053022 232
33 3300005340 Ga0070689_100091327 Ga0070689_1000913273 232
34 3300005340 Ga0070689_100138102 Ga0070689_1001381022 232
35 3300005341 Ga0070691_10286075 Ga0070691_102860751 232
36 3300005343 Ga0070687_100044320 Ga0070687_1000443201 232
37 3300005344 Ga0070661_100268522 Ga0070661_1002685221 232
38 3300005353 Ga0070669_100412682 Ga0070669_1004126821 232
39 3300005365 Ga0070688_100251936 Ga0070688_1002519362 232
40 3300005436 Ga0070713_100077384 Ga0070713_1000773841 232
41 3300005438 Ga0070701_10405603 Ga0070701_104056031 232
42 3300005456 Ga0070678_100095481 Ga0070678_1000954812 232
43 3300005457 Ga0070662_100126604 Ga0070662_1001266042 232
44 3300005466 Ga0070685_10048175 Ga0070685_100481752 232
45 3300005466 Ga0070685_10139263 Ga0070685_101392632 232
46 3300005548 Ga0070665_100536717 Ga0070665_1005367171 232
47 3300005614 Ga0068856_100014335 Ga0068856_1000143353 232
48 3300005614 Ga0068856_100731318 Ga0068856_1007313182 232
49 3300005616 Ga0068852_100147280 Ga0068852_1001472802 232
50 3300005718 Ga0068866_10228290 Ga0068866_102282901 232
51 3300005834 Ga0068851_10449435 Ga0068851_104494351 232
52 3300005842 Ga0068858_100625117 Ga0068858_1006251171 232
53 3300005937 Ga0081455_10010585 Ga0081455_100105855 232
54 3300005937 Ga0081455_10111172 Ga0081455_101111723 232
55 3300005983 Ga0081540_1159726 Ga0081540_11597261 232
56 3300005985 Ga0081539_10016778 Ga0081539_100167785 232
57 3300006048 Ga0075363_100022049 Ga0075363_1000220495 232
58 3300006051 Ga0075364_10020890 Ga0075364_100208903 232
59 3300006177 Ga0075362_10049429 Ga0075362_100494292 232
60 3300006195 Ga0075366_10012093 Ga0075366_100120933 232
61 3300006353 Ga0075370_10096540 Ga0075370_100965401 232
62 3300006353 Ga0075370_10113281 Ga0075370_101132812 232
63 3300006353 Ga0075370_10169307 Ga0075370_101693072 232
64 3300006358 Ga0068871_100526067 Ga0068871_1005260671 232
65 3300009177 Ga0105248_10126415 Ga0105248_101264153 232
66 3300009553 Ga0105249_10506316 Ga0105249_105063162 232
67 3300010375 Ga0105239_10390121 Ga0105239_103901212 232
68 3300013104 Ga0157370_10442135 Ga0157370_104421352 232
69 3300013297 Ga0157378_10199685 Ga0157378_101996852 232
70 3300013306 Ga0163162_10801502 Ga0163162_108015021 232
71 3300013307 Ga0157372_10768335 Ga0157372_107683351 232
72 3300014325 Ga0163163_10539003 Ga0163163_105390031 232
73 3300021384 Ga0213876_10011887 Ga0213876_100118873 232
74 3300021384 Ga0213876_10036527 Ga0213876_100365273 232
75 3300021384 Ga0213876_10117761 Ga0213876_101177612 232
76 3300025893 Ga0207682_10023530 Ga0207682_100235302 232
77 3300025901 Ga0207688_10024680 Ga0207688_100246803 232
78 3300025915 Ga0207693_10405164 Ga0207693_104051641 232
79 3300025918 Ga0207662_10016418 Ga0207662_100164183 232
80 3300025918 Ga0207662_10101989 Ga0207662_101019894 232
81 3300025919 Ga0207657_10373847 Ga0207657_103738471 232
82 3300025923 Ga0207681_10056284 Ga0207681_100562842 232
83 3300025925 Ga0207650_10226048 Ga0207650_102260482 232
84 3300025925 Ga0207650_10565010 Ga0207650_105650101 232
85 3300025933 Ga0207706_10009459 Ga0207706_100094598 232
86 3300025933 Ga0207706_10437140 Ga0207706_104371402 232
87 3300025936 Ga0207670_10094500 Ga0207670_100945001 232
88 3300025937 Ga0207669_10044599 Ga0207669_100445992 232
89 3300025938 Ga0207704_10285417 Ga0207704_102854172 232
90 3300025940 Ga0207691_10085978 Ga0207691_100859782 232
91 3300025941 Ga0207711_10349899 Ga0207711_103498992 232
92 3300025942 Ga0207689_10177914 Ga0207689_101779142 232
93 3300025944 Ga0207661_10214140 Ga0207661_102141402 232
94 3300025960 Ga0207651_10416019 Ga0207651_104160192 232
95 3300026067 Ga0207678_10763844 Ga0207678_107638442 232
96 3300026078 Ga0207702_10016294 Ga0207702_100162943 232
97 3300026089 Ga0207648_10020005 Ga0207648_100200056 232
98 3300026116 Ga0207674_10116041 Ga0207674_101160412 232
