F456242

General Info

Members Datasets Scaffolds Average Seq Length
504 258 1008 249

Family's Representative Sequence

Representative Sequence 3300046475|Ga0495639_0014286|Ga0495639_0014286_2458_3357
Length 282
Sequence MILDLFRVTGRVAVVTGADVVISARSADQLAGVAARIEAAGRRALAVPADLSDLDAAAGLAGTAAEAFGRLDIVVNNVGGAMPRPFAATRPRHLEAAFHFNVAVAHALTAAAVPYLVKAADGEGVPAGVRGAVPAGADLAGAGKAAGPGEAPWHGTAAGAVINISSAVGRAAGRGYLAYGTAKAALAHYTRLAAADLAPRVRVNAIAVGAAATSALDIVLTDDRLRGQMEQATPLRRIGDPREVAAAVVFLASPASGYITGKILEVDGGIERPNLDLGIPDL

Samples

Sample ID Description Type Environment
1 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
72 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
79 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
80 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
90 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
91 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
92 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
93 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
94 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
95 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
98 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
99 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
100 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
102 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
104 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
105 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
108 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
113 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
114 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
131 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
132 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
133 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
134 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
135 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
136 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
242 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
243 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
249 2547132424 Nocardia nova SH22a Isolate Unclassified
250 2558860280 Kutzneria sp. 744 Isolate Unclassified
251 2643221692 Nocardia sp. Root136 Isolate Unclassified
252 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
253 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
254 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
255 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
256 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
257 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
258 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.02
Metatranscriptomes 0
Isolates 1.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.99
Nodule 0
Rhizoplane 2.98
Rhizosphere 92.86
Stem 0
Stem Tuber 0.2
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495639_0014286 3300046475 Bacteria 3437
2 Ga0070658_10228437 3300005327 Bacteria 1575
3 Ga0070683_100703002 3300005329 Bacteria 968
4 Ga0070670_100329952 3300005331 Bacteria 1338
5 Ga0070680_100528855 3300005336 Bacteria 1010
6 Ga0070682_100114615 3300005337 Bacteria 1801
7 Ga0070675_100124813 3300005354 Bacteria 2189
8 Ga0070671_100254845 3300005355 Bacteria 1491
9 Ga0070709_10001369 3300005434 Bacteria 13313
10 Ga0070709_10053265 3300005434 Bacteria 2547
11 Ga0070714_100003326 3300005435 Bacteria 11985
12 Ga0070714_100032275 3300005435 Bacteria 4370
13 Ga0070714_100034287 3300005435 Bacteria 4250
14 Ga0070714_100045934 3300005435 Bacteria 3703
15 Ga0070714_100047307 3300005435 Bacteria 3654
16 Ga0070714_100270238 3300005435 Bacteria 1576
17 Ga0070714_100292016 3300005435 Bacteria 1517
18 Ga0070714_100325702 3300005435 Bacteria 1438
19 Ga0070714_100331344 3300005435 Bacteria 1425
20 Ga0070713_100031847 3300005436 Bacteria 4205
21 Ga0070713_100055000 3300005436 Bacteria 3305
22 Ga0070713_100089728 3300005436 Bacteria 2641
23 Ga0070713_100353167 3300005436 Bacteria 1364
24 Ga0070710_10000059 3300005437 Bacteria 50510
25 Ga0070710_10006001 3300005437 Bacteria 5804
26 Ga0070710_10203758 3300005437 Bacteria 1251
27 Ga0070711_100003455 3300005439 Bacteria 9208
28 Ga0070711_100136182 3300005439 Bacteria 1836
29 Ga0070705_100121378 3300005440 Bacteria 1688
30 Ga0070708_100002865 3300005445 Bacteria 13386
31 Ga0070708_100004941 3300005445 Bacteria 10545
32 Ga0070708_100008847 3300005445 Bacteria 8100
33 Ga0070708_100073879 3300005445 Bacteria 3074
34 Ga0070706_100003387 3300005467 Bacteria 15720
35 Ga0070706_100057626 3300005467 Bacteria 3585
36 Ga0070706_100069585 3300005467 Bacteria 3255
37 Ga0070707_100004586 3300005468 Bacteria 12927
38 Ga0070707_100008081 3300005468 Bacteria 9759
39 Ga0070698_100054158 3300005471 Bacteria 4074
40 Ga0070698_100376827 3300005471 Bacteria 1351
41 Ga0070699_100140680 3300005518 Bacteria 2131
42 Ga0070699_100321542 3300005518 Bacteria 1391
43 Ga0070699_100681395 3300005518 Bacteria 939
44 Ga0070697_100052653 3300005536 Bacteria 3307
45 Ga0070697_100251453 3300005536 Bacteria 1511
46 Ga0070695_100565009 3300005545 Bacteria 888
47 Ga0070704_100040662 3300005549 Bacteria 3202
48 Ga0068855_100224079 3300005563 Bacteria 2107
49 Ga0068855_100666346 3300005563 Bacteria 1116
50 Ga0068856_100208249 3300005614 Bacteria 1970
51 Ga0068864_100348775 3300005618 Bacteria 1396
52 Ga0068860_100319907 3300005843 Bacteria 1523
53 Ga0081539_10006973 3300005985 Bacteria 10492
54 Ga0081539_10011109 3300005985 Bacteria 7188
