F456263
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 504 | 336 | 493 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0012629|Ga0501034_0012629_1471_2298 |
| Length | 275 |
| Sequence | LRLAASLEANRRAAKALRSVTLTFRRAGFYANGILFPIGGFMKKVYPNAKAALDGIVKDGMMVLAAGFGLCGMPATLIEALRDSGVKNLTCVSNNAGIDGAGLGLLLETRQIKKMIASYVGENKLFAAQYLAGELEIEFNPQGTLAERMRAGGAGIPAFFTKTGVGTEIAKGKEERTFNGQRYIMETGLVGDIALVHAWKGDTEGNLVYRKTARNFNPVMATAAKITVAEVEHLVQPGELDGDMIHTPGVFVQRIIHTTAEKRIEVRTLRKRNAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 2 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 3 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 4 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 5 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 6 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 7 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 8 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 9 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 10 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 11 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 12 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 13 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 16 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 17 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 18 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 19 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 20 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 21 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 22 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 23 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 24 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 94 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 101 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 102 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 107 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 108 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 111 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 112 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 113 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 144 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 218 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 220 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 222 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 226 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 227 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 228 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 231 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 232 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 233 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 234 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 235 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 236 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 237 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 238 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 239 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 240 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 243 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 244 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 245 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 249 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 251 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 256 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 257 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 258 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 259 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 260 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 261 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 262 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 263 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 275 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 276 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 277 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 278 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 279 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 282 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 285 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 286 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 314 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 315 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 316 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 317 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 318 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 323 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 325 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 326 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 327 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 328 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 329 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 330 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 331 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 332 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 333 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 334 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 335 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 336 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.62 |
| Metatranscriptomes | 0.2 |
| Isolates | 2.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.54 |
| Nodule | 0.6 |
| Rhizoplane | 3.37 |
| Rhizosphere | 83.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000187 | 3300001977 | Bacteria | 8222 |
| 2 | JGI24747J21853_1005659 | 3300001978 | Bacteria | 1161 |
| 3 | JGI24739J22299_10000841 | 3300001989 | Bacteria | 11280 |
| 4 | JGI24737J22298_10000354 | 3300001990 | Bacteria | 15482 |
| 5 | JGI24750J21931_1000271 | 3300002070 | Bacteria | 8864 |
| 6 | JGI24745J21846_1000158 | 3300002073 | Bacteria | 5345 |
| 7 | JGI24749J21850_1000812 | 3300002076 | Bacteria | 4489 |
| 8 | JGI24744J21845_10006674 | 3300002077 | Bacteria | 2389 |
| 9 | JGI24035J26624_1000301 | 3300002126 | Bacteria | 4584 |
| 10 | JGI24033J26618_1016020 | 3300002155 | Bacteria | 929 |
| 11 | JGI24751J29686_10011272 | 3300002459 | Bacteria | 1844 |
| 12 | JGI24751J29686_10033145 | 3300002459 | Bacteria | 1071 |
| 13 | JGI25406J46586_10010387 | 3300003203 | Bacteria | 4133 |
| 14 | JGI26145J50221_1001271 | 3300003371 | Bacteria | 1998 |
| 15 | Ga0055536_1012680 | 3300003781 | Bacteria | 3106 |
| 16 | JGI25405J52794_10034128 | 3300003911 | Bacteria | 1063 |
| 17 | Ga0065715_10089022 | 3300005293 | Bacteria | 16633 |
| 18 | Ga0065715_10169532 | 3300005293 | Bacteria | 1558 |
| 19 | Ga0070658_10159734 | 3300005327 | Bacteria | 1890 |
| 20 | Ga0070676_10003948 | 3300005328 | Bacteria | 7786 |
| 21 | Ga0070683_100008259 | 3300005329 | Bacteria | 8848 |
| 22 | Ga0070690_100000577 | 3300005330 | Bacteria | 18482 |
| 23 | Ga0070690_100134746 | 3300005330 | Bacteria | 1672 |
| 24 | Ga0070670_100216634 | 3300005331 | Bacteria | 1665 |
| 25 | Ga0070670_100228110 | 3300005331 | Bacteria | 1621 |
| 26 | Ga0070677_10001438 | 3300005333 | Bacteria | 7555 |
| 27 | Ga0070677_10217322 | 3300005333 | Bacteria | 931 |
| 28 | Ga0068869_100006582 | 3300005334 | Bacteria | 7372 |
| 29 | Ga0070666_10012088 | 3300005335 | Bacteria | 5436 |
| 30 | Ga0070666_10147827 | 3300005335 | Bacteria | 1639 |
| 31 | Ga0070680_100006307 | 3300005336 | Bacteria | 9007 |
| 32 | Ga0070680_100226179 | 3300005336 | Bacteria | 1580 |
| 33 | Ga0070682_100003225 | 3300005337 | Bacteria | 9046 |
| 34 | Ga0068868_100405302 | 3300005338 | Bacteria | 1177 |
| 35 | Ga0068868_100451612 | 3300005338 | Bacteria | 1118 |
| 36 | Ga0070660_100004146 | 3300005339 | Bacteria | 10010 |
| 37 | Ga0070689_100014858 | 3300005340 | Bacteria | 5665 |
| 38 | Ga0070689_100091327 | 3300005340 | Bacteria | 2400 |
| 39 | Ga0070689_100138102 | 3300005340 | Bacteria | 1958 |
| 40 | Ga0070691_10005385 | 3300005341 | Bacteria | 5819 |
| 41 | Ga0070691_10286075 | 3300005341 | Bacteria | 896 |
| 42 | Ga0070687_100001224 | 3300005343 | Bacteria | 8906 |
| 43 | Ga0070687_100044320 | 3300005343 | Bacteria | 2266 |
| 44 | Ga0070661_100000804 | 3300005344 | Bacteria | 22558 |
| 45 | Ga0070661_100268522 | 3300005344 | Bacteria | 1320 |
| 46 | Ga0070692_10000837 | 3300005345 | Bacteria | 10325 |
| 47 | Ga0070668_100006098 | 3300005347 | Bacteria | 8940 |
| 48 | Ga0070669_100006161 | 3300005353 | Bacteria | 8659 |
| 49 | Ga0070669_100412682 | 3300005353 | Bacteria | 1107 |
| 50 | Ga0070675_100017427 | 3300005354 | Bacteria | 5707 |
| 51 | Ga0070671_100009037 | 3300005355 | Bacteria | 7995 |
| 52 | Ga0070671_100048819 | 3300005355 | Bacteria | 3521 |
| 53 | Ga0070674_100004299 | 3300005356 | Bacteria | 8105 |
| 54 | Ga0070673_100006345 | 3300005364 | Bacteria | 7683 |
| 55 | Ga0070688_100000558 | 3300005365 | Bacteria | 18862 |
| 56 | Ga0070688_100251936 | 3300005365 | Bacteria | 1257 |
| 57 | Ga0070659_100024392 | 3300005366 | Bacteria | 4636 |
| 58 | Ga0070667_100008212 | 3300005367 | Bacteria | 8653 |
| 59 | Ga0070703_10011177 | 3300005406 | Bacteria | 2535 |