99 3300026118 Ga0207675_100712662 Ga0207675_1007126622 232
100 3300026142 Ga0207698_10027150 Ga0207698_100271503 232
101 3300031241 Ga0265325_10001518 Ga0265325_100015183 232
102 3300031548 Ga0307408_100210532 Ga0307408_1002105322 232
103 3300031595 Ga0265313_10055829 Ga0265313_100558292 232
104 3300031711 Ga0265314_10003835 Ga0265314_1000383515 232
105 3300031824 Ga0307413_10405823 Ga0307413_104058232 232
106 3300031903 Ga0307407_10067094 Ga0307407_100670943 232
107 3300031995 Ga0307409_100262057 Ga0307409_1002620572 232
108 3300032126 Ga0307415_100272701 Ga0307415_1002727011 232
109 3300035115 Ga0373941_0008396 Ga0373941_0008396_495_1199 232
110 3300035170 Ga0373943_0324557 Ga0373943_0324557_15_716 232
111 3300035692 Ga0373935_0316604 Ga0373935_0316604_127_861 232
112 3300035692 Ga0373935_0544383 Ga0373935_0544383_22_720 232
113 3300037418 Ga0395900_0016660 Ga0395900_0016660_2843_3544 232
114 3300038443 Ga0395901_0010912 Ga0395901_0010912_1556_2257 232
115 3300039437 Ga0436365_0240233 Ga0436365_0240233_5785_6486 232
116 3300039437 Ga0436365_0302959 Ga0436365_0302959_1433_2155 232
117 3300039437 Ga0436365_1114955 Ga0436365_1114955_2580_3284 232
118 3300046460 Ga0495638_0041000 Ga0495638_0041000_918_1622 232
119 3300046474 Ga0495605_0056087 Ga0495605_0056087_431_1138 232
120 3300046474 Ga0495605_0243317 Ga0495605_0243317_19_723 232
121 3300046517 Ga0495630_0481330 Ga0495630_0481330_51_755 232
122 3300046539 Ga0495621_0080442 Ga0495621_0080442_154_879 232
123 3300046664 Ga0495659_0125286 Ga0495659_0125286_117_842 232
124 3300047447 Ga0495685_079103 Ga0495685_079103_225_932 232
125 3300048903 Ga0496100_0084811 Ga0496100_0084811_382_1113 232
126 3300048907 Ga0496104_0166362 Ga0496104_0166362_738_1439 232
127 3300048908 Ga0496105_0185260 Ga0496105_0185260_246_947 232
128 3300048918 Ga0496115_0091671 Ga0496115_0091671_192_896 232
129 3300049568 Ga0501031_0018531 Ga0501031_0018531_147_851 232
130 3300049569 Ga0501032_0003564 Ga0501032_0003564_1046_1816 232
131 3300049569 Ga0501032_0030094 Ga0501032_0030094_2393_3097 232
132 3300049569 Ga0501032_0032988 Ga0501032_0032988_2572_3276 232
133 3300049569 Ga0501032_0198538 Ga0501032_0198538_80_784 232
134 3300049570 Ga0501033_0022180 Ga0501033_0022180_1077_1781 232
135 3300049570 Ga0501033_0061658 Ga0501033_0061658_962_1666 232
136 3300049570 Ga0501033_0260458 Ga0501033_0260458_243_947 232
137 3300049571 Ga0501034_0000516 Ga0501034_0000516_50114_50938 232
138 3300049571 Ga0501034_0000850 Ga0501034_0000850_36008_36778 232
139 3300049571 Ga0501034_0007739 Ga0501034_0007739_2657_3361 232
140 3300049571 Ga0501034_0012629 Ga0501034_0012629_1471_2298 232
141 3300049571 Ga0501034_0025429 Ga0501034_0025429_835_1539 232
142 3300049571 Ga0501034_0195360 Ga0501034_0195360_488_1192 232
143 3300049571 Ga0501034_0242712 Ga0501034_0242712_230_934 232
144 3300049572 Ga0501036_0000547 Ga0501036_0000547_5190_5960 232
145 3300049572 Ga0501036_0017164 Ga0501036_0017164_2373_3077 232
146 3300049572 Ga0501036_0038161 Ga0501036_0038161_608_1312 232
147 3300049572 Ga0501036_0129334 Ga0501036_0129334_297_1001 232
148 3300049572 Ga0501036_0319429 Ga0501036_0319429_187_891 232
149 3300049572 Ga0501036_0348534 Ga0501036_0348534_267_971 232
150 3300049573 Ga0501037_0017976 Ga0501037_0017976_4308_5012 232
151 3300049573 Ga0501037_0024616 Ga0501037_0024616_3041_3811 232
152 3300049573 Ga0501037_0082125 Ga0501037_0082125_694_1398 232
153 3300049573 Ga0501037_0150685 Ga0501037_0150685_141_845 232
154 3300049573 Ga0501037_0289992 Ga0501037_0289992_424_1128 232
155 3300049573 Ga0501037_0318904 Ga0501037_0318904_341_1045 232
156 3300049574 Ga0501038_0045667 Ga0501038_0045667_835_1539 232
157 3300049574 Ga0501038_0131386 Ga0501038_0131386_77_781 232
158 3300049574 Ga0501038_0315661 Ga0501038_0315661_113_817 232