55 Ga0070717_10032164 3300006028 Bacteria 4225
56 Ga0070715_10031198 3300006163 Bacteria 2161
57 Ga0070715_10226940 3300006163 Bacteria 963
58 Ga0070712_100004236 3300006175 Bacteria 8827
59 Ga0097621_100133896 3300006237 Bacteria 2112
60 Ga0068871_100301904 3300006358 Bacteria 1406
61 Ga0075428_100029830 3300006844 Bacteria 6033
62 Ga0075428_100168344 3300006844 Bacteria 2377
63 Ga0075428_100201777 3300006844 Bacteria 2150
64 Ga0075428_100412778 3300006844 Bacteria 1446
65 Ga0075430_100067786 3300006846 Bacteria 2995
66 Ga0075430_100099016 3300006846 Bacteria 2435
67 Ga0075430_100187929 3300006846 Bacteria 1717
68 Ga0075430_100281164 3300006846 Bacteria 1377
69 Ga0075431_100173888 3300006847 Bacteria 2212
70 Ga0075431_100180590 3300006847 Bacteria 2166
71 Ga0075434_100044456 3300006871 Bacteria 4406
72 Ga0075434_100144822 3300006871 Bacteria 2396
73 Ga0075434_100233996 3300006871 Bacteria 1857
74 Ga0075429_100271425 3300006880 Bacteria 1485
75 Ga0075429_100611664 3300006880 Bacteria 955
76 Ga0075436_100028467 3300006914 Bacteria 3844
77 Ga0075436_100150854 3300006914 Bacteria 1636
78 Ga0075435_100008937 3300007076 Bacteria 7221
79 Ga0075435_100016529 3300007076 Bacteria 5564
80 Ga0075435_100110890 3300007076 Bacteria 2282
81 Ga0075435_100140685 3300007076 Bacteria 2025
82 Ga0105245_10158729 3300009098 Bacteria 2144
83 Ga0114129_10122164 3300009147 Bacteria 3584
84 Ga0114129_10125661 3300009147 Bacteria 3526
85 Ga0114129_10223373 3300009147 Bacteria 2540
86 Ga0114129_10356084 3300009147 Bacteria 1938
87 Ga0105243_10135761 3300009148 Bacteria 2092
88 Ga0105241_10184855 3300009174 Bacteria 1731
89 Ga0105242_10187633 3300009176 Bacteria 1828
90 Ga0105249_10652419 3300009553 Bacteria 1110
91 Ga0157380_10384341 3300014326 Bacteria 1326
92 Ga0157380_10764263 3300014326 Bacteria 979
93 Ga0213873_10006533 3300021358 Bacteria 2298
94 Ga0207692_10000355 3300025898 Bacteria 15774
95 Ga0207692_10009108 3300025898 Bacteria 4133
96 Ga0207685_10000891 3300025905 Bacteria 5660
97 Ga0207699_10001308 3300025906 Bacteria 11840
98 Ga0207699_10018968 3300025906 Bacteria 3656
99 Ga0207699_10095697 3300025906 Bacteria 1873
100 Ga0207684_10000595 3300025910 Bacteria 43323
101 Ga0207684_10062884 3300025910 Bacteria 3151
102 Ga0207684_10109402 3300025910 Bacteria 2365
103 Ga0207693_10005082 3300025915 Bacteria 11031
104 Ga0207693_10118252 3300025915 Bacteria 2081
105 Ga0207663_10002544 3300025916 Bacteria 8767
106 Ga0207660_10408896 3300025917 Bacteria 1093
107 Ga0207646_10128906 3300025922 Bacteria 2276
108 Ga0207646_10293653 3300025922 Bacteria 1469
109 Ga0207646_10346473 3300025922 Bacteria 1342
110 Ga0207681_10315187 3300025923 Bacteria 1242
111 Ga0207650_10252905 3300025925 Bacteria 1427
112 Ga0207659_10227429 3300025926 Bacteria 1503
113 Ga0207700_10014108 3300025928 Bacteria 5225
114 Ga0207700_10044515 3300025928 Bacteria 3269
115 Ga0207700_10120910 3300025928 Bacteria 2123
116 Ga0207700_10251769 3300025928 Bacteria 1509
117 Ga0207664_10003823 3300025929 Bacteria 10108
118 Ga0207664_10008460 3300025929 Bacteria 7179
119 Ga0207664_10010266 3300025929 Bacteria 6612
120 Ga0207664_10031104 3300025929 Bacteria 4081
121 Ga0207664_10099992 3300025929 Bacteria 2394
122 Ga0207664_10234587 3300025929 Bacteria 1596
123 Ga0207706_10137930 3300025933 Bacteria 2146
124 Ga0207686_10149864 3300025934 Bacteria 1623
125 Ga0207686_10324755 3300025934 Bacteria 1151
126 Ga0207665_10011211 3300025939 Bacteria 5883
127 Ga0207665_10050212 3300025939 Bacteria 2805
128 Ga0207689_10209092 3300025942 Bacteria 1612
129 Ga0207668_10250303 3300025972 Bacteria 1439
130 Ga0207658_10110289 3300025986 Bacteria 2174
131 Ga0207658_10292342 3300025986 Bacteria 1401
132 Ga0207702_10230798 3300026078 Bacteria 1730
133 Ga0207676_10231616 3300026095 Bacteria 1652
134 Ga0207683_10025641 3300026121 Bacteria 5086
135 Ga0268264_10452014 3300028381 Bacteria 1245
136 Ga0316177_1152447 3300030731 Bacteria 5678
137 Ga0314311_1076134 3300030733 Bacteria 5642
138 Ga0265331_10058220 3300031250 Bacteria 1830
139 Ga0265327_10000112 3300031251 Bacteria 175878
140 Ga0265327_10002803 3300031251 Bacteria 17598
141 Ga0307513_10296928 3300031456 Bacteria 1384
142 Ga0307509_10334124 3300031507 Bacteria 1245
143 Ga0307509_10381243 3300031507 Bacteria 1123
144 Ga0307408_100196104 3300031548 Bacteria 1631
145 Ga0316576_10009916 3300031727 Bacteria 6165
146 Ga0316576_10112800 3300031727 Bacteria 2038
147 Ga0316578_10001648 3300031728 Bacteria 9276
148 Ga0316578_10039331 3300031728 Bacteria 2732
149 Ga0316577_10039166 3300031733 Bacteria 2652
150 Ga0316577_10087102 3300031733 Bacteria 1748
151 Ga0307413_10254043 3300031824 Bacteria 1306
152 Ga0307518_10093899 3300031838 Bacteria 2155
153 Ga0307410_10042188 3300031852 Bacteria 3014
154 Ga0307407_10087456 3300031903 Bacteria 1901
155 Ga0307407_10270324 3300031903 Bacteria 1173
156 Ga0307409_100155384 3300031995 Bacteria 1992
157 Ga0307409_100180450 3300031995 Bacteria 1868
158 Ga0307409_100312705 3300031995 Bacteria 1467
159 Ga0307409_100810590 3300031995 Bacteria 944
160 Ga0307416_100058678 3300032002 Bacteria 3122
161 Ga0307416_100061201 3300032002 Bacteria 3071
162 Ga0307416_100128139 3300032002 Bacteria 2278
163 Ga0307416_100165679 3300032002 Bacteria 2049
164 Ga0307416_100198550 3300032002 Bacteria 1901
165 Ga0307416_100619114 3300032002 Bacteria 1164
166 Ga0307416_100995597 3300032002 Bacteria 941
167 Ga0307411_10006515 3300032005 Bacteria 5850
168 Ga0307415_100030714 3300032126 Bacteria 3452