| 60 | Ga0070709_10098327 | 3300005434 | Bacteria | 1945 |
| 61 | Ga0070714_100031220 | 3300005435 | Bacteria | 4444 |
| 62 | Ga0070713_100077384 | 3300005436 | Bacteria | 2828 |
| 63 | Ga0070713_100164081 | 3300005436 | Bacteria | 1985 |
| 64 | Ga0070710_10053652 | 3300005437 | Bacteria | 2272 |
| 65 | Ga0070710_10207862 | 3300005437 | Bacteria | 1239 |
| 66 | Ga0070701_10001856 | 3300005438 | Bacteria | 8013 |
| 67 | Ga0070701_10405603 | 3300005438 | Bacteria | 865 |
| 68 | Ga0070711_100027090 | 3300005439 | Bacteria | 3760 |
| 69 | Ga0070711_100111410 | 3300005439 | Bacteria | 2009 |
| 70 | Ga0070705_100005648 | 3300005440 | Bacteria | 6105 |
| 71 | Ga0070700_100003794 | 3300005441 | Bacteria | 7825 |
| 72 | Ga0070700_100101699 | 3300005441 | Bacteria | 1894 |
| 73 | Ga0070694_100041579 | 3300005444 | Bacteria | 3067 |
| 74 | Ga0070708_100021889 | 3300005445 | Bacteria | 5416 |
| 75 | Ga0070663_100003833 | 3300005455 | Bacteria | 8754 |
| 76 | Ga0070678_100002855 | 3300005456 | Bacteria | 9561 |
| 77 | Ga0070678_100095481 | 3300005456 | Bacteria | 2291 |
| 78 | Ga0070662_100070943 | 3300005457 | Bacteria | 2567 |
| 79 | Ga0070662_100126604 | 3300005457 | Bacteria | 1964 |
| 80 | Ga0070681_10008839 | 3300005458 | Bacteria | 9895 |
| 81 | Ga0068867_100012098 | 3300005459 | Bacteria | 6094 |
| 82 | Ga0070685_10048175 | 3300005466 | Bacteria | 2453 |
| 83 | Ga0070685_10061880 | 3300005466 | Bacteria | 2193 |
| 84 | Ga0070685_10139263 | 3300005466 | Bacteria | 1526 |
| 85 | Ga0070679_100010504 | 3300005530 | Bacteria | 8785 |
| 86 | Ga0070684_100001753 | 3300005535 | Bacteria | 15811 |
| 87 | Ga0070697_100341652 | 3300005536 | Bacteria | 1292 |
| 88 | Ga0068853_100008092 | 3300005539 | Bacteria | 8437 |
| 89 | Ga0070672_100004614 | 3300005543 | Bacteria | 9024 |
| 90 | Ga0070686_100001565 | 3300005544 | Bacteria | 12859 |
| 91 | Ga0070695_100217315 | 3300005545 | Bacteria | 1375 |
| 92 | Ga0070696_100198575 | 3300005546 | Bacteria | 1496 |
| 93 | Ga0070693_100002143 | 3300005547 | Bacteria | 9046 |
| 94 | Ga0070665_100536717 | 3300005548 | Bacteria | 1182 |
| 95 | Ga0070704_100004087 | 3300005549 | Bacteria | 8421 |
| 96 | Ga0068855_100074740 | 3300005563 | Bacteria | 3935 |
| 97 | Ga0070664_100028636 | 3300005564 | Bacteria | 4636 |
| 98 | Ga0068857_100004864 | 3300005577 | Bacteria | 11393 |
| 99 | Ga0068854_100005702 | 3300005578 | Bacteria | 7869 |
| 100 | Ga0068856_100014335 | 3300005614 | Bacteria | 7665 |
| 101 | Ga0068856_100061308 | 3300005614 | Bacteria | 3715 |
| 102 | Ga0068856_100731318 | 3300005614 | Bacteria | 1010 |
| 103 | Ga0070702_100007505 | 3300005615 | Bacteria | 5225 |
| 104 | Ga0068852_100002326 | 3300005616 | Bacteria | 13065 |
| 105 | Ga0068852_100147280 | 3300005616 | Bacteria | 2185 |
| 106 | Ga0068859_100040171 | 3300005617 | Bacteria | 4696 |
| 107 | Ga0068864_100006005 | 3300005618 | Bacteria | 9968 |
| 108 | Ga0068864_100439536 | 3300005618 | Bacteria | 1246 |
| 109 | Ga0068866_10000301 | 3300005718 | Bacteria | 23583 |
| 110 | Ga0068866_10228290 | 3300005718 | Bacteria | 1127 |
| 111 | Ga0068861_100005394 | 3300005719 | Bacteria | 8652 |
| 112 | Ga0068851_10449435 | 3300005834 | Bacteria | 766 |
| 113 | Ga0068870_10000419 | 3300005840 | Bacteria | 15983 |
| 114 | Ga0068863_100000340 | 3300005841 | Bacteria | 47641 |
| 115 | Ga0068858_100036890 | 3300005842 | Bacteria | 4531 |
| 116 | Ga0068858_100625117 | 3300005842 | Bacteria | 1046 |
| 117 | Ga0068860_100037560 | 3300005843 | Bacteria | 4636 |
| 118 | Ga0068860_100151051 | 3300005843 | Bacteria | 2237 |
| 119 | Ga0068862_100009969 | 3300005844 | Bacteria | 7849 |
| 120 | Ga0081455_10010585 | 3300005937 | Bacteria | 9338 |
| 121 | Ga0081455_10111172 | 3300005937 | Bacteria | 2177 |
| 122 | Ga0081540_1076063 | 3300005983 | Bacteria | 1531 |
| 123 | Ga0081540_1159726 | 3300005983 | Bacteria | 876 |
| 124 | Ga0081539_10016778 | 3300005985 | Bacteria | 5198 |
| 125 | Ga0070717_10040793 | 3300006028 | Bacteria | 3783 |
| 126 | Ga0075363_100022049 | 3300006048 | Bacteria | 3216 |
| 127 | Ga0075364_10020890 | 3300006051 | Bacteria | 4122 |
| 128 | Ga0070712_100256184 | 3300006175 | Bacteria | 1400 |
| 129 | Ga0075362_10049429 | 3300006177 | Bacteria | 1878 |
| 130 | Ga0075369_10077093 | 3300006186 | Bacteria | 1474 |
| 131 | Ga0075366_10012093 | 3300006195 | Bacteria | 4888 |
| 132 | Ga0097621_100000880 | 3300006237 | Bacteria | 21059 |
| 133 | Ga0075370_10096540 | 3300006353 | Bacteria | 1708 |
| 134 | Ga0075370_10113281 | 3300006353 | Bacteria | 1576 |
| 135 | Ga0075370_10169307 | 3300006353 | Bacteria | 1284 |
| 136 | Ga0068871_100000301 | 3300006358 | Bacteria | 34368 |
| 137 | Ga0068871_100526067 | 3300006358 | Bacteria | 1068 |
| 138 | Ga0075433_10006405 | 3300006852 | Bacteria | 9308 |
| 139 | Ga0075434_100007954 | 3300006871 | Bacteria | 9826 |
| 140 | Ga0068865_100003905 | 3300006881 | Bacteria | 8939 |
| 141 | Ga0097620_100040169 | 3300006931 | Bacteria | 4696 |
| 142 | Ga0105250_10027060 | 3300009092 | Bacteria | 2310 |
| 143 | Ga0105240_10043237 | 3300009093 | Bacteria | 5734 |
| 144 | Ga0105240_10266730 | 3300009093 | Bacteria | 1973 |
| 145 | Ga0111539_10020700 | 3300009094 | Bacteria | 8100 |
| 146 | Ga0105245_10018996 | 3300009098 | Bacteria | 6016 |
| 147 | Ga0105247_10002113 | 3300009101 | Bacteria | 13737 |
| 148 | Ga0105243_10012907 | 3300009148 | Bacteria | 6313 |
| 149 | Ga0105241_10001943 | 3300009174 | Bacteria | 15638 |
| 150 | Ga0105248_10003102 | 3300009177 | Bacteria | 18407 |
| 151 | Ga0105248_10126415 | 3300009177 | Bacteria | 2884 |
| 152 | Ga0105237_10017102 | 3300009545 | Bacteria | 7523 |
| 153 | Ga0105249_10001599 | 3300009553 | Bacteria | 19830 |
| 154 | Ga0105249_10506316 | 3300009553 | Bacteria | 1253 |
| 155 | Ga0105239_10024058 | 3300010375 | Bacteria | 6709 |
| 156 | Ga0105239_10390121 | 3300010375 | Bacteria | 1575 |
| 157 | Ga0105246_10017880 | 3300011119 | Bacteria | 4511 |
| 158 | Ga0157373_10007508 | 3300013100 | Bacteria | 8107 |
| 159 | Ga0157371_10008631 | 3300013102 | Bacteria | 8095 |
| 160 | Ga0157370_10002130 | 3300013104 | Bacteria | 24167 |
| 161 | Ga0157370_10442135 | 3300013104 | Bacteria | 1196 |
| 162 | Ga0157374_10001695 | 3300013296 | Bacteria | 18451 |
| 163 | Ga0157378_10003374 | 3300013297 | Bacteria | 14202 |
| 164 | Ga0157378_10199685 | 3300013297 | Bacteria | 1891 |
| 165 | Ga0163162_10055943 | 3300013306 | Bacteria | 3973 |
| 166 | Ga0163162_10801502 | 3300013306 | Bacteria | 1059 |
| 167 | Ga0157372_10004321 | 3300013307 | Bacteria | 15190 |
| 168 | Ga0157372_10768335 | 3300013307 | Bacteria | 1120 |
| 169 | Ga0157375_10019602 | 3300013308 | Bacteria | 6156 |
| 170 | Ga0163163_10229268 | 3300014325 | Bacteria | 1906 |
| 171 | Ga0163163_10539003 | 3300014325 | Bacteria | 1229 |
| 172 | Ga0157380_10006382 | 3300014326 | Bacteria | 8300 |
| 173 | Ga0157379_10006391 | 3300014968 | Bacteria | 10151 |
| 174 | Ga0182005_1000055 | 3300015265 | Bacteria | 111824 |
| 175 | Ga0163161_10009345 | 3300017792 | Bacteria | 6784 |
| 176 | Ga0206356_11653084 | 3300020070 | Bacteria | 868 |
| 177 | Ga0213876_10011887 | 3300021384 | Bacteria | 4640 |
| 178 | Ga0213876_10036527 | 3300021384 | Bacteria | 2591 |
| 179 | Ga0213876_10117761 | 3300021384 | Bacteria | 1410 |
| 180 | Ga0213875_10002533 | 3300021388 | Bacteria | 10899 |
| 181 | Ga0207666_1000059 | 3300025271 | Bacteria | 19909 |
| 182 | Ga0207673_1009757 | 3300025290 | Bacteria | 1229 |
| 183 | Ga0209675_1000970 | 3300025291 | Bacteria | 18131 |
| 184 | Ga0209676_1000089 | 3300025292 | Bacteria | 260196 |
| 185 | Ga0209050_1008016 | 3300025298 | Bacteria | 5759 |
| 186 | Ga0207697_10002326 | 3300025315 | Bacteria | 9897 |
| 187 | Ga0207696_1021692 | 3300025711 | Bacteria | 2053 |
| 188 | Ga0207653_10009705 | 3300025885 | Bacteria | 3001 |
| 189 | Ga0207682_10002173 | 3300025893 | Bacteria | 8857 |
| 190 | Ga0207682_10023530 | 3300025893 | Bacteria | 2434 |
| 191 | Ga0207642_10012159 | 3300025899 | Bacteria | 3098 |
| 192 | Ga0207710_10004879 | 3300025900 | Bacteria | 5815 |
| 193 | Ga0207688_10000167 | 3300025901 | Bacteria | 28809 |
| 194 | Ga0207688_10024680 | 3300025901 | Bacteria | 3299 |
| 195 | Ga0207680_10025573 | 3300025903 | Bacteria | 3258 |
| 196 | Ga0207647_10002561 | 3300025904 | Bacteria | 13747 |
| 197 | Ga0207699_10283810 | 3300025906 | Bacteria | 1151 |
| 198 | Ga0207645_10005337 | 3300025907 | Bacteria | 9341 |
| 199 | Ga0207643_10000007 | 3300025908 | Bacteria | 171706 |
| 200 | Ga0207654_10002202 | 3300025911 | Bacteria | 9986 |
| 201 | Ga0207707_10014147 | 3300025912 | Bacteria | 6952 |
| 202 | Ga0207707_10176301 | 3300025912 | Bacteria | 1867 |
| 203 | Ga0207671_10173593 | 3300025914 | Bacteria | 1675 |
| 204 | Ga0207693_10000563 | 3300025915 | Bacteria | 33538 |
| 205 | Ga0207693_10405164 | 3300025915 | Bacteria | 1066 |
| 206 | Ga0207660_10002332 | 3300025917 | Bacteria | 12496 |
| 207 | Ga0207662_10000195 | 3300025918 | Bacteria | 28315 |
| 208 | Ga0207662_10016418 | 3300025918 | Bacteria | 4179 |
| 209 | Ga0207662_10101989 | 3300025918 | Bacteria | 1779 |
| 210 | Ga0207657_10002386 | 3300025919 | Bacteria | 20326 |
| 211 | Ga0207657_10373847 | 3300025919 | Bacteria | 1123 |