159 3300049575 Ga0501039_0003067 Ga0501039_0003067_6348_7052 232
160 3300049575 Ga0501039_0076329 Ga0501039_0076329_1310_2014 232
161 3300049576 Ga0501040_0278221 Ga0501040_0278221_25_729 232
162 3300049579 Ga0501043_0003257 Ga0501043_0003257_3915_4685 232
163 3300049579 Ga0501043_0003673 Ga0501043_0003673_3556_4260 232
164 3300049579 Ga0501043_0018936 Ga0501043_0018936_122_826 232
165 3300049579 Ga0501043_0091383 Ga0501043_0091383_1344_2048 232
166 3300049580 Ga0501046_0092974 Ga0501046_0092974_1330_2100 232
167 3300049580 Ga0501046_0386307 Ga0501046_0386307_293_997 232
168 3300049581 Ga0501047_0000455 Ga0501047_0000455_8447_9217 232
169 3300049581 Ga0501047_0024148 Ga0501047_0024148_4392_5096 232
170 3300049581 Ga0501047_0128575 Ga0501047_0128575_1672_2376 232
171 3300049581 Ga0501047_0142177 Ga0501047_0142177_1383_2087 232
172 3300049581 Ga0501047_0801627 Ga0501047_0801627_15_719 232
173 3300049582 Ga0501048_0002034 Ga0501048_0002034_8502_9272 232
174 3300049582 Ga0501048_0158484 Ga0501048_0158484_660_1364 232
175 3300049584 Ga0501068_0118921 Ga0501068_0118921_412_1116 232
176 3300049584 Ga0501068_0137882 Ga0501068_0137882_164_868 232
177 3300049584 Ga0501068_0328061 Ga0501068_0328061_238_939 232
178 3300049586 Ga0501070_0003722 Ga0501070_0003722_8064_8834 232
179 3300049586 Ga0501070_0020920 Ga0501070_0020920_22_726 232
180 3300049586 Ga0501070_0076879 Ga0501070_0076879_896_1600 232
181 3300049587 Ga0501071_0195691 Ga0501071_0195691_587_1291 232
182 3300049588 Ga0501072_0003523 Ga0501072_0003523_6632_7429 232
183 3300049589 Ga0501073_0011899 Ga0501073_0011899_1988_2758 232
184 3300049589 Ga0501073_0036690 Ga0501073_0036690_62_766 232
185 3300049589 Ga0501073_0305903 Ga0501073_0305903_157_864 232
186 3300049589 Ga0501073_0521637 Ga0501073_0521637_56_757 232
187 3300049590 Ga0501074_0024490 Ga0501074_0024490_881_1585 232
188 3300049592 Ga0501076_0319178 Ga0501076_0319178_76_780 232
189 3300049742 Ga0501080_0001026 Ga0501080_0001026_8459_9229 232
190 3300049742 Ga0501080_0012079 Ga0501080_0012079_3181_3885 232
191 3300049742 Ga0501080_0094108 Ga0501080_0094108_741_1445 232
192 3300049744 Ga0501083_0010516 Ga0501083_0010516_581_1351 232
193 3300049744 Ga0501083_0026213 Ga0501083_0026213_2788_3492 232
194 3300049744 Ga0501083_0030240 Ga0501083_0030240_719_1423 232
195 3300049744 Ga0501083_0457591 Ga0501083_0457591_84_788 232
196 3300049822 Ga0501035_0029743 Ga0501035_0029743_3803_4507 232
197 3300049822 Ga0501035_0315892 Ga0501035_0315892_123_827 232
198 3300049822 Ga0501035_0428939 Ga0501035_0428939_240_944 232
199 3300049823 Ga0501044_0024576 Ga0501044_0024576_2091_2795 232
200 3300049823 Ga0501044_0057824 Ga0501044_0057824_430_1134 232
201 3300049823 Ga0501044_0237298 Ga0501044_0237298_403_1107 232
202 3300049823 Ga0501044_0242762 Ga0501044_0242762_439_1143 232
203 3300049823 Ga0501044_0576450 Ga0501044_0576450_10_741 232
204 3300049824 Ga0501045_0347879 Ga0501045_0347879_376_1080 232
205 3300050491 nmdc:mga00v17_82170_c1 nmdc:mga00v17_82170_c1_1288_1992 232
206 3300050492 nmdc:mga0yw44_107588_c1 nmdc:mga0yw44_107588_c1_704_1405 232
207 3300050494 nmdc:mga06z11_182691_c1 nmdc:mga06z11_182691_c1_321_1025 232
208 3300050494 nmdc:mga06z11_372957_c1 nmdc:mga06z11_372957_c1_82_786 232
209 3300050495 nmdc:mga04h51_148759_c1 nmdc:mga04h51_148759_c1_71_802 232
210 3300050496 nmdc:mga07m45_165553_c1 nmdc:mga07m45_165553_c1_114_836 232
211 3300050496 nmdc:mga07m45_32490_c1 nmdc:mga07m45_32490_c1_1915_2619 232
212 3300050496 nmdc:mga07m45_85170_c1 nmdc:mga07m45_85170_c1_969_1673 232
213 3300053086 Ga0500578_0247208 Ga0500578_0247208_322_1026 232
214 3300053088 Ga0500644_0000616 Ga0500644_0000616_4654_5358 232
215 3300053093 Ga0500651_0032245 Ga0500651_0032245_2127_2831 232
216 3300053094 Ga0500566_0141170 Ga0500566_0141170_436_1140 232