169 Ga0307415_100052085 3300032126 Bacteria 2781
170 Ga0307415_100151715 3300032126 Bacteria 1784
171 Ga0373930_0045851 3300034816 Bacteria 943
172 Ga0373948_0005406 3300034817 Bacteria 2071
173 Ga0373958_0003724 3300034819 Bacteria 2220
174 Ga0373959_0010688 3300034820 Bacteria 1609
175 Ga0373938_0002404 3300034957 Bacteria 3016
176 Ga0373926_0000284 3300035083 Bacteria 12376
177 Ga0373929_0000996 3300035085 Bacteria 5493
178 Ga0373934_0020401 3300035086 Bacteria 2546
179 Ga0373940_0001578 3300035088 Bacteria 4183
180 Ga0373944_0004557 3300035089 Bacteria 3616
181 Ga0373944_0020837 3300035089 Bacteria 1892
182 Ga0373951_0026068 3300035091 Bacteria 1360
183 Ga0373923_0005696 3300035111 Bacteria 4243
184 Ga0373932_0096963 3300035112 Bacteria 954
185 Ga0373936_0000752 3300035113 Bacteria 11362
186 Ga0373941_0040480 3300035115 Bacteria 1437
187 Ga0373945_0003607 3300035116 Bacteria 4878
188 Ga0373953_0005538 3300035117 Bacteria 4106
189 Ga0373953_0065223 3300035117 Bacteria 1494
190 Ga0373956_0010301 3300035119 Bacteria 3827
191 Ga0373956_0011470 3300035119 Bacteria 3654
192 Ga0373956_0038461 3300035119 Bacteria 2116
193 Ga0373956_0072966 3300035119 Bacteria 1568
194 Ga0373957_0046526 3300035120 Bacteria 1647
195 Ga0373957_0095452 3300035120 Bacteria 1186
196 Ga0373960_0004053 3300035121 Bacteria 3346
197 Ga0373943_0010822 3300035170 Bacteria 4094
198 Ga0373943_0061521 3300035170 Bacteria 1877
199 Ga0373943_0165484 3300035170 Bacteria 1207
200 Ga0373946_0087573 3300035171 Bacteria 1374
201 Ga0373946_0174414 3300035171 Bacteria 1017
202 Ga0373955_0015697 3300035172 Bacteria 3714
203 Ga0373955_0021126 3300035172 Bacteria 3281
204 Ga0373955_0111416 3300035172 Bacteria 1582
205 Ga0373955_0148683 3300035172 Bacteria 1378
206 Ga0373942_0047759 3300035207 Bacteria 1190
207 Ga0373962_0052580 3300035242 Bacteria 1177
208 Ga0316574_0014651 3300035398 Bacteria 4535
209 Ga0373924_0017476 3300035410 Bacteria 2752
210 Ga0373935_0008942 3300035692 Bacteria 5995
211 Ga0373935_0023800 3300035692 Bacteria 3763
212 Ga0373935_0047757 3300035692 Bacteria 2708
213 Ga0373935_0124391 3300035692 Bacteria 1726
214 Ga0373935_0130430 3300035692 Bacteria 1688
215 Ga0373927_0029474 3300035695 Bacteria 3577
216 Ga0373927_0098273 3300035695 Bacteria 1903
217 Ga0373933_0019371 3300035724 Bacteria 3843
218 Ga0373933_0021702 3300035724 Bacteria 3650
219 Ga0373933_0025258 3300035724 Bacteria 3406
220 Ga0373933_0137828 3300035724 Bacteria 1538
221 Ga0373933_0321532 3300035724 Bacteria 1003
222 Ga0373947_0004206 3300035725 Bacteria 8443
223 Ga0373947_0043169 3300035725 Bacteria 2693
224 Ga0373947_0086998 3300035725 Bacteria 1943
225 Ga0373947_0103452 3300035725 Bacteria 1792
226 Ga0373937_0002287 3300036401 Bacteria 15995
227 Ga0373937_0129758 3300036401 Bacteria 2354
228 Ga0373937_0140584 3300036401 Bacteria 2258
229 Ga0373937_0177507 3300036401 Bacteria 1999
230 Ga0373937_0339024 3300036401 Bacteria 1423
231 Ga0316582_0301614 3300036647 Bacteria 1101
232 Ga0316584_0021870 3300036712 Bacteria 4656
233 Ga0316584_0281353 3300036712 Bacteria 1208
234 Ga0316584_0339713 3300036712 Bacteria 1080
235 Ga0373925_0009312 3300037068 Bacteria 7147
236 Ga0373925_0012749 3300037068 Bacteria 6090
237 Ga0373925_0102651 3300037068 Bacteria 2200
238 Ga0373925_0119787 3300037068 Bacteria 2042
239 Ga0373925_0172420 3300037068 Bacteria 1708
240 Ga0373925_0314788 3300037068 Bacteria 1266
241 Ga0373925_0414867 3300037068 Bacteria 1099
242 Ga0373925_0481878 3300037068 Bacteria 1017
243 Ga0395900_0129837 3300037418 Bacteria 2583
244 Ga0395900_0159165 3300037418 Bacteria 2304
245 Ga0395898_0055953 3300037466 Bacteria 3847
246 Ga0395905_0044965 3300037471 Bacteria 4142
247 Ga0395905_0121451 3300037471 Bacteria 2456
248 Ga0395901_0078609 3300038443 Bacteria 3444
249 Ga0395901_0101639 3300038443 Bacteria 3016
250 Ga0395901_0626493 3300038443 Bacteria 1082
251 Ga0436365_0631784 3300039437 Bacteria 17829
252 Ga0436365_0804071 3300039437 Bacteria 1709
253 Ga0436360_0363695 3300039438 Bacteria 1072
254 Ga0436362_0151281 3300039453 Bacteria 10211
255 Ga0436362_0957802 3300039453 Bacteria 4324
256 Ga0439438_026783 3300041405 Bacteria 1561
257 Ga0439431_0007166 3300041997 Bacteria 2483
258 Ga0439457_033263 3300042014 Bacteria 1144
259 Ga0450923_030902 3300042125 Bacteria 1092
260 Ga0439434_0014740 3300042435 Bacteria 2327
261 Ga0450918_016032 3300042531 Bacteria 1302
262 Ga0466969_0110875 3300044656 Bacteria 1284
263 Ga0466969_0112032 3300044656 Bacteria 1276
264 Ga0466972_0004587 3300044658 Bacteria 6925
265 Ga0466972_0011312 3300044658 Bacteria 4477
266 Ga0466965_0006807 3300044683 Bacteria 5220
267 Ga0466965_0009399 3300044683 Bacteria 4544
268 Ga0466965_0047809 3300044683 Bacteria 2118
269 Ga0466966_0104224 3300044684 Bacteria 1752
270 Ga0466961_0000884 3300044693 Bacteria 18652
271 Ga0466961_0032536 3300044693 Bacteria 3352
272 Ga0466963_0220130 3300044694 Bacteria 1329
273 Ga0466963_0237236 3300044694 Bacteria 1278
274 Ga0466971_0029230 3300044719 Bacteria 2465
275 Ga0466971_0082741 3300044719 Bacteria 1465
276 Ga0466970_0039246 3300044765 Bacteria 2513
277 Ga0466970_0065478 3300044765 Bacteria 1950
278 Ga0466960_0022949 3300044901 Bacteria 2795
279 Ga0466959_0031622 3300045049 Bacteria 3916
280 Ga0466967_0006001 3300045976 Bacteria 8533
281 Ga0495592_0021922 3300046454 Bacteria 4860
282 Ga0495629_0034448 3300046459 Bacteria 3579
283 Ga0495629_0184340 3300046459 Bacteria 1446
284 Ga0495641_0005300 3300046461 Bacteria 8759