| 212 | Ga0207649_10000944 | 3300025920 | Bacteria | 18174 |
| 213 | Ga0207652_10009630 | 3300025921 | Bacteria | 7771 |
| 214 | Ga0207681_10056284 | 3300025923 | Bacteria | 2682 |
| 215 | Ga0207694_10090984 | 3300025924 | Bacteria | 2408 |
| 216 | Ga0207650_10012289 | 3300025925 | Bacteria | 5908 |
| 217 | Ga0207650_10226048 | 3300025925 | Bacteria | 1508 |
| 218 | Ga0207650_10565010 | 3300025925 | Bacteria | 954 |
| 219 | Ga0207659_10002481 | 3300025926 | Bacteria | 10998 |
| 220 | Ga0207687_10000072 | 3300025927 | Bacteria | 76222 |
| 221 | Ga0207664_10161248 | 3300025929 | Bacteria | 1913 |
| 222 | Ga0207644_10022392 | 3300025931 | Bacteria | 4318 |
| 223 | Ga0207644_10125661 | 3300025931 | Bacteria | 1957 |
| 224 | Ga0207690_10029980 | 3300025932 | Bacteria | 3464 |
| 225 | Ga0207706_10008634 | 3300025933 | Bacteria | 9387 |
| 226 | Ga0207706_10009459 | 3300025933 | Bacteria | 8953 |
| 227 | Ga0207706_10437140 | 3300025933 | Bacteria | 1133 |
| 228 | Ga0207686_10009296 | 3300025934 | Bacteria | 5334 |
| 229 | Ga0207709_10002480 | 3300025935 | Bacteria | 11563 |
| 230 | Ga0207670_10000792 | 3300025936 | Bacteria | 16529 |
| 231 | Ga0207670_10094500 | 3300025936 | Bacteria | 2121 |
| 232 | Ga0207669_10001742 | 3300025937 | Bacteria | 9239 |
| 233 | Ga0207669_10044599 | 3300025937 | Bacteria | 2606 |
| 234 | Ga0207704_10003278 | 3300025938 | Bacteria | 7351 |
| 235 | Ga0207704_10285417 | 3300025938 | Bacteria | 1257 |
| 236 | Ga0207665_10400739 | 3300025939 | Bacteria | 1045 |
| 237 | Ga0207691_10009483 | 3300025940 | Bacteria | 9347 |
| 238 | Ga0207691_10085978 | 3300025940 | Bacteria | 2822 |
| 239 | Ga0207711_10001106 | 3300025941 | Bacteria | 25759 |
| 240 | Ga0207711_10349899 | 3300025941 | Bacteria | 1368 |
| 241 | Ga0207689_10000366 | 3300025942 | Bacteria | 42711 |
| 242 | Ga0207689_10177914 | 3300025942 | Bacteria | 1754 |
| 243 | Ga0207661_10010227 | 3300025944 | Bacteria | 6746 |
| 244 | Ga0207661_10214140 | 3300025944 | Bacteria | 1699 |
| 245 | Ga0207679_10000029 | 3300025945 | Bacteria | 183002 |
| 246 | Ga0207667_10111576 | 3300025949 | Bacteria | 2820 |
| 247 | Ga0207651_10000292 | 3300025960 | Bacteria | 21406 |
| 248 | Ga0207651_10416019 | 3300025960 | Bacteria | 1146 |
| 249 | Ga0207712_10010471 | 3300025961 | Bacteria | 5887 |
| 250 | Ga0207668_10010650 | 3300025972 | Bacteria | 5563 |
| 251 | Ga0207640_10001667 | 3300025981 | Bacteria | 11922 |
| 252 | Ga0207658_10038839 | 3300025986 | Bacteria | 3432 |
| 253 | Ga0207677_10042618 | 3300026023 | Bacteria | 3011 |
| 254 | Ga0207703_10009816 | 3300026035 | Bacteria | 7509 |
| 255 | Ga0207639_10013289 | 3300026041 | Bacteria | 5758 |
| 256 | Ga0207678_10006759 | 3300026067 | Bacteria | 10172 |
| 257 | Ga0207678_10763844 | 3300026067 | Bacteria | 852 |
| 258 | Ga0207708_10004100 | 3300026075 | Bacteria | 10722 |
| 259 | Ga0207702_10011803 | 3300026078 | Bacteria | 7274 |
| 260 | Ga0207702_10016294 | 3300026078 | Bacteria | 6151 |
| 261 | Ga0207641_10004156 | 3300026088 | Bacteria | 12612 |
| 262 | Ga0207648_10008435 | 3300026089 | Bacteria | 9983 |
| 263 | Ga0207648_10020005 | 3300026089 | Bacteria | 6038 |
| 264 | Ga0207676_10000182 | 3300026095 | Bacteria | 55544 |
| 265 | Ga0207676_10248790 | 3300026095 | Bacteria | 1599 |
| 266 | Ga0207674_10007304 | 3300026116 | Bacteria | 12874 |
| 267 | Ga0207674_10116041 | 3300026116 | Bacteria | 2649 |
| 268 | Ga0207675_100011726 | 3300026118 | Bacteria | 8195 |
| 269 | Ga0207675_100712662 | 3300026118 | Bacteria | 1013 |
| 270 | Ga0207683_10007517 | 3300026121 | Bacteria | 9341 |
| 271 | Ga0207698_10005197 | 3300026142 | Bacteria | 8003 |
| 272 | Ga0207698_10027150 | 3300026142 | Bacteria | 4061 |
| 273 | Ga0209967_1016452 | 3300027364 | Bacteria | 1063 |
| 274 | Ga0209970_1027402 | 3300027614 | Bacteria | 981 |
| 275 | Ga0209998_10000962 | 3300027717 | Bacteria | 7298 |
| 276 | Ga0209813_10067392 | 3300027866 | Bacteria | 1156 |
| 277 | Ga0209974_10000736 | 3300027876 | Bacteria | 11197 |
| 278 | Ga0207428_10001793 | 3300027907 | Bacteria | 21978 |
| 279 | Ga0268265_10004249 | 3300028380 | Bacteria | 10001 |
| 280 | Ga0268264_10013946 | 3300028381 | Bacteria | 6607 |
| 281 | Ga0307517_10020056 | 3300028786 | Bacteria | 8540 |
| 282 | Ga0265332_10000732 | 3300031238 | Bacteria | 20494 |
| 283 | Ga0265325_10001518 | 3300031241 | Bacteria | 16310 |
| 284 | Ga0265325_10005918 | 3300031241 | Bacteria | 7494 |
| 285 | Ga0265325_10071293 | 3300031241 | Bacteria | 1744 |
| 286 | Ga0265325_10100954 | 3300031241 | Bacteria | 1412 |
| 287 | Ga0265329_10010307 | 3300031242 | Bacteria | 3438 |
| 288 | Ga0265340_10003622 | 3300031247 | Bacteria | 8687 |
| 289 | Ga0265340_10095553 | 3300031247 | Bacteria | 1385 |
| 290 | Ga0265339_10001116 | 3300031249 | Bacteria | 20311 |
| 291 | Ga0265339_10011954 | 3300031249 | Bacteria | 5320 |
| 292 | Ga0265331_10006555 | 3300031250 | Bacteria | 6866 |
| 293 | Ga0265331_10109471 | 3300031250 | Bacteria | 1267 |
| 294 | Ga0265316_10137477 | 3300031344 | Bacteria | 1838 |
| 295 | Ga0265316_10161230 | 3300031344 | Bacteria | 1676 |
| 296 | Ga0307513_10176719 | 3300031456 | Bacteria | 2004 |
| 297 | Ga0307408_100210532 | 3300031548 | Bacteria | 1580 |
| 298 | Ga0265313_10003835 | 3300031595 | Bacteria | 11864 |
| 299 | Ga0265313_10007507 | 3300031595 | Bacteria | 7427 |
| 300 | Ga0265313_10055829 | 3300031595 | Bacteria | 1869 |
| 301 | Ga0265314_10003835 | 3300031711 | Bacteria | 14352 |
| 302 | Ga0265342_10000258 | 3300031712 | Bacteria | 59570 |
| 303 | Ga0265342_10025712 | 3300031712 | Bacteria | 3696 |
| 304 | Ga0307413_10405823 | 3300031824 | Bacteria | 1069 |
| 305 | Ga0307407_10067094 | 3300031903 | Bacteria | 2119 |
| 306 | Ga0307409_100262057 | 3300031995 | Bacteria | 1587 |
| 307 | Ga0307411_10212861 | 3300032005 | Bacteria | 1494 |
| 308 | Ga0307415_100272701 | 3300032126 | Bacteria | 1387 |
| 309 | Ga0373930_0010963 | 3300034816 | Bacteria | 1629 |
| 310 | Ga0373950_0009099 | 3300034818 | Bacteria | 1577 |
| 311 | Ga0373959_0006771 | 3300034820 | Bacteria | 1912 |
| 312 | Ga0373938_0001079 | 3300034957 | Bacteria | 4392 |
| 313 | Ga0373929_0002864 | 3300035085 | Bacteria | 3152 |
| 314 | Ga0373940_0002243 | 3300035088 | Bacteria | 3718 |
| 315 | Ga0373949_0002153 | 3300035090 | Bacteria | 5166 |
| 316 | Ga0373952_0002050 | 3300035092 | Bacteria | 3628 |
| 317 | Ga0373936_0190380 | 3300035113 | Bacteria | 903 |
| 318 | Ga0373939_0001680 | 3300035114 | Bacteria | 5354 |
| 319 | Ga0373941_0008396 | 3300035115 | Bacteria | 2562 |
| 320 | Ga0373945_0030446 | 3300035116 | Bacteria | 1903 |
| 321 | Ga0373960_0011101 | 3300035121 | Bacteria | 2212 |
| 322 | Ga0373943_0324557 | 3300035170 | Bacteria | 878 |
| 323 | Ga0373935_0316604 | 3300035692 | Bacteria | 1106 |
| 324 | Ga0373935_0544383 | 3300035692 | Bacteria | 846 |
| 325 | Ga0373927_0108287 | 3300035695 | Bacteria | 1810 |
| 326 | Ga0373937_0881888 | 3300036401 | Bacteria | 843 |
| 327 | Ga0373925_0271086 | 3300037068 | Bacteria | 1365 |
| 328 | Ga0395900_0016660 | 3300037418 | Bacteria | 7496 |
| 329 | Ga0395905_0000704 | 3300037471 | Bacteria | 44377 |
| 330 | Ga0436364_0167179 | 3300037853 | Bacteria | 17951 |
| 331 | Ga0436364_0317277 | 3300037853 | Bacteria | 900 |
| 332 | Ga0436364_0335253 | 3300037853 | Bacteria | 76277 |
| 333 | Ga0436364_1247966 | 3300037853 | Bacteria | 12498 |
| 334 | Ga0395901_0010912 | 3300038443 | Bacteria | 9206 |
| 335 | Ga0436365_0240233 | 3300039437 | Bacteria | 6675 |
| 336 | Ga0436365_0302959 | 3300039437 | Bacteria | 2544 |
| 337 | Ga0436365_0665259 | 3300039437 | Bacteria | 1025 |
| 338 | Ga0436365_1069579 | 3300039437 | Bacteria | 1530 |
| 339 | Ga0436365_1114955 | 3300039437 | Bacteria | 4490 |
| 340 | Ga0436365_1646101 | 3300039437 | Bacteria | 1139 |
| 341 | Ga0436360_0020476 | 3300039438 | Bacteria | 3853 |
| 342 | Ga0436361_0136044 | 3300039447 | Bacteria | 7469 |
| 343 | Ga0436363_0251431 | 3300039450 | Bacteria | 1885 |
| 344 | Ga0436363_0490009 | 3300039450 | Bacteria | 2638 |
| 345 | Ga0436363_1384763 | 3300039450 | Bacteria | 3301 |
| 346 | Ga0436362_0280123 | 3300039453 | Bacteria | 1492 |
| 347 | Ga0451576_0732102 | 3300045051 | Bacteria | 1039 |
| 348 | Ga0495638_0041000 | 3300046460 | Bacteria | 2931 |
| 349 | Ga0495638_0046573 | 3300046460 | Bacteria | 2724 |
| 350 | Ga0495605_0056087 | 3300046474 | Bacteria | 1901 |
| 351 | Ga0495605_0243317 | 3300046474 | Bacteria | 772 |
| 352 | Ga0495630_0481330 | 3300046517 | Bacteria | 952 |
| 353 | Ga0495621_0080442 | 3300046539 | Bacteria | 1214 |
| 354 | Ga0495659_0125286 | 3300046664 | Bacteria | 1015 |
| 355 | Ga0495658_0502899 | 3300046683 | Bacteria | 775 |
| 356 | Ga0495669_0082359 | 3300046684 | Bacteria | 1478 |
| 357 | Ga0495680_0094552 | 3300047322 | Bacteria | 2236 |
| 358 | Ga0495685_079103 | 3300047447 | Bacteria | 1096 |
| 359 | Ga0496100_0037625 | 3300048903 | Bacteria | 3060 |
| 360 | Ga0496100_0084811 | 3300048903 | Bacteria | 2148 |
| 361 | Ga0496101_0108779 | 3300048904 | Bacteria | 2084 |
| 362 | Ga0496103_0002596 | 3300048906 | Bacteria | 11311 |
| 363 | Ga0496104_0166362 | 3300048907 | Bacteria | 2115 |
| 364 | Ga0496104_0301403 | 3300048907 | Bacteria | 1515 |
| 365 | Ga0496105_0185260 | 3300048908 | Bacteria | 1704 |