217 3300053096 Ga0500641_0015291 Ga0500641_0015291_128_829 232
218 3300053096 Ga0500641_0038549 Ga0500641_0038549_827_1531 232
219 3300053118 Ga0500594_0046216 Ga0500594_0046216_273_977 232
220 3300053119 Ga0500595_000002 Ga0500595_000002_723434_724138 232
221 3300053142 Ga0500577_0246005 Ga0500577_0246005_14_715 232
222 3300053142 Ga0500577_0261134 Ga0500577_0261134_22_726 232
223 3300053153 Ga0500616_0000002 Ga0500616_0000002_769605_770309 232
224 3300053730 Ga0500645_000012 Ga0500645_000012_161693_162397 232
225 3300060353 Ga0501082_0000016 Ga0501082_0000016_81610_82314 232
226 3300060353 Ga0501082_0070028 Ga0501082_0070028_954_1658 232
227 3300060353 Ga0501082_0139293 Ga0501082_0139293_306_1094 232
228 3300001977 JGI24746J21847_1000187 JGI24746J21847_10001879 233
229 3300001978 JGI24747J21853_1005659 JGI24747J21853_10056592 233
230 3300001989 JGI24739J22299_10000841 JGI24739J22299_100008415 233
231 3300001990 JGI24737J22298_10000354 JGI24737J22298_1000035411 233
232 3300002070 JGI24750J21931_1000271 JGI24750J21931_10002719 233
233 3300002073 JGI24745J21846_1000158 JGI24745J21846_10001583 233
234 3300002076 JGI24749J21850_1000812 JGI24749J21850_10008121 233
235 3300002077 JGI24744J21845_10006674 JGI24744J21845_100066744 233
236 3300002126 JGI24035J26624_1000301 JGI24035J26624_10003017 233
237 3300002155 JGI24033J26618_1016020 JGI24033J26618_10160201 233
238 3300002459 JGI24751J29686_10011272 JGI24751J29686_100112722 233
239 3300003371 JGI26145J50221_1001271 JGI26145J50221_10012713 233
240 3300003781 Ga0055536_1012680 Ga0055536_10126804 233
241 3300005293 Ga0065715_10089022 Ga0065715_100890225 233
242 3300005328 Ga0070676_10003948 Ga0070676_100039485 233
243 3300005329 Ga0070683_100008259 Ga0070683_10000825910 233
244 3300005330 Ga0070690_100000577 Ga0070690_1000005778 233
245 3300005333 Ga0070677_10001438 Ga0070677_100014382 233
246 3300005334 Ga0068869_100006582 Ga0068869_1000065829 233
247 3300005335 Ga0070666_10012088 Ga0070666_100120883 233
248 3300005335 Ga0070666_10147827 Ga0070666_101478272 233
249 3300005336 Ga0070680_100006307 Ga0070680_1000063075 233
250 3300005336 Ga0070680_100226179 Ga0070680_1002261791 233
251 3300005337 Ga0070682_100003225 Ga0070682_10000322510 233
252 3300005338 Ga0068868_100451612 Ga0068868_1004516122 233
253 3300005339 Ga0070660_100004146 Ga0070660_1000041467 233
254 3300005340 Ga0070689_100014858 Ga0070689_1000148585 233
255 3300005341 Ga0070691_10005385 Ga0070691_100053855 233
256 3300005343 Ga0070687_100001224 Ga0070687_1000012244 233
257 3300005344 Ga0070661_100000804 Ga0070661_10000080419 233
258 3300005345 Ga0070692_10000837 Ga0070692_100008375 233
259 3300005347 Ga0070668_100006098 Ga0070668_10000609810 233
260 3300005353 Ga0070669_100006161 Ga0070669_1000061614 233
261 3300005354 Ga0070675_100017427 Ga0070675_1000174275 233
262 3300005355 Ga0070671_100009037 Ga0070671_10000903710 233
263 3300005355 Ga0070671_100048819 Ga0070671_1000488192 233
264 3300005356 Ga0070674_100004299 Ga0070674_1000042997 233
265 3300005364 Ga0070673_100006345 Ga0070673_1000063457 233
266 3300005365 Ga0070688_100000558 Ga0070688_1000005587 233
267 3300005366 Ga0070659_100024392 Ga0070659_1000243922 233
268 3300005367 Ga0070667_100008212 Ga0070667_1000082124 233
269 3300005406 Ga0070703_10011177 Ga0070703_100111773 233
270 3300005434 Ga0070709_10098327 Ga0070709_100983272 233
271 3300005435 Ga0070714_100031220 Ga0070714_1000312203 233
272 3300005436 Ga0070713_100164081 Ga0070713_1001640812 233
273 3300005437 Ga0070710_10053652 Ga0070710_100536522 233
274 3300005437 Ga0070710_10207862 Ga0070710_102078622 233
275 3300005438 Ga0070701_10001856 Ga0070701_100018564 233
276 3300005439 Ga0070711_100027090 Ga0070711_1000270903 233
277 3300005439 Ga0070711_100111410 Ga0070711_1001114102 233