285 Ga0495641_0009908 3300046461 Bacteria 5606
286 Ga0495641_0053923 3300046461 Bacteria 1828
287 Ga0495651_0007042 3300046462 Bacteria 8598
288 Ga0495651_0007768 3300046462 Bacteria 8208
289 Ga0495651_0036281 3300046462 Bacteria 3837
290 Ga0495651_0059708 3300046462 Bacteria 2923
291 Ga0495651_0250888 3300046462 Bacteria 1208
292 Ga0495653_0006944 3300046463 Bacteria 9295
293 Ga0495653_0007686 3300046463 Bacteria 8823
294 Ga0495653_0014361 3300046463 Bacteria 6461
295 Ga0495653_0053787 3300046463 Bacteria 3079
296 Ga0495653_0226209 3300046463 Bacteria 1255
297 Ga0495582_0009117 3300046473 Bacteria 5474
298 Ga0495582_0013354 3300046473 Bacteria 4521
299 Ga0495639_0008123 3300046475 Bacteria 4507
300 Ga0495662_0003902 3300046476 Bacteria 7523
301 Ga0495662_0012357 3300046476 Bacteria 4166
302 Ga0495664_0009549 3300046477 Bacteria 5429
303 Ga0495664_0038379 3300046477 Bacteria 2827
304 Ga0495664_0088341 3300046477 Bacteria 1863
305 Ga0495607_0013909 3300046501 Bacteria 5258
306 Ga0495608_0023488 3300046511 Bacteria 4226
307 Ga0495608_0093326 3300046511 Bacteria 1944
308 Ga0495608_0216672 3300046511 Bacteria 1202
309 Ga0495618_0024264 3300046514 Bacteria 3754
310 Ga0495618_0028254 3300046514 Bacteria 3496
311 Ga0495618_0059438 3300046514 Bacteria 2422
312 Ga0495628_0104197 3300046516 Bacteria 2187
313 Ga0495630_0040792 3300046517 Bacteria 3468
314 Ga0495630_0064338 3300046517 Bacteria 2755
315 Ga0495630_0097838 3300046517 Bacteria 2219
316 Ga0495666_0043621 3300046526 Bacteria 2166
317 Ga0495652_0012767 3300046529 Bacteria 7568
318 Ga0495652_0020803 3300046529 Bacteria 5831
319 Ga0495652_0491121 3300046529 Bacteria 853
320 Ga0495665_0031454 3300046531 Bacteria 2840
321 Ga0495665_0059759 3300046531 Bacteria 2012
322 Ga0495640_0010682 3300046533 Bacteria 7082
323 Ga0495640_0055322 3300046533 Bacteria 2714
324 Ga0495586_0022745 3300046535 Bacteria 3345
325 Ga0495587_0011953 3300046536 Bacteria 5489
326 Ga0495587_0025122 3300046536 Bacteria 3643
327 Ga0495587_0051054 3300046536 Bacteria 2446
328 Ga0495587_0167563 3300046536 Bacteria 1248
329 Ga0495645_0023491 3300046543 Bacteria 4464
330 Ga0495645_0061580 3300046543 Bacteria 2719
331 Ga0495667_0002178 3300046559 Bacteria 13084
332 Ga0495667_0004159 3300046559 Bacteria 9737
333 Ga0495667_0107949 3300046559 Bacteria 1798
334 Ga0495667_0154199 3300046559 Bacteria 1478
335 Ga0495656_0222769 3300046615 Bacteria 944
336 Ga0495634_0009961 3300046642 Bacteria 6983
337 Ga0495635_0000547 3300046663 Bacteria 23894
338 Ga0495635_0006343 3300046663 Bacteria 8246
339 Ga0495635_0037906 3300046663 Bacteria 3337
340 Ga0495635_0043631 3300046663 Bacteria 3094
341 Ga0495635_0384876 3300046663 Bacteria 933
342 Ga0495657_0002561 3300046675 Bacteria 15252
343 Ga0495657_0011579 3300046675 Bacteria 6590
344 Ga0495657_0026008 3300046675 Bacteria 4151
345 Ga0495657_0075711 3300046675 Bacteria 2187
346 Ga0495599_0033755 3300046678 Bacteria 3216
347 Ga0495599_0035123 3300046678 Bacteria 3147
348 Ga0495599_0044901 3300046678 Bacteria 2770
349 Ga0495599_0095829 3300046678 Bacteria 1851
350 Ga0495599_0102941 3300046678 Bacteria 1779
351 Ga0495599_0337816 3300046678 Bacteria 904
352 Ga0495623_0018818 3300046679 Bacteria 4459
353 Ga0495623_0019197 3300046679 Bacteria 4419
354 Ga0495623_0108948 3300046679 Bacteria 1680
355 Ga0495623_0132190 3300046679 Bacteria 1493
356 Ga0495658_0013881 3300046683 Bacteria 4105
357 Ga0495613_0027219 3300046689 Bacteria 4254
358 Ga0495624_0030768 3300046690 Bacteria 3494
359 Ga0495624_0038283 3300046690 Bacteria 3082
360 Ga0495624_0055055 3300046690 Bacteria 2507
361 Ga0495624_0080653 3300046690 Bacteria 2016
362 Ga0495649_0084578 3300046694 Bacteria 1694
363 Ga0495600_0001417 3300046809 Bacteria 13235
364 Ga0495600_0008094 3300046809 Bacteria 6449
365 Ga0495600_0033352 3300046809 Bacteria 3342
366 Ga0495600_0086786 3300046809 Bacteria 2041
367 Ga0495581_0004912 3300047315 Bacteria 7732
368 Ga0495581_0030538 3300047315 Bacteria 3122
369 Ga0495581_0033064 3300047315 Bacteria 2994
370 Ga0495604_0004447 3300047317 Bacteria 11102
371 Ga0495604_0015427 3300047317 Bacteria 6098
372 Ga0495604_0076950 3300047317 Bacteria 2509
373 Ga0495604_0082966 3300047317 Bacteria 2396
374 Ga0495674_0003706 3300047319 Bacteria 14855
375 Ga0495674_0173059 3300047319 Bacteria 1801
376 Ga0495674_0177721 3300047319 Bacteria 1773
377 Ga0495674_0182418 3300047319 Bacteria 1747
378 Ga0495674_0214804 3300047319 Bacteria 1592
379 Ga0495672_0100959 3300047320 Bacteria 1565
380 Ga0495676_0001921 3300047321 Bacteria 18222
381 Ga0495680_0016977 3300047322 Bacteria 6231
382 Ga0495680_0017291 3300047322 Bacteria 6162
383 Ga0495680_0020277 3300047322 Bacteria 5596
384 Ga0495680_0050079 3300047322 Bacteria 3267
385 Ga0495680_0159701 3300047322 Bacteria 1637
386 Ga0495683_0001450 3300047323 Bacteria 15563
387 Ga0495675_0115911 3300047444 Bacteria 1670
388 Ga0495684_0013782 3300047471 Bacteria 6221
389 Ga0495684_0023698 3300047471 Bacteria 4720
390 Ga0495684_0093550 3300047471 Bacteria 2276
391 Ga0495684_0095926 3300047471 Bacteria 2245
392 Ga0495593_0022065 3300047673 Bacteria 3552
393 Ga0495593_0025321 3300047673 Bacteria 3284
394 Ga0495602_0006694 3300048088 Bacteria 12078
395 Ga0495602_0038825 3300048088 Bacteria 4395
396 Ga0495602_0045487 3300048088 Bacteria 3971
397 Ga0495602_0071263 3300048088 Bacteria 2968
398 Ga0495602_0213383 3300048088 Bacteria 1463
399 Ga0495602_0217128 3300048088 Bacteria 1446
400 Ga0495602_0367139 3300048088 Bacteria 1034