| 366 | Ga0496106_0035717 | 3300048909 | Bacteria | 3716 |
| 367 | Ga0496107_0040869 | 3300048910 | Bacteria | 3329 |
| 368 | Ga0496108_0028028 | 3300048911 | Bacteria | 4658 |
| 369 | Ga0496109_0008888 | 3300048912 | Bacteria | 8555 |
| 370 | Ga0496110_0176925 | 3300048913 | Bacteria | 1937 |
| 371 | Ga0496110_0350514 | 3300048913 | Bacteria | 1345 |
| 372 | Ga0496111_0294123 | 3300048914 | Bacteria | 1204 |
| 373 | Ga0496114_0005989 | 3300048917 | Bacteria | 9574 |
| 374 | Ga0496115_0031731 | 3300048918 | Bacteria | 4164 |
| 375 | Ga0496115_0091671 | 3300048918 | Bacteria | 2484 |
| 376 | Ga0496125_0034764 | 3300048928 | Bacteria | 4436 |
| 377 | Ga0501031_0018531 | 3300049568 | Bacteria | 4531 |
| 378 | Ga0501032_0003564 | 3300049569 | Bacteria | 11867 |
| 379 | Ga0501032_0030094 | 3300049569 | Bacteria | 3724 |
| 380 | Ga0501032_0032988 | 3300049569 | Bacteria | 3548 |
| 381 | Ga0501032_0198538 | 3300049569 | Bacteria | 1309 |
| 382 | Ga0501033_0022180 | 3300049570 | Bacteria | 4791 |
| 383 | Ga0501033_0061658 | 3300049570 | Bacteria | 2763 |
| 384 | Ga0501033_0260458 | 3300049570 | Bacteria | 1227 |
| 385 | Ga0501034_0000516 | 3300049571 | Bacteria | 62005 |
| 386 | Ga0501034_0000850 | 3300049571 | Bacteria | 45243 |
| 387 | Ga0501034_0007739 | 3300049571 | Bacteria | 11422 |
| 388 | Ga0501034_0012629 | 3300049571 | Bacteria | 8715 |
| 389 | Ga0501034_0025429 | 3300049571 | Bacteria | 6027 |
| 390 | Ga0501034_0195360 | 3300049571 | Bacteria | 1983 |
| 391 | Ga0501034_0242712 | 3300049571 | Bacteria | 1747 |
| 392 | Ga0501034_0418243 | 3300049571 | Bacteria | 1262 |
| 393 | Ga0501036_0000547 | 3300049572 | Bacteria | 26976 |
| 394 | Ga0501036_0017164 | 3300049572 | Bacteria | 6051 |
| 395 | Ga0501036_0038161 | 3300049572 | Bacteria | 4065 |
| 396 | Ga0501036_0129334 | 3300049572 | Bacteria | 2132 |
| 397 | Ga0501036_0319429 | 3300049572 | Bacteria | 1297 |
| 398 | Ga0501036_0348534 | 3300049572 | Bacteria | 1236 |
| 399 | Ga0501037_0017976 | 3300049573 | Bacteria | 5204 |
| 400 | Ga0501037_0024616 | 3300049573 | Bacteria | 4451 |
| 401 | Ga0501037_0082125 | 3300049573 | Bacteria | 2335 |
| 402 | Ga0501037_0150685 | 3300049573 | Bacteria | 1662 |
| 403 | Ga0501037_0289992 | 3300049573 | Bacteria | 1138 |
| 404 | Ga0501037_0318904 | 3300049573 | Bacteria | 1076 |
| 405 | Ga0501038_0045667 | 3300049574 | Bacteria | 3801 |
| 406 | Ga0501038_0131386 | 3300049574 | Bacteria | 2055 |
| 407 | Ga0501038_0315661 | 3300049574 | Bacteria | 1223 |
| 408 | Ga0501039_0003067 | 3300049575 | Bacteria | 12495 |
| 409 | Ga0501039_0076329 | 3300049575 | Bacteria | 2605 |
| 410 | Ga0501040_0278221 | 3300049576 | Bacteria | 1195 |
| 411 | Ga0501043_0003257 | 3300049579 | Bacteria | 13387 |
| 412 | Ga0501043_0003673 | 3300049579 | Bacteria | 12604 |
| 413 | Ga0501043_0018936 | 3300049579 | Bacteria | 5403 |
| 414 | Ga0501043_0091383 | 3300049579 | Bacteria | 2393 |
| 415 | Ga0501046_0092974 | 3300049580 | Bacteria | 2318 |
| 416 | Ga0501046_0386307 | 3300049580 | Bacteria | 1012 |
| 417 | Ga0501047_0000455 | 3300049581 | Bacteria | 45200 |
| 418 | Ga0501047_0024148 | 3300049581 | Bacteria | 5839 |
| 419 | Ga0501047_0128575 | 3300049581 | Bacteria | 2413 |
| 420 | Ga0501047_0142177 | 3300049581 | Bacteria | 2277 |
| 421 | Ga0501047_0801627 | 3300049581 | Bacteria | 757 |
| 422 | Ga0501048_0002034 | 3300049582 | Bacteria | 15361 |
| 423 | Ga0501048_0158484 | 3300049582 | Bacteria | 1601 |
| 424 | Ga0501068_0118921 | 3300049584 | Bacteria | 1646 |
| 425 | Ga0501068_0137882 | 3300049584 | Bacteria | 1528 |
| 426 | Ga0501068_0328061 | 3300049584 | Bacteria | 982 |
| 427 | Ga0501069_0005711 | 3300049585 | Bacteria | 6483 |
| 428 | Ga0501070_0003722 | 3300049586 | Bacteria | 13172 |
| 429 | Ga0501070_0020920 | 3300049586 | Bacteria | 5488 |
| 430 | Ga0501070_0038661 | 3300049586 | Bacteria | 3981 |
| 431 | Ga0501070_0076879 | 3300049586 | Bacteria | 2763 |
| 432 | Ga0501071_0195691 | 3300049587 | Bacteria | 1517 |
| 433 | Ga0501072_0003523 | 3300049588 | Bacteria | 11791 |
| 434 | Ga0501073_0011899 | 3300049589 | Bacteria | 6352 |
| 435 | Ga0501073_0036690 | 3300049589 | Bacteria | 3481 |
| 436 | Ga0501073_0305903 | 3300049589 | Bacteria | 1097 |
| 437 | Ga0501073_0521637 | 3300049589 | Bacteria | 821 |
| 438 | Ga0501074_0024490 | 3300049590 | Bacteria | 4387 |
| 439 | Ga0501076_0319178 | 3300049592 | Bacteria | 1274 |
| 440 | Ga0501079_0334186 | 3300049741 | Bacteria | 1187 |
| 441 | Ga0501080_0001026 | 3300049742 | Bacteria | 22970 |
| 442 | Ga0501080_0012079 | 3300049742 | Bacteria | 7910 |
| 443 | Ga0501080_0094108 | 3300049742 | Bacteria | 2782 |
| 444 | Ga0501083_0010516 | 3300049744 | Bacteria | 6511 |
| 445 | Ga0501083_0026213 | 3300049744 | Bacteria | 4031 |
| 446 | Ga0501083_0030240 | 3300049744 | Bacteria | 3721 |
| 447 | Ga0501083_0066710 | 3300049744 | Bacteria | 2396 |
| 448 | Ga0501083_0457591 | 3300049744 | Bacteria | 830 |
| 449 | Ga0501035_0001156 | 3300049822 | Bacteria | 27546 |
| 450 | Ga0501035_0029743 | 3300049822 | Bacteria | 4981 |
| 451 | Ga0501035_0315892 | 3300049822 | Bacteria | 1313 |
| 452 | Ga0501035_0428939 | 3300049822 | Bacteria | 1096 |
| 453 | Ga0501044_0024576 | 3300049823 | Bacteria | 6393 |
| 454 | Ga0501044_0057824 | 3300049823 | Bacteria | 3978 |
| 455 | Ga0501044_0237298 | 3300049823 | Bacteria | 1768 |
| 456 | Ga0501044_0242762 | 3300049823 | Bacteria | 1744 |
| 457 | Ga0501044_0551295 | 3300049823 | Bacteria | 1050 |
| 458 | Ga0501044_0576450 | 3300049823 | Bacteria | 1020 |
| 459 | Ga0501045_0347879 | 3300049824 | Bacteria | 1103 |
| 460 | nmdc:mga00v17_82170_c1 | 3300050491 | Bacteria | 2013 |
| 461 | nmdc:mga0yw44_107588_c1 | 3300050492 | Bacteria | 1784 |
| 462 | nmdc:mga06z11_182691_c1 | 3300050494 | Bacteria | 1210 |
| 463 | nmdc:mga06z11_372957_c1 | 3300050494 | Bacteria | 856 |
| 464 | nmdc:mga04h51_148759_c1 | 3300050495 | Bacteria | 893 |
| 465 | nmdc:mga07m45_165553_c1 | 3300050496 | Bacteria | 1284 |
| 466 | nmdc:mga07m45_32490_c1 | 3300050496 | Bacteria | 2706 |
| 467 | nmdc:mga07m45_85170_c1 | 3300050496 | Bacteria | 1807 |
| 468 | nmdc:mga08y16_439554_c1 | 3300050511 | Bacteria | 1332 |
| 469 | nmdc:mga0n895_1284_c1 | 3300050512 | Bacteria | 18562 |
| 470 | nmdc:mga0n895_574709_c1 | 3300050512 | Bacteria | 1131 |
| 471 | nmdc:mga0rr50_366859_c1 | 3300050513 | Bacteria | 1213 |
| 472 | nmdc:mga0a205_1140_c1 | 3300050515 | Bacteria | 22064 |
| 473 | Ga0500578_0247208 | 3300053086 | Bacteria | 1076 |
| 474 | Ga0500644_0000616 | 3300053088 | Bacteria | 13364 |
| 475 | Ga0500651_0032245 | 3300053093 | Bacteria | 3302 |
| 476 | Ga0500566_0141170 | 3300053094 | Bacteria | 1278 |
| 477 | Ga0500641_0015291 | 3300053096 | Bacteria | 2845 |
| 478 | Ga0500641_0038549 | 3300053096 | Bacteria | 1921 |
| 479 | Ga0500572_080261 | 3300053111 | Bacteria | 1021 |
| 480 | Ga0500593_003255 | 3300053117 | Bacteria | 6114 |
| 481 | Ga0500594_0046216 | 3300053118 | Bacteria | 1211 |
| 482 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 483 | Ga0500577_0246005 | 3300053142 | Bacteria | 777 |
| 484 | Ga0500577_0261134 | 3300053142 | Bacteria | 753 |
| 485 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 486 | Ga0500616_0049676 | 3300053153 | Bacteria | 2218 |
| 487 | Ga0500625_045483 | 3300053729 | Bacteria | 2049 |
| 488 | Ga0500645_000012 | 3300053730 | Bacteria | 168579 |
| 489 | Ga0500601_001022 | 3300053737 | Bacteria | 3218 |
| 490 | Ga0501082_0000016 | 3300060353 | Bacteria | 115081 |
| 491 | Ga0501082_0070028 | 3300060353 | Bacteria | 3020 |
| 492 | Ga0501082_0139293 | 3300060353 | Bacteria | 2106 |
| 493 | Ga0501082_0172625 | 3300060353 | Bacteria | 1880 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035113 | Ga0373936_0190380 | Ga0373936_0190380_11_679 | 222 |
| 2 | 3300020070 | Ga0206356_11653084 | Ga0206356_116530841 | 223 |
| 3 | 3300005983 | Ga0081540_1076063 | Ga0081540_10760631 | 225 |
| 4 | 3300005843 | Ga0068860_100151051 | Ga0068860_1001510512 | 226 |
| 5 | 3300037853 | Ga0436364_0317277 | Ga0436364_0317277_67_768 | 226 |
| 6 | 3300039437 | Ga0436365_1646101 | Ga0436365_1646101_144_845 | 226 |
| 7 | 3300047322 | Ga0495680_0094552 | Ga0495680_0094552_434_1135 | 226 |
| 8 | iso_pu_bacteria | 2643221541 | 2643730102 | 228 |
| 9 | iso_pu_bacteria | 2643221547 | 2643757154 | 228 |
| 10 | iso_pu_bacteria | 2643221606 | 2644045588 | 228 |
| 11 | iso_pu_bacteria | 2643221671 | 2644392786 | 228 |
| 12 | iso_pu_bacteria | 2643221699 | 2644549578 | 228 |
| 13 | iso_pu_bacteria | 2869256925 | 2869257047 | 228 |
| 14 | iso_pu_bacteria | 2643221733 | 2644732516 | 229 |
| 15 | iso_pu_bacteria | 2841911363 | 2841915662 | 229 |
| 16 | iso_pu_bacteria | 2841917233 | 2841920864 | 229 |
| 17 | iso_pu_bacteria | 2919085039 | 2919085884 | 229 |
| 18 | 3300037471 | Ga0395905_0000704 | Ga0395905_0000704_13124_13816 | 230 |
| 19 | iso_pu_bacteria | 2830075706 | 2830079190 | 230 |
| 20 | 3300009093 | Ga0105240_10266730 | Ga0105240_102667303 | 231 |
| 21 | 3300046460 | Ga0495638_0046573 | Ga0495638_0046573_1961_2668 | 231 |
| 22 | 3300053153 | Ga0500616_0049676 | Ga0500616_0049676_283_990 | 231 |
| 23 | 3300002459 | JGI24751J29686_10033145 | JGI24751J29686_100331452 | 232 |