278 3300005440 Ga0070705_100005648 Ga0070705_1000056484 233
279 3300005441 Ga0070700_100003794 Ga0070700_1000037949 233
280 3300005441 Ga0070700_100101699 Ga0070700_1001016992 233
281 3300005444 Ga0070694_100041579 Ga0070694_1000415795 233
282 3300005445 Ga0070708_100021889 Ga0070708_1000218892 233
283 3300005455 Ga0070663_100003833 Ga0070663_1000038339 233
284 3300005456 Ga0070678_100002855 Ga0070678_1000028555 233
285 3300005457 Ga0070662_100070943 Ga0070662_1000709431 233
286 3300005458 Ga0070681_10008839 Ga0070681_100088396 233
287 3300005459 Ga0068867_100012098 Ga0068867_1000120987 233
288 3300005466 Ga0070685_10061880 Ga0070685_100618802 233
289 3300005530 Ga0070679_100010504 Ga0070679_1000105044 233
290 3300005535 Ga0070684_100001753 Ga0070684_1000017535 233
291 3300005536 Ga0070697_100341652 Ga0070697_1003416521 233
292 3300005539 Ga0068853_100008092 Ga0068853_1000080929 233
293 3300005543 Ga0070672_100004614 Ga0070672_10000461410 233
294 3300005544 Ga0070686_100001565 Ga0070686_1000015659 233
295 3300005545 Ga0070695_100217315 Ga0070695_1002173152 233
296 3300005546 Ga0070696_100198575 Ga0070696_1001985751 233
297 3300005547 Ga0070693_100002143 Ga0070693_1000021434 233
298 3300005549 Ga0070704_100004087 Ga0070704_1000040879 233
299 3300005563 Ga0068855_100074740 Ga0068855_1000747404 233
300 3300005564 Ga0070664_100028636 Ga0070664_1000286365 233
301 3300005577 Ga0068857_100004864 Ga0068857_1000048647 233
302 3300005578 Ga0068854_100005702 Ga0068854_1000057022 233
303 3300005614 Ga0068856_100061308 Ga0068856_1000613085 233
304 3300005615 Ga0070702_100007505 Ga0070702_1000075052 233
305 3300005616 Ga0068852_100002326 Ga0068852_10000232614 233
306 3300005617 Ga0068859_100040171 Ga0068859_1000401712 233
307 3300005618 Ga0068864_100006005 Ga0068864_1000060059 233
308 3300005618 Ga0068864_100439536 Ga0068864_1004395361 233
309 3300005718 Ga0068866_10000301 Ga0068866_100003017 233
310 3300005719 Ga0068861_100005394 Ga0068861_1000053945 233
311 3300005840 Ga0068870_10000419 Ga0068870_100004197 233
312 3300005841 Ga0068863_100000340 Ga0068863_10000034036 233
313 3300005842 Ga0068858_100036890 Ga0068858_1000368903 233
314 3300005843 Ga0068860_100037560 Ga0068860_1000375605 233
315 3300005844 Ga0068862_100009969 Ga0068862_10000996910 233
316 3300006028 Ga0070717_10040793 Ga0070717_100407932 233
317 3300006175 Ga0070712_100256184 Ga0070712_1002561842 233
318 3300006186 Ga0075369_10077093 Ga0075369_100770932 233
319 3300006237 Ga0097621_100000880 Ga0097621_10000088010 233
320 3300006358 Ga0068871_100000301 Ga0068871_10000030131 233
321 3300006852 Ga0075433_10006405 Ga0075433_100064058 233
322 3300006871 Ga0075434_100007954 Ga0075434_1000079546 233
323 3300006881 Ga0068865_100003905 Ga0068865_10000390510 233
324 3300006931 Ga0097620_100040169 Ga0097620_1000401695 233
325 3300009092 Ga0105250_10027060 Ga0105250_100270602 233
326 3300009093 Ga0105240_10043237 Ga0105240_100432372 233
327 3300009094 Ga0111539_10020700 Ga0111539_100207008 233
328 3300009098 Ga0105245_10018996 Ga0105245_100189964 233
329 3300009101 Ga0105247_10002113 Ga0105247_100021139 233
330 3300009148 Ga0105243_10012907 Ga0105243_100129078 233
331 3300009174 Ga0105241_10001943 Ga0105241_1000194311 233
332 3300009177 Ga0105248_10003102 Ga0105248_100031029 233
333 3300009545 Ga0105237_10017102 Ga0105237_100171022 233
334 3300009553 Ga0105249_10001599 Ga0105249_1000159917 233
335 3300010375 Ga0105239_10024058 Ga0105239_100240584 233
336 3300011119 Ga0105246_10017880 Ga0105246_100178804 233
337 3300013100 Ga0157373_10007508 Ga0157373_100075085 233
338 3300013102 Ga0157371_10008631 Ga0157371_100086318 233
339 3300013104 Ga0157370_10002130 Ga0157370_1000213027 233
340 3300013296 Ga0157374_10001695 Ga0157374_100016956 233
341 3300013297 Ga0157378_10003374 Ga0157378_1000337417 233