401 Ga0495614_0012775 3300048089 Bacteria 3686
402 Ga0495614_0066366 3300048089 Bacteria 1552
403 Ga0495614_0110145 3300048089 Bacteria 1209
404 Ga0496101_0036607 3300048904 Bacteria 3476
405 Ga0496102_0425195 3300048905 Bacteria 1248
406 Ga0496104_0502366 3300048907 Bacteria 1124
407 Ga0496105_0158162 3300048908 Bacteria 1860
408 Ga0496106_0098411 3300048909 Bacteria 2266
409 Ga0496106_0583793 3300048909 Bacteria 896
410 Ga0496107_0164195 3300048910 Bacteria 1647
411 Ga0496108_0012263 3300048911 Bacteria 6972
412 Ga0496108_0073769 3300048911 Bacteria 2881
413 Ga0496109_0202190 3300048912 Bacteria 1868
414 Ga0496109_0713046 3300048912 Bacteria 941
415 Ga0496112_0050646 3300048915 Bacteria 4073
416 Ga0496112_0583652 3300048915 Bacteria 1050
417 Ga0496114_0146162 3300048917 Bacteria 2049
418 Ga0496115_0070506 3300048918 Bacteria 2833
419 Ga0496126_0000040 3300048929 Bacteria 345144
420 Ga0496126_0409749 3300048929 Bacteria 1098
421 Ga0501032_0112062 3300049569 Bacteria 1805
422 Ga0501034_0001234 3300049571 Bacteria 34758
423 Ga0501034_0013341 3300049571 Bacteria 8462
424 Ga0501034_0466902 3300049571 Bacteria 1178
425 Ga0501036_0005115 3300049572 Bacteria 10601
426 Ga0501037_0014453 3300049573 Bacteria 5810
427 Ga0501038_0100781 3300049574 Bacteria 2405
428 Ga0501039_0007081 3300049575 Bacteria 8543
429 Ga0501040_0052142 3300049576 Bacteria 2799
430 Ga0501040_0407038 3300049576 Bacteria 977
431 Ga0501042_0072659 3300049578 Bacteria 2461
432 Ga0501046_0076095 3300049580 Bacteria 2601
433 Ga0501047_0029936 3300049581 Bacteria 5248
434 Ga0501067_0011028 3300049583 Bacteria 5002
435 Ga0501068_0006748 3300049584 Bacteria 6342
436 Ga0501068_0098886 3300049584 Bacteria 1807
437 Ga0501069_0002148 3300049585 Bacteria 9926
438 Ga0501070_0001421 3300049586 Bacteria 21443
439 Ga0501071_0047778 3300049587 Bacteria 3075
440 Ga0501071_0057241 3300049587 Bacteria 2817
441 Ga0501072_0018960 3300049588 Bacteria 5310
442 Ga0501073_0003616 3300049589 Bacteria 11623
443 Ga0501073_0014500 3300049589 Bacteria 5727
444 Ga0501073_0173825 3300049589 Bacteria 1491
445 Ga0501074_0008645 3300049590 Bacteria 7375
446 Ga0501074_0053696 3300049590 Bacteria 2906
447 Ga0501075_0462799 3300049591 Bacteria 967
448 Ga0501077_0084701 3300049593 Bacteria 2009
449 Ga0501079_0060786 3300049741 Bacteria 2914
450 Ga0501080_0014249 3300049742 Bacteria 7320
451 Ga0501080_0033055 3300049742 Bacteria 4827
452 Ga0501083_0004698 3300049744 Bacteria 9646
453 Ga0501083_0016097 3300049744 Bacteria 5237
454 Ga0501083_0091953 3300049744 Bacteria 2003
455 Ga0501083_0419578 3300049744 Bacteria 871
456 Ga0501045_0322383 3300049824 Bacteria 1150
457 nmdc:mga07m45_167465_c1 3300050496 Bacteria 1276
458 nmdc:mga05p37_209171_c1 3300050507 Bacteria 2359
459 nmdc:mga05p37_380968_c1 3300050507 Bacteria 1653
460 nmdc:mga09592_15364_c1 3300050508 Bacteria 6252
461 nmdc:mga09592_287534_c1 3300050508 Bacteria 1425
462 nmdc:mga0qj67_100938_c1 3300050509 Bacteria 2326
463 nmdc:mga06r32_185118_c1 3300050510 Bacteria 2069
464 nmdc:mga06r32_311373_c1 3300050510 Bacteria 1560
465 nmdc:mga06r32_469504_c1 3300050510 Bacteria 1237
466 nmdc:mga06r32_820957_c1 3300050510 Bacteria 889
467 nmdc:mga0n895_101935_c1 3300050512 Bacteria 2881
468 nmdc:mga0n895_228844_c1 3300050512 Bacteria 1887
469 nmdc:mga0n895_93941_c1 3300050512 Bacteria 3003
470 nmdc:mga0rr50_119195_c1 3300050513 Bacteria 2098
471 nmdc:mga0rr50_38507_c1 3300050513 Bacteria 3461
472 nmdc:mga0rr50_89414_c1 3300050513 Bacteria 2394
473 nmdc:mga08x19_158856_c1 3300050514 Bacteria 1534
474 nmdc:mga08x19_208176_c1 3300050514 Bacteria 1342
475 nmdc:mga0a205_4150_c1 3300050515 Bacteria 12975
476 Ga0495601_0085619 3300053077 Bacteria 2025
477 Ga0495601_0306270 3300053077 Bacteria 1035
478 Ga0495612_0050181 3300053078 Bacteria 1713
479 Ga0495612_0065694 3300053078 Bacteria 1507
480 Ga0495595_0003644 3300053084 Bacteria 6120
481 Ga0495595_0128305 3300053084 Bacteria 1238
482 Ga0495619_0031065 3300053085 Bacteria 3459
483 Ga0495619_0063225 3300053085 Bacteria 2465
484 Ga0495619_0142914 3300053085 Bacteria 1648
485 Ga0500595_031520 3300053119 Bacteria 1778
486 Ga0500564_072366 3300053138 Unclassified 1553
487 Ga0500573_0013978 3300053140 Bacteria 4535
488 Ga0500616_0010607 3300053153 Bacteria 5500
489 Ga0501084_0000834 3300054114 Bacteria 23762
490 Ga0501084_0079449 3300054114 Bacteria 2749
491 Ga0501082_0088421 3300060353 Bacteria 2673
492 Ga0466962_0008381 3300061719 Bacteria 4955
493 Ga0530510_0014519 3300061734 Bacteria 5556
494 Ga0530510_0018320 3300061734 Bacteria 4965
495 2548692669 2547132424 Bacteria 8348532
496 2559432329 2558860280 Bacteria 11429938
497 2644512338 2643221692 Bacteria 7282860
498 2791913505 2791354901 Bacteria 8322202
499 2870787850 2870782633 Bacteria 9624083
500 2899363961 2899359706 Bacteria 10940472
501 2899371800 2899370129 Bacteria 6781179
502 2919718101 2919713450 Bacteria 7431245
503 3003000644 3002998708 Bacteria 11715108
504 8055071999 8055066027 Bacteria 9479577
505 Ga0495639_0014286
506 Ga0070658_10228437
507 Ga0070683_100703002
508 Ga0070670_100329952
509 Ga0070680_100528855
510 Ga0070682_100114615
511 Ga0070675_100124813
512 Ga0070671_100254845
513 Ga0070709_10001369
514 Ga0070709_10053265
515 Ga0070714_100003326
516 Ga0070714_100032275
517 Ga0070714_100034287
518 Ga0070714_100045934
519 Ga0070714_100047307
520 Ga0070714_100270238
521 Ga0070714_100292016
522 Ga0070714_100325702
523 Ga0070714_100331344
524 Ga0070713_100031847