| 24 | 3300003203 | JGI25406J46586_10010387 | JGI25406J46586_100103872 | 232 |
| 25 | 3300003911 | JGI25405J52794_10034128 | JGI25405J52794_100341282 | 232 |
| 26 | 3300005293 | Ga0065715_10169532 | Ga0065715_101695322 | 232 |
| 27 | 3300005327 | Ga0070658_10159734 | Ga0070658_101597341 | 232 |
| 28 | 3300005330 | Ga0070690_100134746 | Ga0070690_1001347462 | 232 |
| 29 | 3300005331 | Ga0070670_100216634 | Ga0070670_1002166341 | 232 |
| 30 | 3300005331 | Ga0070670_100228110 | Ga0070670_1002281101 | 232 |
| 31 | 3300005333 | Ga0070677_10217322 | Ga0070677_102173221 | 232 |
| 32 | 3300005338 | Ga0068868_100405302 | Ga0068868_1004053022 | 232 |
| 33 | 3300005340 | Ga0070689_100091327 | Ga0070689_1000913273 | 232 |
| 34 | 3300005340 | Ga0070689_100138102 | Ga0070689_1001381022 | 232 |
| 35 | 3300005341 | Ga0070691_10286075 | Ga0070691_102860751 | 232 |
| 36 | 3300005343 | Ga0070687_100044320 | Ga0070687_1000443201 | 232 |
| 37 | 3300005344 | Ga0070661_100268522 | Ga0070661_1002685221 | 232 |
| 38 | 3300005353 | Ga0070669_100412682 | Ga0070669_1004126821 | 232 |
| 39 | 3300005365 | Ga0070688_100251936 | Ga0070688_1002519362 | 232 |
| 40 | 3300005436 | Ga0070713_100077384 | Ga0070713_1000773841 | 232 |
| 41 | 3300005438 | Ga0070701_10405603 | Ga0070701_104056031 | 232 |
| 42 | 3300005456 | Ga0070678_100095481 | Ga0070678_1000954812 | 232 |
| 43 | 3300005457 | Ga0070662_100126604 | Ga0070662_1001266042 | 232 |
| 44 | 3300005466 | Ga0070685_10048175 | Ga0070685_100481752 | 232 |
| 45 | 3300005466 | Ga0070685_10139263 | Ga0070685_101392632 | 232 |
| 46 | 3300005548 | Ga0070665_100536717 | Ga0070665_1005367171 | 232 |
| 47 | 3300005614 | Ga0068856_100014335 | Ga0068856_1000143353 | 232 |
| 48 | 3300005614 | Ga0068856_100731318 | Ga0068856_1007313182 | 232 |
| 49 | 3300005616 | Ga0068852_100147280 | Ga0068852_1001472802 | 232 |
| 50 | 3300005718 | Ga0068866_10228290 | Ga0068866_102282901 | 232 |
| 51 | 3300005834 | Ga0068851_10449435 | Ga0068851_104494351 | 232 |
| 52 | 3300005842 | Ga0068858_100625117 | Ga0068858_1006251171 | 232 |
| 53 | 3300005937 | Ga0081455_10010585 | Ga0081455_100105855 | 232 |
| 54 | 3300005937 | Ga0081455_10111172 | Ga0081455_101111723 | 232 |
| 55 | 3300005983 | Ga0081540_1159726 | Ga0081540_11597261 | 232 |
| 56 | 3300005985 | Ga0081539_10016778 | Ga0081539_100167785 | 232 |
| 57 | 3300006048 | Ga0075363_100022049 | Ga0075363_1000220495 | 232 |
| 58 | 3300006051 | Ga0075364_10020890 | Ga0075364_100208903 | 232 |
| 59 | 3300006177 | Ga0075362_10049429 | Ga0075362_100494292 | 232 |
| 60 | 3300006195 | Ga0075366_10012093 | Ga0075366_100120933 | 232 |
| 61 | 3300006353 | Ga0075370_10096540 | Ga0075370_100965401 | 232 |
| 62 | 3300006353 | Ga0075370_10113281 | Ga0075370_101132812 | 232 |
| 63 | 3300006353 | Ga0075370_10169307 | Ga0075370_101693072 | 232 |
| 64 | 3300006358 | Ga0068871_100526067 | Ga0068871_1005260671 | 232 |
| 65 | 3300009177 | Ga0105248_10126415 | Ga0105248_101264153 | 232 |
| 66 | 3300009553 | Ga0105249_10506316 | Ga0105249_105063162 | 232 |
| 67 | 3300010375 | Ga0105239_10390121 | Ga0105239_103901212 | 232 |
| 68 | 3300013104 | Ga0157370_10442135 | Ga0157370_104421352 | 232 |
| 69 | 3300013297 | Ga0157378_10199685 | Ga0157378_101996852 | 232 |
| 70 | 3300013306 | Ga0163162_10801502 | Ga0163162_108015021 | 232 |
| 71 | 3300013307 | Ga0157372_10768335 | Ga0157372_107683351 | 232 |
| 72 | 3300014325 | Ga0163163_10539003 | Ga0163163_105390031 | 232 |
| 73 | 3300021384 | Ga0213876_10011887 | Ga0213876_100118873 | 232 |
| 74 | 3300021384 | Ga0213876_10036527 | Ga0213876_100365273 | 232 |
| 75 | 3300021384 | Ga0213876_10117761 | Ga0213876_101177612 | 232 |
| 76 | 3300025893 | Ga0207682_10023530 | Ga0207682_100235302 | 232 |
| 77 | 3300025901 | Ga0207688_10024680 | Ga0207688_100246803 | 232 |
| 78 | 3300025915 | Ga0207693_10405164 | Ga0207693_104051641 | 232 |
| 79 | 3300025918 | Ga0207662_10016418 | Ga0207662_100164183 | 232 |
| 80 | 3300025918 | Ga0207662_10101989 | Ga0207662_101019894 | 232 |
| 81 | 3300025919 | Ga0207657_10373847 | Ga0207657_103738471 | 232 |
| 82 | 3300025923 | Ga0207681_10056284 | Ga0207681_100562842 | 232 |
| 83 | 3300025925 | Ga0207650_10226048 | Ga0207650_102260482 | 232 |
| 84 | 3300025925 | Ga0207650_10565010 | Ga0207650_105650101 | 232 |
| 85 | 3300025933 | Ga0207706_10009459 | Ga0207706_100094598 | 232 |
| 86 | 3300025933 | Ga0207706_10437140 | Ga0207706_104371402 | 232 |
| 87 | 3300025936 | Ga0207670_10094500 | Ga0207670_100945001 | 232 |
| 88 | 3300025937 | Ga0207669_10044599 | Ga0207669_100445992 | 232 |
| 89 | 3300025938 | Ga0207704_10285417 | Ga0207704_102854172 | 232 |
| 90 | 3300025940 | Ga0207691_10085978 | Ga0207691_100859782 | 232 |
| 91 | 3300025941 | Ga0207711_10349899 | Ga0207711_103498992 | 232 |
| 92 | 3300025942 | Ga0207689_10177914 | Ga0207689_101779142 | 232 |
| 93 | 3300025944 | Ga0207661_10214140 | Ga0207661_102141402 | 232 |
| 94 | 3300025960 | Ga0207651_10416019 | Ga0207651_104160192 | 232 |
| 95 | 3300026067 | Ga0207678_10763844 | Ga0207678_107638442 | 232 |
| 96 | 3300026078 | Ga0207702_10016294 | Ga0207702_100162943 | 232 |
| 97 | 3300026089 | Ga0207648_10020005 | Ga0207648_100200056 | 232 |
| 98 | 3300026116 | Ga0207674_10116041 | Ga0207674_101160412 | 232 |
| 99 | 3300026118 | Ga0207675_100712662 | Ga0207675_1007126622 | 232 |
| 100 | 3300026142 | Ga0207698_10027150 | Ga0207698_100271503 | 232 |
| 101 | 3300031241 | Ga0265325_10001518 | Ga0265325_100015183 | 232 |
| 102 | 3300031548 | Ga0307408_100210532 | Ga0307408_1002105322 | 232 |
| 103 | 3300031595 | Ga0265313_10055829 | Ga0265313_100558292 | 232 |
| 104 | 3300031711 | Ga0265314_10003835 | Ga0265314_1000383515 | 232 |
| 105 | 3300031824 | Ga0307413_10405823 | Ga0307413_104058232 | 232 |
| 106 | 3300031903 | Ga0307407_10067094 | Ga0307407_100670943 | 232 |
| 107 | 3300031995 | Ga0307409_100262057 | Ga0307409_1002620572 | 232 |
| 108 | 3300032126 | Ga0307415_100272701 | Ga0307415_1002727011 | 232 |
| 109 | 3300035115 | Ga0373941_0008396 | Ga0373941_0008396_495_1199 | 232 |
| 110 | 3300035170 | Ga0373943_0324557 | Ga0373943_0324557_15_716 | 232 |
| 111 | 3300035692 | Ga0373935_0316604 | Ga0373935_0316604_127_861 | 232 |
| 112 | 3300035692 | Ga0373935_0544383 | Ga0373935_0544383_22_720 | 232 |
| 113 | 3300037418 | Ga0395900_0016660 | Ga0395900_0016660_2843_3544 | 232 |
| 114 | 3300038443 | Ga0395901_0010912 | Ga0395901_0010912_1556_2257 | 232 |
| 115 | 3300039437 | Ga0436365_0240233 | Ga0436365_0240233_5785_6486 | 232 |
| 116 | 3300039437 | Ga0436365_0302959 | Ga0436365_0302959_1433_2155 | 232 |
| 117 | 3300039437 | Ga0436365_1114955 | Ga0436365_1114955_2580_3284 | 232 |
| 118 | 3300046460 | Ga0495638_0041000 | Ga0495638_0041000_918_1622 | 232 |
| 119 | 3300046474 | Ga0495605_0056087 | Ga0495605_0056087_431_1138 | 232 |
| 120 | 3300046474 | Ga0495605_0243317 | Ga0495605_0243317_19_723 | 232 |
| 121 | 3300046517 | Ga0495630_0481330 | Ga0495630_0481330_51_755 | 232 |
| 122 | 3300046539 | Ga0495621_0080442 | Ga0495621_0080442_154_879 | 232 |
| 123 | 3300046664 | Ga0495659_0125286 | Ga0495659_0125286_117_842 | 232 |
| 124 | 3300047447 | Ga0495685_079103 | Ga0495685_079103_225_932 | 232 |
| 125 | 3300048903 | Ga0496100_0084811 | Ga0496100_0084811_382_1113 | 232 |
| 126 | 3300048907 | Ga0496104_0166362 | Ga0496104_0166362_738_1439 | 232 |
| 127 | 3300048908 | Ga0496105_0185260 | Ga0496105_0185260_246_947 | 232 |
| 128 | 3300048918 | Ga0496115_0091671 | Ga0496115_0091671_192_896 | 232 |
| 129 | 3300049568 | Ga0501031_0018531 | Ga0501031_0018531_147_851 | 232 |
| 130 | 3300049569 | Ga0501032_0003564 | Ga0501032_0003564_1046_1816 | 232 |
| 131 | 3300049569 | Ga0501032_0030094 | Ga0501032_0030094_2393_3097 | 232 |
| 132 | 3300049569 | Ga0501032_0032988 | Ga0501032_0032988_2572_3276 | 232 |
| 133 | 3300049569 | Ga0501032_0198538 | Ga0501032_0198538_80_784 | 232 |
| 134 | 3300049570 | Ga0501033_0022180 | Ga0501033_0022180_1077_1781 | 232 |
| 135 | 3300049570 | Ga0501033_0061658 | Ga0501033_0061658_962_1666 | 232 |
| 136 | 3300049570 | Ga0501033_0260458 | Ga0501033_0260458_243_947 | 232 |
| 137 | 3300049571 | Ga0501034_0000516 | Ga0501034_0000516_50114_50938 | 232 |
| 138 | 3300049571 | Ga0501034_0000850 | Ga0501034_0000850_36008_36778 | 232 |
| 139 | 3300049571 | Ga0501034_0007739 | Ga0501034_0007739_2657_3361 | 232 |
| 140 | 3300049571 | Ga0501034_0012629 | Ga0501034_0012629_1471_2298 | 232 |
| 141 | 3300049571 | Ga0501034_0025429 | Ga0501034_0025429_835_1539 | 232 |
| 142 | 3300049571 | Ga0501034_0195360 | Ga0501034_0195360_488_1192 | 232 |
| 143 | 3300049571 | Ga0501034_0242712 | Ga0501034_0242712_230_934 | 232 |
| 144 | 3300049572 | Ga0501036_0000547 | Ga0501036_0000547_5190_5960 | 232 |
| 145 | 3300049572 | Ga0501036_0017164 | Ga0501036_0017164_2373_3077 | 232 |
| 146 | 3300049572 | Ga0501036_0038161 | Ga0501036_0038161_608_1312 | 232 |
| 147 | 3300049572 | Ga0501036_0129334 | Ga0501036_0129334_297_1001 | 232 |
| 148 | 3300049572 | Ga0501036_0319429 | Ga0501036_0319429_187_891 | 232 |
| 149 | 3300049572 | Ga0501036_0348534 | Ga0501036_0348534_267_971 | 232 |
| 150 | 3300049573 | Ga0501037_0017976 | Ga0501037_0017976_4308_5012 | 232 |
| 151 | 3300049573 | Ga0501037_0024616 | Ga0501037_0024616_3041_3811 | 232 |