342 3300013306 Ga0163162_10055943 Ga0163162_100559431 233
343 3300013307 Ga0157372_10004321 Ga0157372_100043217 233
344 3300013308 Ga0157375_10019602 Ga0157375_100196022 233
345 3300014325 Ga0163163_10229268 Ga0163163_102292682 233
346 3300014326 Ga0157380_10006382 Ga0157380_100063824 233
347 3300014968 Ga0157379_10006391 Ga0157379_100063915 233
348 3300015265 Ga0182005_1000055 Ga0182005_100005577 233
349 3300017792 Ga0163161_10009345 Ga0163161_100093459 233
350 3300021388 Ga0213875_10002533 Ga0213875_100025334 233
351 3300025271 Ga0207666_1000059 Ga0207666_10000599 233
352 3300025290 Ga0207673_1009757 Ga0207673_10097572 233
353 3300025291 Ga0209675_1000970 Ga0209675_10009705 233
354 3300025292 Ga0209676_1000089 Ga0209676_1000089183 233
355 3300025298 Ga0209050_1008016 Ga0209050_10080167 233
356 3300025315 Ga0207697_10002326 Ga0207697_1000232611 233
357 3300025711 Ga0207696_1021692 Ga0207696_10216922 233
358 3300025885 Ga0207653_10009705 Ga0207653_100097053 233
359 3300025893 Ga0207682_10002173 Ga0207682_100021739 233
360 3300025899 Ga0207642_10012159 Ga0207642_100121594 233
361 3300025900 Ga0207710_10004879 Ga0207710_100048794 233
362 3300025901 Ga0207688_10000167 Ga0207688_1000016719 233
363 3300025903 Ga0207680_10025573 Ga0207680_100255732 233
364 3300025904 Ga0207647_10002561 Ga0207647_100025617 233
365 3300025906 Ga0207699_10283810 Ga0207699_102838102 233
366 3300025907 Ga0207645_10005337 Ga0207645_100053378 233
367 3300025908 Ga0207643_10000007 Ga0207643_10000007189 233
368 3300025911 Ga0207654_10002202 Ga0207654_100022026 233
369 3300025912 Ga0207707_10014147 Ga0207707_100141477 233
370 3300025912 Ga0207707_10176301 Ga0207707_101763012 233
371 3300025914 Ga0207671_10173593 Ga0207671_101735932 233
372 3300025915 Ga0207693_10000563 Ga0207693_1000056319 233
373 3300025917 Ga0207660_10002332 Ga0207660_100023329 233
374 3300025918 Ga0207662_10000195 Ga0207662_1000019520 233
375 3300025919 Ga0207657_10002386 Ga0207657_100023869 233
376 3300025920 Ga0207649_10000944 Ga0207649_100009449 233
377 3300025921 Ga0207652_10009630 Ga0207652_100096309 233
378 3300025924 Ga0207694_10090984 Ga0207694_100909842 233
379 3300025925 Ga0207650_10012289 Ga0207650_100122895 233
380 3300025926 Ga0207659_10002481 Ga0207659_100024819 233
381 3300025927 Ga0207687_10000072 Ga0207687_1000007280 233
382 3300025929 Ga0207664_10161248 Ga0207664_101612482 233
383 3300025931 Ga0207644_10022392 Ga0207644_100223922 233
384 3300025931 Ga0207644_10125661 Ga0207644_101256613 233
385 3300025932 Ga0207690_10029980 Ga0207690_100299804 233
386 3300025933 Ga0207706_10008634 Ga0207706_100086348 233
387 3300025934 Ga0207686_10009296 Ga0207686_100092965 233
388 3300025935 Ga0207709_10002480 Ga0207709_1000248013 233
389 3300025936 Ga0207670_10000792 Ga0207670_1000079214 233
390 3300025937 Ga0207669_10001742 Ga0207669_1000174210 233
391 3300025938 Ga0207704_10003278 Ga0207704_100032786 233
392 3300025939 Ga0207665_10400739 Ga0207665_104007391 233
393 3300025940 Ga0207691_10009483 Ga0207691_100094836 233
394 3300025941 Ga0207711_10001106 Ga0207711_1000110624 233
395 3300025942 Ga0207689_10000366 Ga0207689_100003668 233
396 3300025944 Ga0207661_10010227 Ga0207661_100102275 233
397 3300025945 Ga0207679_10000029 Ga0207679_100000298 233
398 3300025949 Ga0207667_10111576 Ga0207667_101115763 233
399 3300025960 Ga0207651_10000292 Ga0207651_1000029223 233
400 3300025961 Ga0207712_10010471 Ga0207712_100104714 233
401 3300025972 Ga0207668_10010650 Ga0207668_100106506 233
402 3300025981 Ga0207640_10001667 Ga0207640_100016679 233
403 3300025986 Ga0207658_10038839 Ga0207658_100388395 233
404 3300026023 Ga0207677_10042618 Ga0207677_100426184 233
405 3300026035 Ga0207703_10009816 Ga0207703_100098169 233
406 3300026041 Ga0207639_10013289 Ga0207639_100132896 233
407 3300026067 Ga0207678_10006759 Ga0207678_100067598 233