525 Ga0070713_100055000
526 Ga0070713_100089728
527 Ga0070713_100353167
528 Ga0070710_10000059
529 Ga0070710_10006001
530 Ga0070710_10203758
531 Ga0070711_100003455
532 Ga0070711_100136182
533 Ga0070705_100121378
534 Ga0070708_100002865
535 Ga0070708_100004941
536 Ga0070708_100008847
537 Ga0070708_100073879
538 Ga0070706_100003387
539 Ga0070706_100057626
540 Ga0070706_100069585
541 Ga0070707_100004586
542 Ga0070707_100008081
543 Ga0070698_100054158
544 Ga0070698_100376827
545 Ga0070699_100140680
546 Ga0070699_100321542
547 Ga0070699_100681395
548 Ga0070697_100052653
549 Ga0070697_100251453
550 Ga0070695_100565009
551 Ga0070704_100040662
552 Ga0068855_100224079
553 Ga0068855_100666346
554 Ga0068856_100208249
555 Ga0068864_100348775
556 Ga0068860_100319907
557 Ga0081539_10006973
558 Ga0081539_10011109
559 Ga0070717_10032164
560 Ga0070715_10031198
561 Ga0070715_10226940
562 Ga0070712_100004236
563 Ga0097621_100133896
564 Ga0068871_100301904
565 Ga0075428_100029830
566 Ga0075428_100168344
567 Ga0075428_100201777
568 Ga0075428_100412778
569 Ga0075430_100067786
570 Ga0075430_100099016
571 Ga0075430_100187929
572 Ga0075430_100281164
573 Ga0075431_100173888
574 Ga0075431_100180590
575 Ga0075434_100044456
576 Ga0075434_100144822
577 Ga0075434_100233996
578 Ga0075429_100271425
579 Ga0075429_100611664
580 Ga0075436_100028467
581 Ga0075436_100150854
582 Ga0075435_100008937
583 Ga0075435_100016529
584 Ga0075435_100110890
585 Ga0075435_100140685
586 Ga0105245_10158729
587 Ga0114129_10122164
588 Ga0114129_10125661
589 Ga0114129_10223373
590 Ga0114129_10356084
591 Ga0105243_10135761
592 Ga0105241_10184855
593 Ga0105242_10187633
594 Ga0105249_10652419
595 Ga0157380_10384341
596 Ga0157380_10764263
597 Ga0213873_10006533
598 Ga0207692_10000355
599 Ga0207692_10009108
600 Ga0207685_10000891
601 Ga0207699_10001308
602 Ga0207699_10018968
603 Ga0207699_10095697
604 Ga0207684_10000595
605 Ga0207684_10062884
606 Ga0207684_10109402
607 Ga0207693_10005082
608 Ga0207693_10118252
609 Ga0207663_10002544
610 Ga0207660_10408896
611 Ga0207646_10128906
612 Ga0207646_10293653
613 Ga0207646_10346473
614 Ga0207681_10315187
615 Ga0207650_10252905
616 Ga0207659_10227429
617 Ga0207700_10014108
618 Ga0207700_10044515
619 Ga0207700_10120910
620 Ga0207700_10251769
621 Ga0207664_10003823
622 Ga0207664_10008460
623 Ga0207664_10010266
624 Ga0207664_10031104
625 Ga0207664_10099992
626 Ga0207664_10234587
627 Ga0207706_10137930
628 Ga0207686_10149864
629 Ga0207686_10324755
630 Ga0207665_10011211
631 Ga0207665_10050212
632 Ga0207689_10209092
633 Ga0207668_10250303
634 Ga0207658_10110289
635 Ga0207658_10292342
636 Ga0207702_10230798
637 Ga0207676_10231616
638 Ga0207683_10025641
639 Ga0268264_10452014
640 Ga0316177_1152447
641 Ga0314311_1076134
642 Ga0265331_10058220
643 Ga0265327_10000112
644 Ga0265327_10002803
645 Ga0307513_10296928
646 Ga0307509_10334124
647 Ga0307509_10381243
648 Ga0307408_100196104
649 Ga0316576_10009916
650 Ga0316576_10112800
651 Ga0316578_10001648
652 Ga0316578_10039331
653 Ga0316577_10039166
654 Ga0316577_10087102
655 Ga0307413_10254043
656 Ga0307518_10093899
657 Ga0307410_10042188
658 Ga0307407_10087456
659 Ga0307407_10270324
660 Ga0307409_100155384
661 Ga0307409_100180450
662 Ga0307409_100312705
663 Ga0307409_100810590
664 Ga0307416_100058678
665 Ga0307416_100061201
666 Ga0307416_100128139
667 Ga0307416_100165679
668 Ga0307416_100198550
669 Ga0307416_100619114
670 Ga0307416_100995597
671 Ga0307411_10006515
672 Ga0307415_100030714
673 Ga0307415_100052085
674 Ga0307415_100151715
675 Ga0373930_0045851
676 Ga0373948_0005406
677 Ga0373958_0003724
678 Ga0373959_0010688
679 Ga0373938_0002404
680 Ga0373926_0000284
681 Ga0373929_0000996
682 Ga0373934_0020401
683 Ga0373940_0001578
684 Ga0373944_0004557
685 Ga0373944_0020837
686 Ga0373951_0026068
687 Ga0373923_0005696
688 Ga0373932_0096963
689 Ga0373936_0000752
690 Ga0373941_0040480
691 Ga0373945_0003607
692 Ga0373953_0005538
693 Ga0373953_0065223
694 Ga0373956_0010301
695 Ga0373956_0011470
696 Ga0373956_0038461
697 Ga0373956_0072966
698 Ga0373957_0046526
699 Ga0373957_0095452
700 Ga0373960_0004053
701 Ga0373943_0010822
702 Ga0373943_0061521
703 Ga0373943_0165484
704 Ga0373946_0087573
705 Ga0373946_0174414
706 Ga0373955_0015697
707 Ga0373955_0021126
708 Ga0373955_0111416
709 Ga0373955_0148683
710 Ga0373942_0047759
711 Ga0373962_0052580
712 Ga0316574_0014651
713 Ga0373924_0017476
714 Ga0373935_0008942
715 Ga0373935_0023800
716 Ga0373935_0047757
717 Ga0373935_0124391
718 Ga0373935_0130430
719 Ga0373927_0029474
720 Ga0373927_0098273
721 Ga0373933_0019371
722 Ga0373933_0021702
723 Ga0373933_0025258
724 Ga0373933_0137828
725 Ga0373933_0321532
726 Ga0373947_0004206
727 Ga0373947_0043169
728 Ga0373947_0086998
729 Ga0373947_0103452
730 Ga0373937_0002287
731 Ga0373937_0129758
732 Ga0373937_0140584
733 Ga0373937_0177507
734 Ga0373937_0339024
735 Ga0316582_0301614
736 Ga0316584_0021870
737 Ga0316584_0281353
738 Ga0316584_0339713
739 Ga0373925_0009312
740 Ga0373925_0012749
741 Ga0373925_0102651
742 Ga0373925_0119787
743 Ga0373925_0172420
744 Ga0373925_0314788
745 Ga0373925_0414867
746 Ga0373925_0481878
747 Ga0395900_0129837
748 Ga0395900_0159165
749 Ga0395898_0055953
750 Ga0395905_0044965
751 Ga0395905_0121451
752 Ga0395901_0078609
753 Ga0395901_0101639
754 Ga0395901_0626493
755 Ga0436365_0631784
756 Ga0436365_0804071
757 Ga0436360_0363695
758 Ga0436362_0151281
759 Ga0436362_0957802
760 Ga0439438_026783
761 Ga0439431_0007166
762 Ga0439457_033263