| 152 | 3300049573 | Ga0501037_0082125 | Ga0501037_0082125_694_1398 | 232 |
| 153 | 3300049573 | Ga0501037_0150685 | Ga0501037_0150685_141_845 | 232 |
| 154 | 3300049573 | Ga0501037_0289992 | Ga0501037_0289992_424_1128 | 232 |
| 155 | 3300049573 | Ga0501037_0318904 | Ga0501037_0318904_341_1045 | 232 |
| 156 | 3300049574 | Ga0501038_0045667 | Ga0501038_0045667_835_1539 | 232 |
| 157 | 3300049574 | Ga0501038_0131386 | Ga0501038_0131386_77_781 | 232 |
| 158 | 3300049574 | Ga0501038_0315661 | Ga0501038_0315661_113_817 | 232 |
| 159 | 3300049575 | Ga0501039_0003067 | Ga0501039_0003067_6348_7052 | 232 |
| 160 | 3300049575 | Ga0501039_0076329 | Ga0501039_0076329_1310_2014 | 232 |
| 161 | 3300049576 | Ga0501040_0278221 | Ga0501040_0278221_25_729 | 232 |
| 162 | 3300049579 | Ga0501043_0003257 | Ga0501043_0003257_3915_4685 | 232 |
| 163 | 3300049579 | Ga0501043_0003673 | Ga0501043_0003673_3556_4260 | 232 |
| 164 | 3300049579 | Ga0501043_0018936 | Ga0501043_0018936_122_826 | 232 |
| 165 | 3300049579 | Ga0501043_0091383 | Ga0501043_0091383_1344_2048 | 232 |
| 166 | 3300049580 | Ga0501046_0092974 | Ga0501046_0092974_1330_2100 | 232 |
| 167 | 3300049580 | Ga0501046_0386307 | Ga0501046_0386307_293_997 | 232 |
| 168 | 3300049581 | Ga0501047_0000455 | Ga0501047_0000455_8447_9217 | 232 |
| 169 | 3300049581 | Ga0501047_0024148 | Ga0501047_0024148_4392_5096 | 232 |
| 170 | 3300049581 | Ga0501047_0128575 | Ga0501047_0128575_1672_2376 | 232 |
| 171 | 3300049581 | Ga0501047_0142177 | Ga0501047_0142177_1383_2087 | 232 |
| 172 | 3300049581 | Ga0501047_0801627 | Ga0501047_0801627_15_719 | 232 |
| 173 | 3300049582 | Ga0501048_0002034 | Ga0501048_0002034_8502_9272 | 232 |
| 174 | 3300049582 | Ga0501048_0158484 | Ga0501048_0158484_660_1364 | 232 |
| 175 | 3300049584 | Ga0501068_0118921 | Ga0501068_0118921_412_1116 | 232 |
| 176 | 3300049584 | Ga0501068_0137882 | Ga0501068_0137882_164_868 | 232 |
| 177 | 3300049584 | Ga0501068_0328061 | Ga0501068_0328061_238_939 | 232 |
| 178 | 3300049586 | Ga0501070_0003722 | Ga0501070_0003722_8064_8834 | 232 |
| 179 | 3300049586 | Ga0501070_0020920 | Ga0501070_0020920_22_726 | 232 |
| 180 | 3300049586 | Ga0501070_0076879 | Ga0501070_0076879_896_1600 | 232 |
| 181 | 3300049587 | Ga0501071_0195691 | Ga0501071_0195691_587_1291 | 232 |
| 182 | 3300049588 | Ga0501072_0003523 | Ga0501072_0003523_6632_7429 | 232 |
| 183 | 3300049589 | Ga0501073_0011899 | Ga0501073_0011899_1988_2758 | 232 |
| 184 | 3300049589 | Ga0501073_0036690 | Ga0501073_0036690_62_766 | 232 |
| 185 | 3300049589 | Ga0501073_0305903 | Ga0501073_0305903_157_864 | 232 |
| 186 | 3300049589 | Ga0501073_0521637 | Ga0501073_0521637_56_757 | 232 |
| 187 | 3300049590 | Ga0501074_0024490 | Ga0501074_0024490_881_1585 | 232 |
| 188 | 3300049592 | Ga0501076_0319178 | Ga0501076_0319178_76_780 | 232 |
| 189 | 3300049742 | Ga0501080_0001026 | Ga0501080_0001026_8459_9229 | 232 |
| 190 | 3300049742 | Ga0501080_0012079 | Ga0501080_0012079_3181_3885 | 232 |
| 191 | 3300049742 | Ga0501080_0094108 | Ga0501080_0094108_741_1445 | 232 |
| 192 | 3300049744 | Ga0501083_0010516 | Ga0501083_0010516_581_1351 | 232 |
| 193 | 3300049744 | Ga0501083_0026213 | Ga0501083_0026213_2788_3492 | 232 |
| 194 | 3300049744 | Ga0501083_0030240 | Ga0501083_0030240_719_1423 | 232 |
| 195 | 3300049744 | Ga0501083_0457591 | Ga0501083_0457591_84_788 | 232 |
| 196 | 3300049822 | Ga0501035_0029743 | Ga0501035_0029743_3803_4507 | 232 |
| 197 | 3300049822 | Ga0501035_0315892 | Ga0501035_0315892_123_827 | 232 |
| 198 | 3300049822 | Ga0501035_0428939 | Ga0501035_0428939_240_944 | 232 |
| 199 | 3300049823 | Ga0501044_0024576 | Ga0501044_0024576_2091_2795 | 232 |
| 200 | 3300049823 | Ga0501044_0057824 | Ga0501044_0057824_430_1134 | 232 |
| 201 | 3300049823 | Ga0501044_0237298 | Ga0501044_0237298_403_1107 | 232 |
| 202 | 3300049823 | Ga0501044_0242762 | Ga0501044_0242762_439_1143 | 232 |
| 203 | 3300049823 | Ga0501044_0576450 | Ga0501044_0576450_10_741 | 232 |
| 204 | 3300049824 | Ga0501045_0347879 | Ga0501045_0347879_376_1080 | 232 |
| 205 | 3300050491 | nmdc:mga00v17_82170_c1 | nmdc:mga00v17_82170_c1_1288_1992 | 232 |
| 206 | 3300050492 | nmdc:mga0yw44_107588_c1 | nmdc:mga0yw44_107588_c1_704_1405 | 232 |
| 207 | 3300050494 | nmdc:mga06z11_182691_c1 | nmdc:mga06z11_182691_c1_321_1025 | 232 |
| 208 | 3300050494 | nmdc:mga06z11_372957_c1 | nmdc:mga06z11_372957_c1_82_786 | 232 |
| 209 | 3300050495 | nmdc:mga04h51_148759_c1 | nmdc:mga04h51_148759_c1_71_802 | 232 |
| 210 | 3300050496 | nmdc:mga07m45_165553_c1 | nmdc:mga07m45_165553_c1_114_836 | 232 |
| 211 | 3300050496 | nmdc:mga07m45_32490_c1 | nmdc:mga07m45_32490_c1_1915_2619 | 232 |
| 212 | 3300050496 | nmdc:mga07m45_85170_c1 | nmdc:mga07m45_85170_c1_969_1673 | 232 |
| 213 | 3300053086 | Ga0500578_0247208 | Ga0500578_0247208_322_1026 | 232 |
| 214 | 3300053088 | Ga0500644_0000616 | Ga0500644_0000616_4654_5358 | 232 |
| 215 | 3300053093 | Ga0500651_0032245 | Ga0500651_0032245_2127_2831 | 232 |
| 216 | 3300053094 | Ga0500566_0141170 | Ga0500566_0141170_436_1140 | 232 |
| 217 | 3300053096 | Ga0500641_0015291 | Ga0500641_0015291_128_829 | 232 |
| 218 | 3300053096 | Ga0500641_0038549 | Ga0500641_0038549_827_1531 | 232 |
| 219 | 3300053118 | Ga0500594_0046216 | Ga0500594_0046216_273_977 | 232 |
| 220 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_723434_724138 | 232 |
| 221 | 3300053142 | Ga0500577_0246005 | Ga0500577_0246005_14_715 | 232 |
| 222 | 3300053142 | Ga0500577_0261134 | Ga0500577_0261134_22_726 | 232 |
| 223 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_769605_770309 | 232 |
| 224 | 3300053730 | Ga0500645_000012 | Ga0500645_000012_161693_162397 | 232 |
| 225 | 3300060353 | Ga0501082_0000016 | Ga0501082_0000016_81610_82314 | 232 |
| 226 | 3300060353 | Ga0501082_0070028 | Ga0501082_0070028_954_1658 | 232 |
| 227 | 3300060353 | Ga0501082_0139293 | Ga0501082_0139293_306_1094 | 232 |
| 228 | 3300001977 | JGI24746J21847_1000187 | JGI24746J21847_10001879 | 233 |
| 229 | 3300001978 | JGI24747J21853_1005659 | JGI24747J21853_10056592 | 233 |
| 230 | 3300001989 | JGI24739J22299_10000841 | JGI24739J22299_100008415 | 233 |
| 231 | 3300001990 | JGI24737J22298_10000354 | JGI24737J22298_1000035411 | 233 |
| 232 | 3300002070 | JGI24750J21931_1000271 | JGI24750J21931_10002719 | 233 |
| 233 | 3300002073 | JGI24745J21846_1000158 | JGI24745J21846_10001583 | 233 |
| 234 | 3300002076 | JGI24749J21850_1000812 | JGI24749J21850_10008121 | 233 |
| 235 | 3300002077 | JGI24744J21845_10006674 | JGI24744J21845_100066744 | 233 |
| 236 | 3300002126 | JGI24035J26624_1000301 | JGI24035J26624_10003017 | 233 |
| 237 | 3300002155 | JGI24033J26618_1016020 | JGI24033J26618_10160201 | 233 |
| 238 | 3300002459 | JGI24751J29686_10011272 | JGI24751J29686_100112722 | 233 |
| 239 | 3300003371 | JGI26145J50221_1001271 | JGI26145J50221_10012713 | 233 |
| 240 | 3300003781 | Ga0055536_1012680 | Ga0055536_10126804 | 233 |
| 241 | 3300005293 | Ga0065715_10089022 | Ga0065715_100890225 | 233 |
| 242 | 3300005328 | Ga0070676_10003948 | Ga0070676_100039485 | 233 |
| 243 | 3300005329 | Ga0070683_100008259 | Ga0070683_10000825910 | 233 |
| 244 | 3300005330 | Ga0070690_100000577 | Ga0070690_1000005778 | 233 |
| 245 | 3300005333 | Ga0070677_10001438 | Ga0070677_100014382 | 233 |
| 246 | 3300005334 | Ga0068869_100006582 | Ga0068869_1000065829 | 233 |
| 247 | 3300005335 | Ga0070666_10012088 | Ga0070666_100120883 | 233 |
| 248 | 3300005335 | Ga0070666_10147827 | Ga0070666_101478272 | 233 |
| 249 | 3300005336 | Ga0070680_100006307 | Ga0070680_1000063075 | 233 |
| 250 | 3300005336 | Ga0070680_100226179 | Ga0070680_1002261791 | 233 |
| 251 | 3300005337 | Ga0070682_100003225 | Ga0070682_10000322510 | 233 |
| 252 | 3300005338 | Ga0068868_100451612 | Ga0068868_1004516122 | 233 |
| 253 | 3300005339 | Ga0070660_100004146 | Ga0070660_1000041467 | 233 |
| 254 | 3300005340 | Ga0070689_100014858 | Ga0070689_1000148585 | 233 |
| 255 | 3300005341 | Ga0070691_10005385 | Ga0070691_100053855 | 233 |
| 256 | 3300005343 | Ga0070687_100001224 | Ga0070687_1000012244 | 233 |
| 257 | 3300005344 | Ga0070661_100000804 | Ga0070661_10000080419 | 233 |
| 258 | 3300005345 | Ga0070692_10000837 | Ga0070692_100008375 | 233 |
| 259 | 3300005347 | Ga0070668_100006098 | Ga0070668_10000609810 | 233 |
| 260 | 3300005353 | Ga0070669_100006161 | Ga0070669_1000061614 | 233 |
| 261 | 3300005354 | Ga0070675_100017427 | Ga0070675_1000174275 | 233 |
| 262 | 3300005355 | Ga0070671_100009037 | Ga0070671_10000903710 | 233 |
| 263 | 3300005355 | Ga0070671_100048819 | Ga0070671_1000488192 | 233 |
| 264 | 3300005356 | Ga0070674_100004299 | Ga0070674_1000042997 | 233 |
| 265 | 3300005364 | Ga0070673_100006345 | Ga0070673_1000063457 | 233 |
| 266 | 3300005365 | Ga0070688_100000558 | Ga0070688_1000005587 | 233 |
| 267 | 3300005366 | Ga0070659_100024392 | Ga0070659_1000243922 | 233 |
| 268 | 3300005367 | Ga0070667_100008212 | Ga0070667_1000082124 | 233 |
| 269 | 3300005406 | Ga0070703_10011177 | Ga0070703_100111773 | 233 |
| 270 | 3300005434 | Ga0070709_10098327 | Ga0070709_100983272 | 233 |
| 271 | 3300005435 | Ga0070714_100031220 | Ga0070714_1000312203 | 233 |
| 272 | 3300005436 | Ga0070713_100164081 | Ga0070713_1001640812 | 233 |
| 273 | 3300005437 | Ga0070710_10053652 | Ga0070710_100536522 | 233 |