408 3300026075 Ga0207708_10004100 Ga0207708_100041009 233
409 3300026078 Ga0207702_10011803 Ga0207702_100118035 233
410 3300026088 Ga0207641_10004156 Ga0207641_1000415612 233
411 3300026089 Ga0207648_10008435 Ga0207648_100084358 233
412 3300026095 Ga0207676_10000182 Ga0207676_100001826 233
413 3300026095 Ga0207676_10248790 Ga0207676_102487901 233
414 3300026116 Ga0207674_10007304 Ga0207674_100073049 233
415 3300026118 Ga0207675_100011726 Ga0207675_1000117269 233
416 3300026121 Ga0207683_10007517 Ga0207683_100075178 233
417 3300026142 Ga0207698_10005197 Ga0207698_1000519710 233
418 3300027364 Ga0209967_1016452 Ga0209967_10164521 233
419 3300027614 Ga0209970_1027402 Ga0209970_10274022 233
420 3300027717 Ga0209998_10000962 Ga0209998_100009628 233
421 3300027866 Ga0209813_10067392 Ga0209813_100673922 233
422 3300027876 Ga0209974_10000736 Ga0209974_100007368 233
423 3300027907 Ga0207428_10001793 Ga0207428_100017938 233
424 3300028380 Ga0268265_10004249 Ga0268265_100042499 233
425 3300028381 Ga0268264_10013946 Ga0268264_100139466 233
426 3300028786 Ga0307517_10020056 Ga0307517_100200562 233
427 3300031238 Ga0265332_10000732 Ga0265332_1000073214 233
428 3300031241 Ga0265325_10005918 Ga0265325_100059183 233
429 3300031241 Ga0265325_10071293 Ga0265325_100712932 233
430 3300031241 Ga0265325_10100954 Ga0265325_101009541 233
431 3300031242 Ga0265329_10010307 Ga0265329_100103072 233
432 3300031247 Ga0265340_10003622 Ga0265340_100036224 233
433 3300031247 Ga0265340_10095553 Ga0265340_100955532 233
434 3300031249 Ga0265339_10001116 Ga0265339_1000111613 233
435 3300031249 Ga0265339_10011954 Ga0265339_100119543 233
436 3300031250 Ga0265331_10006555 Ga0265331_100065555 233
437 3300031250 Ga0265331_10109471 Ga0265331_101094712 233
438 3300031344 Ga0265316_10137477 Ga0265316_101374772 233
439 3300031344 Ga0265316_10161230 Ga0265316_101612302 233
440 3300031456 Ga0307513_10176719 Ga0307513_101767192 233
441 3300031595 Ga0265313_10003835 Ga0265313_100038357 233
442 3300031595 Ga0265313_10007507 Ga0265313_100075077 233
443 3300031712 Ga0265342_10000258 Ga0265342_1000025836 233
444 3300031712 Ga0265342_10025712 Ga0265342_100257124 233
445 3300032005 Ga0307411_10212861 Ga0307411_102128612 233
446 3300034816 Ga0373930_0010963 Ga0373930_0010963_629_1330 233
447 3300034818 Ga0373950_0009099 Ga0373950_0009099_841_1542 233
448 3300034820 Ga0373959_0006771 Ga0373959_0006771_81_782 233
449 3300034957 Ga0373938_0001079 Ga0373938_0001079_3000_3701 233
450 3300035085 Ga0373929_0002864 Ga0373929_0002864_2189_2890 233
451 3300035088 Ga0373940_0002243 Ga0373940_0002243_1482_2183 233
452 3300035090 Ga0373949_0002153 Ga0373949_0002153_3104_3805 233
453 3300035092 Ga0373952_0002050 Ga0373952_0002050_1648_2349 233
454 3300035114 Ga0373939_0001680 Ga0373939_0001680_4507_5208 233
455 3300035116 Ga0373945_0030446 Ga0373945_0030446_1006_1713 233
456 3300035121 Ga0373960_0011101 Ga0373960_0011101_988_1689 233
457 3300035695 Ga0373927_0108287 Ga0373927_0108287_444_1151 233
458 3300036401 Ga0373937_0881888 Ga0373937_0881888_129_830 233
459 3300037068 Ga0373925_0271086 Ga0373925_0271086_270_992 233
460 3300037853 Ga0436364_0167179 Ga0436364_0167179_7017_7721 233
461 3300037853 Ga0436364_0335253 Ga0436364_0335253_42553_43266 233
462 3300037853 Ga0436364_1247966 Ga0436364_1247966_8681_9430 233
463 3300039437 Ga0436365_0665259 Ga0436365_0665259_188_889 233
464 3300039437 Ga0436365_1069579 Ga0436365_1069579_45_746 233
465 3300039438 Ga0436360_0020476 Ga0436360_0020476_1920_2624 233
466 3300039447 Ga0436361_0136044 Ga0436361_0136044_6179_6937 233
467 3300039450 Ga0436363_0251431 Ga0436363_0251431_552_1256 233
468 3300039450 Ga0436363_0490009 Ga0436363_0490009_179_880 233
469 3300039450 Ga0436363_1384763 Ga0436363_1384763_1639_2343 233