763 Ga0450923_030902
764 Ga0439434_0014740
765 Ga0450918_016032
766 Ga0466969_0110875
767 Ga0466969_0112032
768 Ga0466972_0004587
769 Ga0466972_0011312
770 Ga0466965_0006807
771 Ga0466965_0009399
772 Ga0466965_0047809
773 Ga0466966_0104224
774 Ga0466961_0000884
775 Ga0466961_0032536
776 Ga0466963_0220130
777 Ga0466963_0237236
778 Ga0466971_0029230
779 Ga0466971_0082741
780 Ga0466970_0039246
781 Ga0466970_0065478
782 Ga0466960_0022949
783 Ga0466959_0031622
784 Ga0466967_0006001
785 Ga0495592_0021922
786 Ga0495629_0034448
787 Ga0495629_0184340
788 Ga0495641_0005300
789 Ga0495641_0009908
790 Ga0495641_0053923
791 Ga0495651_0007042
792 Ga0495651_0007768
793 Ga0495651_0036281
794 Ga0495651_0059708
795 Ga0495651_0250888
796 Ga0495653_0006944
797 Ga0495653_0007686
798 Ga0495653_0014361
799 Ga0495653_0053787
800 Ga0495653_0226209
801 Ga0495582_0009117
802 Ga0495582_0013354
803 Ga0495639_0008123
804 Ga0495662_0003902
805 Ga0495662_0012357
806 Ga0495664_0009549
807 Ga0495664_0038379
808 Ga0495664_0088341
809 Ga0495607_0013909
810 Ga0495608_0023488
811 Ga0495608_0093326
812 Ga0495608_0216672
813 Ga0495618_0024264
814 Ga0495618_0028254
815 Ga0495618_0059438
816 Ga0495628_0104197
817 Ga0495630_0040792
818 Ga0495630_0064338
819 Ga0495630_0097838
820 Ga0495666_0043621
821 Ga0495652_0012767
822 Ga0495652_0020803
823 Ga0495652_0491121
824 Ga0495665_0031454
825 Ga0495665_0059759
826 Ga0495640_0010682
827 Ga0495640_0055322
828 Ga0495586_0022745
829 Ga0495587_0011953
830 Ga0495587_0025122
831 Ga0495587_0051054
832 Ga0495587_0167563
833 Ga0495645_0023491
834 Ga0495645_0061580
835 Ga0495667_0002178
836 Ga0495667_0004159
837 Ga0495667_0107949
838 Ga0495667_0154199
839 Ga0495656_0222769
840 Ga0495634_0009961
841 Ga0495635_0000547
842 Ga0495635_0006343
843 Ga0495635_0037906
844 Ga0495635_0043631
845 Ga0495635_0384876
846 Ga0495657_0002561
847 Ga0495657_0011579
848 Ga0495657_0026008
849 Ga0495657_0075711
850 Ga0495599_0033755
851 Ga0495599_0035123
852 Ga0495599_0044901
853 Ga0495599_0095829
854 Ga0495599_0102941
855 Ga0495599_0337816
856 Ga0495623_0018818
857 Ga0495623_0019197
858 Ga0495623_0108948
859 Ga0495623_0132190
860 Ga0495658_0013881
861 Ga0495613_0027219
862 Ga0495624_0030768
863 Ga0495624_0038283
864 Ga0495624_0055055
865 Ga0495624_0080653
866 Ga0495649_0084578
867 Ga0495600_0001417
868 Ga0495600_0008094
869 Ga0495600_0033352
870 Ga0495600_0086786
871 Ga0495581_0004912
872 Ga0495581_0030538
873 Ga0495581_0033064
874 Ga0495604_0004447
875 Ga0495604_0015427
876 Ga0495604_0076950
877 Ga0495604_0082966
878 Ga0495674_0003706
879 Ga0495674_0173059
880 Ga0495674_0177721
881 Ga0495674_0182418
882 Ga0495674_0214804
883 Ga0495672_0100959
884 Ga0495676_0001921
885 Ga0495680_0016977
886 Ga0495680_0017291
887 Ga0495680_0020277
888 Ga0495680_0050079
889 Ga0495680_0159701
890 Ga0495683_0001450
891 Ga0495675_0115911
892 Ga0495684_0013782
893 Ga0495684_0023698
894 Ga0495684_0093550
895 Ga0495684_0095926
896 Ga0495593_0022065
897 Ga0495593_0025321
898 Ga0495602_0006694
899 Ga0495602_0038825
900 Ga0495602_0045487
901 Ga0495602_0071263
902 Ga0495602_0213383
903 Ga0495602_0217128
904 Ga0495602_0367139
905 Ga0495614_0012775
906 Ga0495614_0066366
907 Ga0495614_0110145
908 Ga0496101_0036607
909 Ga0496102_0425195
910 Ga0496104_0502366
911 Ga0496105_0158162
912 Ga0496106_0098411
913 Ga0496106_0583793
914 Ga0496107_0164195
915 Ga0496108_0012263
916 Ga0496108_0073769
917 Ga0496109_0202190
918 Ga0496109_0713046
919 Ga0496112_0050646
920 Ga0496112_0583652
921 Ga0496114_0146162
922 Ga0496115_0070506
923 Ga0496126_0000040
924 Ga0496126_0409749
925 Ga0501032_0112062
926 Ga0501034_0001234
927 Ga0501034_0013341
928 Ga0501034_0466902
929 Ga0501036_0005115
930 Ga0501037_0014453
931 Ga0501038_0100781
932 Ga0501039_0007081
933 Ga0501040_0052142
934 Ga0501040_0407038
935 Ga0501042_0072659
936 Ga0501046_0076095
937 Ga0501047_0029936
938 Ga0501067_0011028
939 Ga0501068_0006748
940 Ga0501068_0098886
941 Ga0501069_0002148
942 Ga0501070_0001421
943 Ga0501071_0047778
944 Ga0501071_0057241
945 Ga0501072_0018960
946 Ga0501073_0003616
947 Ga0501073_0014500
948 Ga0501073_0173825
949 Ga0501074_0008645
950 Ga0501074_0053696
951 Ga0501075_0462799
952 Ga0501077_0084701
953 Ga0501079_0060786
954 Ga0501080_0014249
955 Ga0501080_0033055
956 Ga0501083_0004698
957 Ga0501083_0016097
958 Ga0501083_0091953
959 Ga0501083_0419578
960 Ga0501045_0322383
961 nmdc:mga07m45_167465_c1
962 nmdc:mga05p37_209171_c1
963 nmdc:mga05p37_380968_c1
964 nmdc:mga09592_15364_c1
965 nmdc:mga09592_287534_c1
966 nmdc:mga0qj67_100938_c1
967 nmdc:mga06r32_185118_c1
968 nmdc:mga06r32_311373_c1
969 nmdc:mga06r32_469504_c1
970 nmdc:mga06r32_820957_c1
971 nmdc:mga0n895_101935_c1
972 nmdc:mga0n895_228844_c1
973 nmdc:mga0n895_93941_c1
974 nmdc:mga0rr50_119195_c1
975 nmdc:mga0rr50_38507_c1
976 nmdc:mga0rr50_89414_c1
977 nmdc:mga08x19_158856_c1
978 nmdc:mga08x19_208176_c1
979 nmdc:mga0a205_4150_c1
980 Ga0495601_0085619
981 Ga0495601_0306270
982 Ga0495612_0050181
983 Ga0495612_0065694
984 Ga0495595_0003644
985 Ga0495595_0128305
986 Ga0495619_0031065
987 Ga0495619_0063225
988 Ga0495619_0142914
989 Ga0500595_031520
990 Ga0500564_072366
991 Ga0500573_0013978
992 Ga0500616_0010607
993 Ga0501084_0000834
994 Ga0501084_0079449
995 Ga0501082_0088421
996 Ga0466962_0008381
997 Ga0530510_0014519
998 Ga0530510_0018320
999 2548692669
1000 2559432329
1001 2644512338
1002 2791913505
1003 2870787850
1004 2899363961
1005 2899371800
1006 2919718101
1007 3003000644
1008 8055071999