| 274 | 3300005437 | Ga0070710_10207862 | Ga0070710_102078622 | 233 |
| 275 | 3300005438 | Ga0070701_10001856 | Ga0070701_100018564 | 233 |
| 276 | 3300005439 | Ga0070711_100027090 | Ga0070711_1000270903 | 233 |
| 277 | 3300005439 | Ga0070711_100111410 | Ga0070711_1001114102 | 233 |
| 278 | 3300005440 | Ga0070705_100005648 | Ga0070705_1000056484 | 233 |
| 279 | 3300005441 | Ga0070700_100003794 | Ga0070700_1000037949 | 233 |
| 280 | 3300005441 | Ga0070700_100101699 | Ga0070700_1001016992 | 233 |
| 281 | 3300005444 | Ga0070694_100041579 | Ga0070694_1000415795 | 233 |
| 282 | 3300005445 | Ga0070708_100021889 | Ga0070708_1000218892 | 233 |
| 283 | 3300005455 | Ga0070663_100003833 | Ga0070663_1000038339 | 233 |
| 284 | 3300005456 | Ga0070678_100002855 | Ga0070678_1000028555 | 233 |
| 285 | 3300005457 | Ga0070662_100070943 | Ga0070662_1000709431 | 233 |
| 286 | 3300005458 | Ga0070681_10008839 | Ga0070681_100088396 | 233 |
| 287 | 3300005459 | Ga0068867_100012098 | Ga0068867_1000120987 | 233 |
| 288 | 3300005466 | Ga0070685_10061880 | Ga0070685_100618802 | 233 |
| 289 | 3300005530 | Ga0070679_100010504 | Ga0070679_1000105044 | 233 |
| 290 | 3300005535 | Ga0070684_100001753 | Ga0070684_1000017535 | 233 |
| 291 | 3300005536 | Ga0070697_100341652 | Ga0070697_1003416521 | 233 |
| 292 | 3300005539 | Ga0068853_100008092 | Ga0068853_1000080929 | 233 |
| 293 | 3300005543 | Ga0070672_100004614 | Ga0070672_10000461410 | 233 |
| 294 | 3300005544 | Ga0070686_100001565 | Ga0070686_1000015659 | 233 |
| 295 | 3300005545 | Ga0070695_100217315 | Ga0070695_1002173152 | 233 |
| 296 | 3300005546 | Ga0070696_100198575 | Ga0070696_1001985751 | 233 |
| 297 | 3300005547 | Ga0070693_100002143 | Ga0070693_1000021434 | 233 |
| 298 | 3300005549 | Ga0070704_100004087 | Ga0070704_1000040879 | 233 |
| 299 | 3300005563 | Ga0068855_100074740 | Ga0068855_1000747404 | 233 |
| 300 | 3300005564 | Ga0070664_100028636 | Ga0070664_1000286365 | 233 |
| 301 | 3300005577 | Ga0068857_100004864 | Ga0068857_1000048647 | 233 |
| 302 | 3300005578 | Ga0068854_100005702 | Ga0068854_1000057022 | 233 |
| 303 | 3300005614 | Ga0068856_100061308 | Ga0068856_1000613085 | 233 |
| 304 | 3300005615 | Ga0070702_100007505 | Ga0070702_1000075052 | 233 |
| 305 | 3300005616 | Ga0068852_100002326 | Ga0068852_10000232614 | 233 |
| 306 | 3300005617 | Ga0068859_100040171 | Ga0068859_1000401712 | 233 |
| 307 | 3300005618 | Ga0068864_100006005 | Ga0068864_1000060059 | 233 |
| 308 | 3300005618 | Ga0068864_100439536 | Ga0068864_1004395361 | 233 |
| 309 | 3300005718 | Ga0068866_10000301 | Ga0068866_100003017 | 233 |
| 310 | 3300005719 | Ga0068861_100005394 | Ga0068861_1000053945 | 233 |
| 311 | 3300005840 | Ga0068870_10000419 | Ga0068870_100004197 | 233 |
| 312 | 3300005841 | Ga0068863_100000340 | Ga0068863_10000034036 | 233 |
| 313 | 3300005842 | Ga0068858_100036890 | Ga0068858_1000368903 | 233 |
| 314 | 3300005843 | Ga0068860_100037560 | Ga0068860_1000375605 | 233 |
| 315 | 3300005844 | Ga0068862_100009969 | Ga0068862_10000996910 | 233 |
| 316 | 3300006028 | Ga0070717_10040793 | Ga0070717_100407932 | 233 |
| 317 | 3300006175 | Ga0070712_100256184 | Ga0070712_1002561842 | 233 |
| 318 | 3300006186 | Ga0075369_10077093 | Ga0075369_100770932 | 233 |
| 319 | 3300006237 | Ga0097621_100000880 | Ga0097621_10000088010 | 233 |
| 320 | 3300006358 | Ga0068871_100000301 | Ga0068871_10000030131 | 233 |
| 321 | 3300006852 | Ga0075433_10006405 | Ga0075433_100064058 | 233 |
| 322 | 3300006871 | Ga0075434_100007954 | Ga0075434_1000079546 | 233 |
| 323 | 3300006881 | Ga0068865_100003905 | Ga0068865_10000390510 | 233 |
| 324 | 3300006931 | Ga0097620_100040169 | Ga0097620_1000401695 | 233 |
| 325 | 3300009092 | Ga0105250_10027060 | Ga0105250_100270602 | 233 |
| 326 | 3300009093 | Ga0105240_10043237 | Ga0105240_100432372 | 233 |
| 327 | 3300009094 | Ga0111539_10020700 | Ga0111539_100207008 | 233 |
| 328 | 3300009098 | Ga0105245_10018996 | Ga0105245_100189964 | 233 |
| 329 | 3300009101 | Ga0105247_10002113 | Ga0105247_100021139 | 233 |
| 330 | 3300009148 | Ga0105243_10012907 | Ga0105243_100129078 | 233 |
| 331 | 3300009174 | Ga0105241_10001943 | Ga0105241_1000194311 | 233 |
| 332 | 3300009177 | Ga0105248_10003102 | Ga0105248_100031029 | 233 |
| 333 | 3300009545 | Ga0105237_10017102 | Ga0105237_100171022 | 233 |
| 334 | 3300009553 | Ga0105249_10001599 | Ga0105249_1000159917 | 233 |
| 335 | 3300010375 | Ga0105239_10024058 | Ga0105239_100240584 | 233 |
| 336 | 3300011119 | Ga0105246_10017880 | Ga0105246_100178804 | 233 |
| 337 | 3300013100 | Ga0157373_10007508 | Ga0157373_100075085 | 233 |
| 338 | 3300013102 | Ga0157371_10008631 | Ga0157371_100086318 | 233 |
| 339 | 3300013104 | Ga0157370_10002130 | Ga0157370_1000213027 | 233 |
| 340 | 3300013296 | Ga0157374_10001695 | Ga0157374_100016956 | 233 |
| 341 | 3300013297 | Ga0157378_10003374 | Ga0157378_1000337417 | 233 |
| 342 | 3300013306 | Ga0163162_10055943 | Ga0163162_100559431 | 233 |
| 343 | 3300013307 | Ga0157372_10004321 | Ga0157372_100043217 | 233 |
| 344 | 3300013308 | Ga0157375_10019602 | Ga0157375_100196022 | 233 |
| 345 | 3300014325 | Ga0163163_10229268 | Ga0163163_102292682 | 233 |
| 346 | 3300014326 | Ga0157380_10006382 | Ga0157380_100063824 | 233 |
| 347 | 3300014968 | Ga0157379_10006391 | Ga0157379_100063915 | 233 |
| 348 | 3300015265 | Ga0182005_1000055 | Ga0182005_100005577 | 233 |
| 349 | 3300017792 | Ga0163161_10009345 | Ga0163161_100093459 | 233 |
| 350 | 3300021388 | Ga0213875_10002533 | Ga0213875_100025334 | 233 |
| 351 | 3300025271 | Ga0207666_1000059 | Ga0207666_10000599 | 233 |
| 352 | 3300025290 | Ga0207673_1009757 | Ga0207673_10097572 | 233 |
| 353 | 3300025291 | Ga0209675_1000970 | Ga0209675_10009705 | 233 |
| 354 | 3300025292 | Ga0209676_1000089 | Ga0209676_1000089183 | 233 |
| 355 | 3300025298 | Ga0209050_1008016 | Ga0209050_10080167 | 233 |
| 356 | 3300025315 | Ga0207697_10002326 | Ga0207697_1000232611 | 233 |
| 357 | 3300025711 | Ga0207696_1021692 | Ga0207696_10216922 | 233 |
| 358 | 3300025885 | Ga0207653_10009705 | Ga0207653_100097053 | 233 |
| 359 | 3300025893 | Ga0207682_10002173 | Ga0207682_100021739 | 233 |
| 360 | 3300025899 | Ga0207642_10012159 | Ga0207642_100121594 | 233 |
| 361 | 3300025900 | Ga0207710_10004879 | Ga0207710_100048794 | 233 |
| 362 | 3300025901 | Ga0207688_10000167 | Ga0207688_1000016719 | 233 |
| 363 | 3300025903 | Ga0207680_10025573 | Ga0207680_100255732 | 233 |
| 364 | 3300025904 | Ga0207647_10002561 | Ga0207647_100025617 | 233 |
| 365 | 3300025906 | Ga0207699_10283810 | Ga0207699_102838102 | 233 |
| 366 | 3300025907 | Ga0207645_10005337 | Ga0207645_100053378 | 233 |
| 367 | 3300025908 | Ga0207643_10000007 | Ga0207643_10000007189 | 233 |
| 368 | 3300025911 | Ga0207654_10002202 | Ga0207654_100022026 | 233 |
| 369 | 3300025912 | Ga0207707_10014147 | Ga0207707_100141477 | 233 |
| 370 | 3300025912 | Ga0207707_10176301 | Ga0207707_101763012 | 233 |
| 371 | 3300025914 | Ga0207671_10173593 | Ga0207671_101735932 | 233 |
| 372 | 3300025915 | Ga0207693_10000563 | Ga0207693_1000056319 | 233 |
| 373 | 3300025917 | Ga0207660_10002332 | Ga0207660_100023329 | 233 |
| 374 | 3300025918 | Ga0207662_10000195 | Ga0207662_1000019520 | 233 |
| 375 | 3300025919 | Ga0207657_10002386 | Ga0207657_100023869 | 233 |
| 376 | 3300025920 | Ga0207649_10000944 | Ga0207649_100009449 | 233 |
| 377 | 3300025921 | Ga0207652_10009630 | Ga0207652_100096309 | 233 |
| 378 | 3300025924 | Ga0207694_10090984 | Ga0207694_100909842 | 233 |
| 379 | 3300025925 | Ga0207650_10012289 | Ga0207650_100122895 | 233 |
| 380 | 3300025926 | Ga0207659_10002481 | Ga0207659_100024819 | 233 |
| 381 | 3300025927 | Ga0207687_10000072 | Ga0207687_1000007280 | 233 |
| 382 | 3300025929 | Ga0207664_10161248 | Ga0207664_101612482 | 233 |
| 383 | 3300025931 | Ga0207644_10022392 | Ga0207644_100223922 | 233 |
| 384 | 3300025931 | Ga0207644_10125661 | Ga0207644_101256613 | 233 |
| 385 | 3300025932 | Ga0207690_10029980 | Ga0207690_100299804 | 233 |
| 386 | 3300025933 | Ga0207706_10008634 | Ga0207706_100086348 | 233 |
| 387 | 3300025934 | Ga0207686_10009296 | Ga0207686_100092965 | 233 |
| 388 | 3300025935 | Ga0207709_10002480 | Ga0207709_1000248013 | 233 |
| 389 | 3300025936 | Ga0207670_10000792 | Ga0207670_1000079214 | 233 |
| 390 | 3300025937 | Ga0207669_10001742 | Ga0207669_1000174210 | 233 |
| 391 | 3300025938 | Ga0207704_10003278 | Ga0207704_100032786 | 233 |
| 392 | 3300025939 | Ga0207665_10400739 | Ga0207665_104007391 | 233 |
| 393 | 3300025940 | Ga0207691_10009483 | Ga0207691_100094836 | 233 |
| 394 | 3300025941 | Ga0207711_10001106 | Ga0207711_1000110624 | 233 |
| 395 | 3300025942 | Ga0207689_10000366 | Ga0207689_100003668 | 233 |
| 396 | 3300025944 | Ga0207661_10010227 | Ga0207661_100102275 | 233 |
| 397 | 3300025945 | Ga0207679_10000029 | Ga0207679_100000298 | 233 |
| 398 | 3300025949 | Ga0207667_10111576 | Ga0207667_101115763 | 233 |
| 399 | 3300025960 | Ga0207651_10000292 | Ga0207651_1000029223 | 233 |
| 400 | 3300025961 | Ga0207712_10010471 | Ga0207712_100104714 | 233 |
| 401 | 3300025972 | Ga0207668_10010650 | Ga0207668_100106506 | 233 |
| 402 | 3300025981 | Ga0207640_10001667 | Ga0207640_100016679 | 233 |