470 3300039453 Ga0436362_0280123 Ga0436362_0280123_431_1135 233
471 3300045051 Ga0451576_0732102 Ga0451576_0732102_177_914 233
472 3300046683 Ga0495658_0502899 Ga0495658_0502899_38_742 233
473 3300046684 Ga0495669_0082359 Ga0495669_0082359_112_813 233
474 3300048903 Ga0496100_0037625 Ga0496100_0037625_902_1603 233
475 3300048904 Ga0496101_0108779 Ga0496101_0108779_1034_1735 233
476 3300048906 Ga0496103_0002596 Ga0496103_0002596_8190_8891 233
477 3300048907 Ga0496104_0301403 Ga0496104_0301403_578_1279 233
478 3300048909 Ga0496106_0035717 Ga0496106_0035717_853_1554 233
479 3300048910 Ga0496107_0040869 Ga0496107_0040869_2478_3179 233
480 3300048911 Ga0496108_0028028 Ga0496108_0028028_407_1108 233
481 3300048912 Ga0496109_0008888 Ga0496109_0008888_6258_6959 233
482 3300048913 Ga0496110_0176925 Ga0496110_0176925_660_1361 233
483 3300048913 Ga0496110_0350514 Ga0496110_0350514_55_813 233
484 3300048914 Ga0496111_0294123 Ga0496111_0294123_382_1083 233
485 3300048917 Ga0496114_0005989 Ga0496114_0005989_3262_3963 233
486 3300048918 Ga0496115_0031731 Ga0496115_0031731_2596_3297 233
487 3300048928 Ga0496125_0034764 Ga0496125_0034764_1104_1916 233
488 3300049571 Ga0501034_0418243 Ga0501034_0418243_449_1150 233
489 3300049585 Ga0501069_0005711 Ga0501069_0005711_305_1012 233
490 3300049586 Ga0501070_0038661 Ga0501070_0038661_1777_2484 233
491 3300049741 Ga0501079_0334186 Ga0501079_0334186_318_1025 233
492 3300049744 Ga0501083_0066710 Ga0501083_0066710_1570_2277 233
493 3300049822 Ga0501035_0001156 Ga0501035_0001156_6018_6725 233
494 3300049823 Ga0501044_0551295 Ga0501044_0551295_22_723 233
495 3300050511 nmdc:mga08y16_439554_c1 nmdc:mga08y16_439554_c1_481_1182 233
496 3300050512 nmdc:mga0n895_1284_c1 nmdc:mga0n895_1284_c1_6127_6828 233
497 3300050512 nmdc:mga0n895_574709_c1 nmdc:mga0n895_574709_c1_145_849 233
498 3300050513 nmdc:mga0rr50_366859_c1 nmdc:mga0rr50_366859_c1_481_1182 233
499 3300050515 nmdc:mga0a205_1140_c1 nmdc:mga0a205_1140_c1_17428_18129 233
500 3300053111 Ga0500572_080261 Ga0500572_080261_84_785 233
501 3300053117 Ga0500593_003255 Ga0500593_003255_4280_4981 233
502 3300053729 Ga0500625_045483 Ga0500625_045483_954_1676 233
503 3300053737 Ga0500601_001022 Ga0500601_001022_86_787 233
504 3300060353 Ga0501082_0172625 Ga0501082_0172625_49_756 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

46

258

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kgb-assembly1.cif.gz_A structure of succinyl-coa: 3-ketoacid coa transferase from drosophila melanogaster 0.9771 3 226
4kgb-assembly1.cif.gz_B structure of succinyl-coa: 3-ketoacid coa transferase from drosophila melanogaster 0.977 3 226
5dbn-assembly2.cif.gz_E crystal structure of atoda complex 0.974 3 215
1ooz-assembly1.cif.gz_A deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart 0.9739 3 226
1o9l-assembly2.cif.gz_C succinate:coenzyme-a transferase (pig heart) 0.9737 3 226
ID Description Score Start End Superfamily
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9764 1 215 3.40.1080.10
2nrbB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9745 3 217 3.40.1080.10
af_Q4E2P8_5_264_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9669 1 229 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.963 1 215 3.40.1080.10
af_A4I5L9_2_259_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9513 4 231 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A3C0Y3Z3-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9974 1 79 GO:0008410
AF-A0A257PXQ8-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9973 1 107 GO:0008410
AF-A0A4V1QWY8-F1-model_v4 deleted 0.9958 26 102
AF-A0A5A7MRX1-F1-model_v4 merged 0.9946 1 155
AF-A0A2V6D029-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9938 1 93 GO:0008410

Feature Viewer

pLDDT pTM Quality
91.36 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map