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

7

131

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

139

271

0.95

PF00106

adh_short

short chain dehydrogenase

151

223

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

8

147

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aus-assembly1.cif.gz_A crystal structure of bacillus megaterium glucose dehydrogenase 4 in ligand-free form 0.9607 11 234
3ay6-assembly1.cif.gz_C crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose 0.9601 11 234
1gee-assembly1.cif.gz_A crystal structure of glucose dehydrogenase mutant q252l complexed with nad+ 0.9581 8 234
1rwb-assembly1.cif.gz_A cooperative effect of two surface amino acid mutations (q252l and e170k) of glucose dehydrogenase from bacillus megaterium iwg3 for the stabilization of oligomeric state 0.9578 8 234
7do5-assembly2.cif.gz_G crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase(apo-form) 0.9484 11 235
ID Description Score Start End Superfamily
af_P9WGQ5_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9784 1 238 3.40.50.720
3ay6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9515 11 239 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9381 2 234 3.40.50.720
1vl8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.938 6 234 3.40.50.720
3rihC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.937 6 234 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A820DJ99-F1-model_v4 SDR family oxidoreductase 0.9725 123 234 GO:0016616
AF-A0A7Y5MR30-F1-model_v4 SDR family oxidoreductase 0.9677 122 234 GO:0016491
AF-R1DG55-F1-model_v4 Uncharacterized protein 0.9665 72 234 GO:0016491
AF-A0A514LIH0-F1-model_v4 2,4-dienoyl-CoA reductase (EC 1.3.1.34) 0.9653 21 234 GO:0005777
GO:0008670
GO:0009062
AF-A0A3B9B294-F1-model_v4 deleted 0.9652 124 234

Map