| 403 | 3300025986 | Ga0207658_10038839 | Ga0207658_100388395 | 233 |
| 404 | 3300026023 | Ga0207677_10042618 | Ga0207677_100426184 | 233 |
| 405 | 3300026035 | Ga0207703_10009816 | Ga0207703_100098169 | 233 |
| 406 | 3300026041 | Ga0207639_10013289 | Ga0207639_100132896 | 233 |
| 407 | 3300026067 | Ga0207678_10006759 | Ga0207678_100067598 | 233 |
| 408 | 3300026075 | Ga0207708_10004100 | Ga0207708_100041009 | 233 |
| 409 | 3300026078 | Ga0207702_10011803 | Ga0207702_100118035 | 233 |
| 410 | 3300026088 | Ga0207641_10004156 | Ga0207641_1000415612 | 233 |
| 411 | 3300026089 | Ga0207648_10008435 | Ga0207648_100084358 | 233 |
| 412 | 3300026095 | Ga0207676_10000182 | Ga0207676_100001826 | 233 |
| 413 | 3300026095 | Ga0207676_10248790 | Ga0207676_102487901 | 233 |
| 414 | 3300026116 | Ga0207674_10007304 | Ga0207674_100073049 | 233 |
| 415 | 3300026118 | Ga0207675_100011726 | Ga0207675_1000117269 | 233 |
| 416 | 3300026121 | Ga0207683_10007517 | Ga0207683_100075178 | 233 |
| 417 | 3300026142 | Ga0207698_10005197 | Ga0207698_1000519710 | 233 |
| 418 | 3300027364 | Ga0209967_1016452 | Ga0209967_10164521 | 233 |
| 419 | 3300027614 | Ga0209970_1027402 | Ga0209970_10274022 | 233 |
| 420 | 3300027717 | Ga0209998_10000962 | Ga0209998_100009628 | 233 |
| 421 | 3300027866 | Ga0209813_10067392 | Ga0209813_100673922 | 233 |
| 422 | 3300027876 | Ga0209974_10000736 | Ga0209974_100007368 | 233 |
| 423 | 3300027907 | Ga0207428_10001793 | Ga0207428_100017938 | 233 |
| 424 | 3300028380 | Ga0268265_10004249 | Ga0268265_100042499 | 233 |
| 425 | 3300028381 | Ga0268264_10013946 | Ga0268264_100139466 | 233 |
| 426 | 3300028786 | Ga0307517_10020056 | Ga0307517_100200562 | 233 |
| 427 | 3300031238 | Ga0265332_10000732 | Ga0265332_1000073214 | 233 |
| 428 | 3300031241 | Ga0265325_10005918 | Ga0265325_100059183 | 233 |
| 429 | 3300031241 | Ga0265325_10071293 | Ga0265325_100712932 | 233 |
| 430 | 3300031241 | Ga0265325_10100954 | Ga0265325_101009541 | 233 |
| 431 | 3300031242 | Ga0265329_10010307 | Ga0265329_100103072 | 233 |
| 432 | 3300031247 | Ga0265340_10003622 | Ga0265340_100036224 | 233 |
| 433 | 3300031247 | Ga0265340_10095553 | Ga0265340_100955532 | 233 |
| 434 | 3300031249 | Ga0265339_10001116 | Ga0265339_1000111613 | 233 |
| 435 | 3300031249 | Ga0265339_10011954 | Ga0265339_100119543 | 233 |
| 436 | 3300031250 | Ga0265331_10006555 | Ga0265331_100065555 | 233 |
| 437 | 3300031250 | Ga0265331_10109471 | Ga0265331_101094712 | 233 |
| 438 | 3300031344 | Ga0265316_10137477 | Ga0265316_101374772 | 233 |
| 439 | 3300031344 | Ga0265316_10161230 | Ga0265316_101612302 | 233 |
| 440 | 3300031456 | Ga0307513_10176719 | Ga0307513_101767192 | 233 |
| 441 | 3300031595 | Ga0265313_10003835 | Ga0265313_100038357 | 233 |
| 442 | 3300031595 | Ga0265313_10007507 | Ga0265313_100075077 | 233 |
| 443 | 3300031712 | Ga0265342_10000258 | Ga0265342_1000025836 | 233 |
| 444 | 3300031712 | Ga0265342_10025712 | Ga0265342_100257124 | 233 |
| 445 | 3300032005 | Ga0307411_10212861 | Ga0307411_102128612 | 233 |
| 446 | 3300034816 | Ga0373930_0010963 | Ga0373930_0010963_629_1330 | 233 |
| 447 | 3300034818 | Ga0373950_0009099 | Ga0373950_0009099_841_1542 | 233 |
| 448 | 3300034820 | Ga0373959_0006771 | Ga0373959_0006771_81_782 | 233 |
| 449 | 3300034957 | Ga0373938_0001079 | Ga0373938_0001079_3000_3701 | 233 |
| 450 | 3300035085 | Ga0373929_0002864 | Ga0373929_0002864_2189_2890 | 233 |
| 451 | 3300035088 | Ga0373940_0002243 | Ga0373940_0002243_1482_2183 | 233 |
| 452 | 3300035090 | Ga0373949_0002153 | Ga0373949_0002153_3104_3805 | 233 |
| 453 | 3300035092 | Ga0373952_0002050 | Ga0373952_0002050_1648_2349 | 233 |
| 454 | 3300035114 | Ga0373939_0001680 | Ga0373939_0001680_4507_5208 | 233 |
| 455 | 3300035116 | Ga0373945_0030446 | Ga0373945_0030446_1006_1713 | 233 |
| 456 | 3300035121 | Ga0373960_0011101 | Ga0373960_0011101_988_1689 | 233 |
| 457 | 3300035695 | Ga0373927_0108287 | Ga0373927_0108287_444_1151 | 233 |
| 458 | 3300036401 | Ga0373937_0881888 | Ga0373937_0881888_129_830 | 233 |
| 459 | 3300037068 | Ga0373925_0271086 | Ga0373925_0271086_270_992 | 233 |
| 460 | 3300037853 | Ga0436364_0167179 | Ga0436364_0167179_7017_7721 | 233 |
| 461 | 3300037853 | Ga0436364_0335253 | Ga0436364_0335253_42553_43266 | 233 |
| 462 | 3300037853 | Ga0436364_1247966 | Ga0436364_1247966_8681_9430 | 233 |
| 463 | 3300039437 | Ga0436365_0665259 | Ga0436365_0665259_188_889 | 233 |
| 464 | 3300039437 | Ga0436365_1069579 | Ga0436365_1069579_45_746 | 233 |
| 465 | 3300039438 | Ga0436360_0020476 | Ga0436360_0020476_1920_2624 | 233 |
| 466 | 3300039447 | Ga0436361_0136044 | Ga0436361_0136044_6179_6937 | 233 |
| 467 | 3300039450 | Ga0436363_0251431 | Ga0436363_0251431_552_1256 | 233 |
| 468 | 3300039450 | Ga0436363_0490009 | Ga0436363_0490009_179_880 | 233 |
| 469 | 3300039450 | Ga0436363_1384763 | Ga0436363_1384763_1639_2343 | 233 |
| 470 | 3300039453 | Ga0436362_0280123 | Ga0436362_0280123_431_1135 | 233 |
| 471 | 3300045051 | Ga0451576_0732102 | Ga0451576_0732102_177_914 | 233 |
| 472 | 3300046683 | Ga0495658_0502899 | Ga0495658_0502899_38_742 | 233 |
| 473 | 3300046684 | Ga0495669_0082359 | Ga0495669_0082359_112_813 | 233 |
| 474 | 3300048903 | Ga0496100_0037625 | Ga0496100_0037625_902_1603 | 233 |
| 475 | 3300048904 | Ga0496101_0108779 | Ga0496101_0108779_1034_1735 | 233 |
| 476 | 3300048906 | Ga0496103_0002596 | Ga0496103_0002596_8190_8891 | 233 |
| 477 | 3300048907 | Ga0496104_0301403 | Ga0496104_0301403_578_1279 | 233 |
| 478 | 3300048909 | Ga0496106_0035717 | Ga0496106_0035717_853_1554 | 233 |
| 479 | 3300048910 | Ga0496107_0040869 | Ga0496107_0040869_2478_3179 | 233 |
| 480 | 3300048911 | Ga0496108_0028028 | Ga0496108_0028028_407_1108 | 233 |
| 481 | 3300048912 | Ga0496109_0008888 | Ga0496109_0008888_6258_6959 | 233 |
| 482 | 3300048913 | Ga0496110_0176925 | Ga0496110_0176925_660_1361 | 233 |
| 483 | 3300048913 | Ga0496110_0350514 | Ga0496110_0350514_55_813 | 233 |
| 484 | 3300048914 | Ga0496111_0294123 | Ga0496111_0294123_382_1083 | 233 |
| 485 | 3300048917 | Ga0496114_0005989 | Ga0496114_0005989_3262_3963 | 233 |
| 486 | 3300048918 | Ga0496115_0031731 | Ga0496115_0031731_2596_3297 | 233 |
| 487 | 3300048928 | Ga0496125_0034764 | Ga0496125_0034764_1104_1916 | 233 |
| 488 | 3300049571 | Ga0501034_0418243 | Ga0501034_0418243_449_1150 | 233 |
| 489 | 3300049585 | Ga0501069_0005711 | Ga0501069_0005711_305_1012 | 233 |
| 490 | 3300049586 | Ga0501070_0038661 | Ga0501070_0038661_1777_2484 | 233 |
| 491 | 3300049741 | Ga0501079_0334186 | Ga0501079_0334186_318_1025 | 233 |
| 492 | 3300049744 | Ga0501083_0066710 | Ga0501083_0066710_1570_2277 | 233 |
| 493 | 3300049822 | Ga0501035_0001156 | Ga0501035_0001156_6018_6725 | 233 |
| 494 | 3300049823 | Ga0501044_0551295 | Ga0501044_0551295_22_723 | 233 |
| 495 | 3300050511 | nmdc:mga08y16_439554_c1 | nmdc:mga08y16_439554_c1_481_1182 | 233 |
| 496 | 3300050512 | nmdc:mga0n895_1284_c1 | nmdc:mga0n895_1284_c1_6127_6828 | 233 |
| 497 | 3300050512 | nmdc:mga0n895_574709_c1 | nmdc:mga0n895_574709_c1_145_849 | 233 |
| 498 | 3300050513 | nmdc:mga0rr50_366859_c1 | nmdc:mga0rr50_366859_c1_481_1182 | 233 |
| 499 | 3300050515 | nmdc:mga0a205_1140_c1 | nmdc:mga0a205_1140_c1_17428_18129 | 233 |
| 500 | 3300053111 | Ga0500572_080261 | Ga0500572_080261_84_785 | 233 |
| 501 | 3300053117 | Ga0500593_003255 | Ga0500593_003255_4280_4981 | 233 |
| 502 | 3300053729 | Ga0500625_045483 | Ga0500625_045483_954_1676 | 233 |
| 503 | 3300053737 | Ga0500601_001022 | Ga0500601_001022_86_787 | 233 |
| 504 | 3300060353 | Ga0501082_0172625 | Ga0501082_0172625_49_756 | 233 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kgb-assembly1.cif.gz_A | structure of succinyl-coa: 3-ketoacid coa transferase from drosophila melanogaster | 0.9771 | 3 | 226 |
| 4kgb-assembly1.cif.gz_B | structure of succinyl-coa: 3-ketoacid coa transferase from drosophila melanogaster | 0.977 | 3 | 226 |
| 5dbn-assembly2.cif.gz_E | crystal structure of atoda complex | 0.974 | 3 | 215 |
| 1ooz-assembly1.cif.gz_A | deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart | 0.9739 | 3 | 226 |
| 1o9l-assembly2.cif.gz_C | succinate:coenzyme-a transferase (pig heart) | 0.9737 | 3 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5dbnA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.9764 | 1 | 215 | 3.40.1080.10 |
| 2nrbB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.9745 | 3 | 217 | 3.40.1080.10 |
| af_Q4E2P8_5_264_3.40.1080.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.9669 | 1 | 229 | 3.40.1080.10 |
| 5dbnA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.963 | 1 | 215 | 3.40.1080.10 |
| af_A4I5L9_2_259_3.40.1080.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.9513 | 4 | 231 | 3.40.1080.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0Y3Z3-F1-model_v4 | Succinyl-CoA--3-ketoacid-CoA transferase | 0.9974 | 1 | 79 |
GO:0008410
|
| AF-A0A257PXQ8-F1-model_v4 | Succinyl-CoA--3-ketoacid-CoA transferase | 0.9973 | 1 | 107 |
GO:0008410
|
| AF-A0A4V1QWY8-F1-model_v4 | deleted | 0.9958 | 26 | 102 |
|
| AF-A0A5A7MRX1-F1-model_v4 | merged | 0.9946 | 1 | 155 |
|
| AF-A0A2V6D029-F1-model_v4 | Succinyl-CoA--3-ketoacid-CoA transferase | 0.9938 | 1 | 93 |
GO:0008410
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar