F456147

General Info

Members Datasets Scaffolds Average Seq Length
504 288 1008 159

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_101189505|Ga0070706_1011895051
Length 184
Sequence VTRCTTGFRATGSDLARPRFGTNRKNDMQKITPFLWFNGKAEEAANFYTSIFKNSKILNIARYGEAGPGPKGTVMVATFQIEGQKFMALNGGPQYTFSPAISFYVDCETQAEVDELWEKLSAGGSEVQCGWLRDKFGVSWQIIPKTLIELMQDKDPVKSQRVFKAMMGMIKIDIEALRRAYRGE

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
94 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
152 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
177 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
193 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
194 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
201 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
262 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
274 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
277 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
278 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
279 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
283 2857472729 Cohnella sp. R-74144 Isolate Unclassified
284 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
285 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
286 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
287 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
288 8054795415 Paenibacillus periandrae PM10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.61
Metatranscriptomes 0.2
Isolates 1.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.96
Nodule 0.2
Rhizoplane 0.99
Rhizosphere 92.66
Stem 0
Stem Tuber 0
Unclassified 6.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_101189505 3300005467 Bacteria 701
2 SwRhRL2b_contig_1076093 2162886007 Bacteria 11043
3 JGI24735J21928_10034918 3300002067 Bacteria 1481
4 JGI25162J39368_1000091 3300002737 Bacteria 101521
5 JGI25165J46597_1000172 3300003214 Bacteria 101521
6 Ga0055538_1000063 3300003751 Bacteria 101521
7 Ga0055539_1000096 3300003752 Bacteria 101521
8 Ga0055533_1000107 3300003756 Bacteria 101521
9 Ga0055525_1000140 3300003759 Bacteria 101521
10 Ga0055541_1000064 3300003841 Bacteria 101521
11 Ga0065714_10003796 3300005288 Bacteria 20147
12 Ga0065714_10064959 3300005288 Bacteria 14887
13 Ga0065714_10102297 3300005288 Bacteria 1626
14 Ga0065704_10070204 3300005289 Bacteria 85748
15 Ga0065704_10425804 3300005289 Bacteria 719
16 Ga0065715_10042533 3300005293 Bacteria 1753
17 Ga0065707_10023534 3300005295 Bacteria 1846
18 Ga0065707_10108041 3300005295 Bacteria 2527
19 Ga0068869_100306587 3300005334 Bacteria 1284
20 Ga0070680_100064264 3300005336 Bacteria 3007
21 Ga0070692_10235235 3300005345 Bacteria 1089
22 Ga0070668_100352428 3300005347 Bacteria 1246
23 Ga0070675_100176390 3300005354 Bacteria 1846
24 Ga0070675_100236627 3300005354 Bacteria 1595
25 Ga0070671_100585077 3300005355 Bacteria 964
26 Ga0070671_101678582 3300005355 Bacteria 564
27 Ga0070674_100970213 3300005356 Bacteria 744
28 Ga0070673_100479252 3300005364 Bacteria 1123
29 Ga0070673_100510455 3300005364 Bacteria 1088
30 Ga0070673_102149529 3300005364 Unclassified 530
31 Ga0070703_10455437 3300005406 Bacteria 567
32 Ga0070714_100114091 3300005435 Bacteria 2396
33 Ga0070714_100283025 3300005435 Bacteria 1541
34 Ga0070713_100092710 3300005436 Bacteria 2601
35 Ga0070710_10279421 3300005437 Bacteria 1083
36 Ga0070711_100020515 3300005439 Bacteria 4260
37 Ga0070711_100518417 3300005439 Bacteria 985
38 Ga0070705_100519062 3300005440 Bacteria 908
39 Ga0070694_100547988 3300005444 Bacteria 926
40 Ga0070694_100643524 3300005444 Bacteria 857
41 Ga0070694_101156342 3300005444 Bacteria 647
42 Ga0070708_100021049 3300005445 Bacteria 5507
43 Ga0070708_100026406 3300005445 Bacteria 4971
44 Ga0070708_100250830 3300005445 Bacteria 1663
45 Ga0070708_100277900 3300005445 Bacteria 1576
46 Ga0070708_100457586 3300005445 Bacteria 1204
47 Ga0070708_101633258 3300005445 Unclassified 600
48 Ga0070708_101663009 3300005445 Unclassified 594
49 Ga0070663_100615438 3300005455 Bacteria 915
50 Ga0070681_10122890 3300005458 Bacteria 2529
51 Ga0068867_101617856 3300005459 Bacteria 606
52 Ga0070707_100000180 3300005468 Bacteria 62083
53 Ga0070707_100035574 3300005468 Bacteria 4751
54 Ga0070707_100062148 3300005468 Bacteria 3583
55 Ga0070707_100338024 3300005468 Bacteria 1463
56 Ga0070698_100046196 3300005471 Bacteria 4453
57 Ga0070698_100125729 3300005471 Bacteria 2521
58 Ga0070698_100355632 3300005471 Bacteria 1396
59 Ga0070698_100460703 3300005471 Unclassified 1207
60 Ga0070698_100676366 3300005471 Bacteria 974
61 Ga0070699_100191657 3300005518 Bacteria 1816
62 Ga0070679_100408827 3300005530 Bacteria 1303
63 Ga0070679_101259550 3300005530 Bacteria 685
64 Ga0070697_100000005 3300005536 Bacteria 259746
65 Ga0070697_100022453 3300005536 Bacteria 5008
66 Ga0070697_100048365 3300005536 Bacteria 3448
67 Ga0070697_100384582 3300005536 Bacteria 1216
68 Ga0070697_100538900 3300005536 Bacteria 1023
69 Ga0070697_100653247 3300005536 Bacteria 926
70 Ga0070672_100074170 3300005543 Bacteria 2714
71 Ga0070695_100079216 3300005545 Bacteria 2168
72 Ga0070695_100407967 3300005545 Bacteria 1032
73 Ga0070695_100451053 3300005545 Bacteria 985
74 Ga0070695_101110141 3300005545 Bacteria 647
75 Ga0070696_100044931 3300005546 Bacteria 3059
76 Ga0070696_100191427 3300005546 Unclassified 1523
77 Ga0070693_100496091 3300005547 Unclassified 865
78 Ga0070704_100018840 3300005549 Bacteria 4424
79 Ga0070664_100327440 3300005564 Bacteria 1389
80 Ga0068857_100011737 3300005577 Bacteria 7617
81 Ga0068857_100138578 3300005577 Bacteria 2198
82 Ga0068857_101952901 3300005577 Unclassified 575
83 Ga0068852_102169014 3300005616 Bacteria 577
84 Ga0068859_100515553 3300005617 Bacteria 1291
85 Ga0068859_101526519 3300005617 Bacteria 737
86 Ga0068864_100097619 3300005618 Bacteria 2601
87 Ga0068864_100904254 3300005618 Bacteria 872
88 Ga0068864_101556041 3300005618 Bacteria 665
89 Ga0068861_100369342 3300005719 Bacteria 1264
90 Ga0068870_10086662 3300005840 Archaea 1742
91 Ga0068863_100288829 3300005841 Archaea 1590
92 Ga0068862_100483026 3300005844 Bacteria 1173
93 Ga0068862_100613639 3300005844 Unclassified 1046
94 Ga0081540_1100041 3300005983 Bacteria 1251
95 Ga0081539_10000537 3300005985 Bacteria 78553
96 Ga0070717_10061488 3300006028 Bacteria 3112
97 Ga0070717_10097175 3300006028 Bacteria 2495
98 Ga0075363_100128124 3300006048 Bacteria 1422
99 Ga0070716_100172492 3300006173 Bacteria 1413
100 Ga0070712_100120754 3300006175 Bacteria 1971
101 Ga0070712_100519776 3300006175 Bacteria 1000
102 Ga0070712_100565908 3300006175 Bacteria 959
103 Ga0070712_101029278 3300006175 Bacteria 713
104 Ga0075362_10009309 3300006177 Bacteria 3794
105 Ga0075428_100000473 3300006844 Bacteria 40394
106 Ga0075428_100002493 3300006844 Bacteria 19979
107 Ga0075428_100014976 3300006844 Bacteria 8620
108 Ga0075428_100036926 3300006844 Bacteria 5380
109 Ga0075428_100054851 3300006844 Bacteria 4367
110 Ga0075428_100628910 3300006844 Bacteria 1145
111 Ga0075430_100073884 3300006846 Bacteria 2858
112 Ga0075430_100168329 3300006846 Bacteria 1823
113 Ga0075431_100369732 3300006847 Unclassified 1439
114 Ga0075433_10009221 3300006852 Bacteria 7887
115 Ga0075433_10288698 3300006852 Bacteria 1453
116 Ga0075434_100037528 3300006871 Bacteria 4797
117 Ga0075429_100118791 3300006880 Bacteria 2310
118 Ga0075429_100894791 3300006880 Bacteria 777
119 Ga0075436_100150731 3300006914 Bacteria 1636
120 Ga0097620_100515584 3300006931 Bacteria 1291
121 Ga0097620_101526226 3300006931 Bacteria 737
122 Ga0075435_100017523 3300007076 Bacteria 5425
123 Ga0099794_10030822 3300007265 Bacteria 2506
124 Ga0099794_10043592 3300007265 Bacteria 2142
125 Ga0099794_10140349 3300007265 Bacteria 1223
126 Ga0099794_10171024 3300007265 Unclassified 1107
127 Ga0105240_10064633 3300009093 Bacteria 4546
128 Ga0111539_10121713 3300009094 Bacteria 3057
129 Ga0111539_12245647 3300009094 Bacteria 633
130 Ga0105245_10111288 3300009098 Bacteria 2546
131 Ga0105245_10799325 3300009098 Bacteria 981
132 Ga0105245_11771878 3300009098 Bacteria 670
133 Ga0105247_10444596 3300009101 Bacteria 933
134 Ga0114129_10173698 3300009147 Bacteria 2936
135 Ga0114129_10293173 3300009147 Bacteria 2170
136 Ga0114129_11460666 3300009147 Bacteria 842
137 Ga0105243_10152002 3300009148 Bacteria 1987
138 Ga0105243_11275342 3300009148 Unclassified 751
139 Ga0105242_10301814 3300009176 Bacteria 1462
140 Ga0105248_10513874 3300009177 Bacteria 1351
141 Ga0105248_11183718 3300009177 Bacteria 864
142 Ga0105249_10283864 3300009553 Bacteria 1654
143 Ga0105246_11568988 3300011119 Bacteria 621
144 Ga0157373_10000290 3300013100 Bacteria 40415
145 Ga0157371_10000438 3300013102 Bacteria 51021
146 Ga0157371_10524551 3300013102 Bacteria 876
147 Ga0157370_10062920 3300013104 Bacteria 3517
148 Ga0157374_10014842 3300013296 Bacteria 6825
149 Ga0157378_10003951 3300013297 Bacteria 13100
150 Ga0163162_10198842 3300013306 Bacteria 2133
151 Ga0163162_11748735 3300013306 Bacteria 710
152 Ga0163163_10015400 3300014325 Bacteria 7069
153 Ga0157380_10535743 3300014326 Bacteria 1145
154 Ga0182008_10013648 3300014497 Bacteria 4268
155 Ga0157377_10109281 3300014745 Unclassified 1660
156 Ga0182006_1003490 3300015261 Bacteria 8025
157 Ga0213873_10164467 3300021358 Unclassified 674
158 Ga0213875_10088762 3300021388 Bacteria 1442
159 Ga0228598_1003365 3300024227 Bacteria 3442
160 Ga0228598_1004249 3300024227 Bacteria 3035
161 Ga0209760_102118 3300025207 Bacteria 1904
162 Ga0209784_100079 3300025224 Bacteria 136351
163 Ga0209566_100093 3300025225 Bacteria 136351
164 Ga0209674_100115 3300025226 Bacteria 136351
165 Ga0209563_100113 3300025230 Bacteria 136351
166 Ga0207427_100588 3300025231 Bacteria 18279
167 Ga0209437_100176 3300025233 Bacteria 136351
168 Ga0209677_100072 3300025253 Bacteria 136351
169 Ga0209233_1000183 3300025261 Bacteria 136351
170 Ga0209025_1110993 3300025294 Bacteria 843
171 Ga0207653_10000414 3300025885 Bacteria 18144
172 Ga0207692_10508166 3300025898 Bacteria 765
173 Ga0207647_10416485 3300025904 Bacteria 756
174 Ga0207699_10008521 3300025906 Bacteria 5067
175 Ga0207684_10148644 3300025910 Bacteria 2015
176 Ga0207707_10319672 3300025912 Bacteria 1340
177 Ga0207695_10082582 3300025913 Bacteria 3247
178 Ga0207693_10123712 3300025915 Bacteria 2032
179 Ga0207693_10503291 3300025915 Bacteria 946
180 Ga0207660_10133770 3300025917 Archaea 1890
181 Ga0207652_11009594 3300025921 Bacteria 731
182 Ga0207646_10000059 3300025922 Bacteria 154875
183 Ga0207646_10202355 3300025922 Unclassified 1794
184 Ga0207646_10457038 3300025922 Bacteria 1152
185 Ga0207650_10837209 3300025925 Bacteria 780
186 Ga0207659_10130492 3300025926 Bacteria 1939
187 Ga0207659_10168689 3300025926 Bacteria 1725
188 Ga0207700_10258515 3300025928 Bacteria 1490
189 Ga0207700_11281460 3300025928 Bacteria 653
190 Ga0207664_10463908 3300025929 Bacteria 1131
191 Ga0207709_10107514 3300025935 Bacteria 1858
192 Ga0207669_11354464 3300025937 Bacteria 605
193 Ga0207665_10080971 3300025939 Bacteria 2234
194 Ga0207665_10093590 3300025939 Bacteria 2087
195 Ga0207665_10110098 3300025939 Bacteria 1934
196 Ga0207665_10144682 3300025939 Bacteria 1698
197 Ga0207679_10162464 3300025945 Bacteria 1830
198 Ga0207651_10437632 3300025960 Bacteria 1119
199 Ga0207668_10576454 3300025972 Bacteria 978
200 Ga0207640_10169489 3300025981 Bacteria 1625
201 Ga0207658_10330195 3300025986 Bacteria 1323
202 Ga0207708_10217882 3300026075 Unclassified 1528
203 Ga0207708_10618564 3300026075 Bacteria 919
204 Ga0207708_11484020 3300026075 Bacteria 596
205 Ga0207641_10340253 3300026088 Bacteria 1428
206 Ga0207641_10588932 3300026088 Unclassified 1088
207 Ga0207676_10119873 3300026095 Bacteria 2216
208 Ga0207676_10855061 3300026095 Bacteria 890
209 Ga0207674_10018708 3300026116 Bacteria 7521
210 Ga0207674_10274089 3300026116 Bacteria 1635
211 Ga0207675_100071191 3300026118 Bacteria 3250
212 Ga0207698_11914202 3300026142 Bacteria 608
213 Ga0209588_1007319 3300027671 Bacteria 3241
214 Ga0209588_1027800 3300027671 Unclassified 1800
215 Ga0209588_1121424 3300027671 Bacteria 836
216 Ga0207428_10366089 3300027907 Archaea 1059
217 Ga0265319_1001080 3300028563 Bacteria 16943
218 Ga0265319_1172589 3300028563 Bacteria 667
219 Ga0265318_10030776 3300028577 Bacteria 2086
220 Ga0265338_10149228 3300028800 Bacteria 1819
221 Ga0265760_10020749 3300031090 Bacteria 1898
222 Ga0265330_10002532 3300031235 Bacteria 9928
223 Ga0265320_10001615 3300031240 Bacteria 16146
224 Ga0265340_10009210 3300031247 Bacteria 5306
225 Ga0265340_10038002 3300031247 Bacteria 2383
226 Ga0265339_10076050 3300031249 Bacteria 1781
227 Ga0265316_10000552 3300031344 Bacteria 42074
228 Ga0265316_10020207 3300031344 Bacteria 5675
229 Ga0265314_10001011 3300031711 Bacteria 32906
230 Ga0265314_10028074 3300031711 Bacteria 4201
231 Ga0265314_10118474 3300031711 Bacteria 1671
232 Ga0265314_10617914 3300031711 Bacteria 556
233 Ga0265342_10525742 3300031712 Bacteria 602
234 Ga0307410_11089508 3300031852 Bacteria 692
235 Ga0307406_10083718 3300031901 Bacteria 2128
236 Ga0307412_10000023 3300031911 Bacteria 237005
237 Ga0307412_10246938 3300031911 Bacteria 1384
238 Ga0307414_10010177 3300032004 Bacteria 5443
239 Ga0307415_101135935 3300032126 Bacteria 733
240 Ga0316214_1047812 3300033545 Bacteria 618
241 Ga0373950_0010558 3300034818 Bacteria 1494
242 Ga0373934_0048450 3300035086 Bacteria 1682
243 Ga0373951_0156419 3300035091 Bacteria 642
244 Ga0373923_0012262 3300035111 Bacteria 3163
245 Ga0373939_0006323 3300035114 Bacteria 2851
246 Ga0373954_0054550 3300035118 Bacteria 1880
247 Ga0373954_0130625 3300035118 Unclassified 1222
248 Ga0373954_0147851 3300035118 Bacteria 1147
249 Ga0373956_0078891 3300035119 Bacteria 1509
250 Ga0373960_0031418 3300035121 Bacteria 1485
251 Ga0373946_0544456 3300035171 Unclassified 598
252 Ga0373955_0121762 3300035172 Bacteria 1517
253 Ga0373961_0003721 3300035241 Bacteria 3730
254 Ga0373931_0016034 3300035691 Bacteria 3683
255 Ga0373935_0099655 3300035692 Bacteria 1913
256 Ga0373935_1436786 3300035692 Bacteria 516
257 Ga0373927_0236432 3300035695 Unclassified 1200
258 Ga0373927_0445859 3300035695 Bacteria 855
259 Ga0373933_0014456 3300035724 Bacteria 4392
260 Ga0373933_0120810 3300035724 Bacteria 1641
261 Ga0373933_0859726 3300035724 Unclassified 597
262 Ga0373947_0019071 3300035725 Bacteria 3953
263 Ga0373937_0013061 3300036401 Bacteria 7315
264 Ga0373937_0203482 3300036401 Bacteria 1861
265 Ga0373937_1759268 3300036401 Bacteria 566
266 Ga0395900_0000092 3300037418 Bacteria 166966
267 Ga0395898_0062156 3300037466 Bacteria 3627
268 Ga0436365_0676843 3300039437 Bacteria 594
269 Ga0436360_0390745 3300039438 Bacteria 2056
270 Ga0436360_0402163 3300039438 Bacteria 1016
271 Ga0436360_0828304 3300039438 Bacteria 2823
272 Ga0436360_1371142 3300039438 Bacteria 1328
273 Ga0436361_0226691 3300039447 Unclassified 3430
274 Ga0436363_0346351 3300039450 Bacteria 3602
275 Ga0436362_0327735 3300039453 Bacteria 1039
276 Ga0436362_0471209 3300039453 Bacteria 827
277 Ga0436362_0741091 3300039453 Unclassified 1117
278 Ga0436362_1265168 3300039453 Bacteria 517
279 Ga0439438_132388 3300041405 Bacteria 598
280 Ga0439446_0208453 3300042156 Bacteria 662
281 Ga0451577_0698003 3300042876 Unclassified 919
282 Ga0466972_0387886 3300044658 Bacteria 654
283 Ga0453683_0864481 3300044673 Bacteria 597
284 Ga0466965_0041071 3300044683 Bacteria 2278
285 Ga0453684_0366180 3300044712 Bacteria 1622
286 Ga0466957_0181588 3300044842 Bacteria 1374
287 Ga0466960_0039662 3300044901 Bacteria 2222
288 Ga0451576_0536133 3300045051 Bacteria 1230
289 Ga0495592_0073078 3300046454 Bacteria 2494
290 Ga0495592_0094625 3300046454 Bacteria 2138
291 Ga0495592_0152299 3300046454 Bacteria 1598
292 Ga0495638_0317948 3300046460 Bacteria 833
293 Ga0495651_0000024 3300046462 Bacteria 113645
294 Ga0495651_0001072 3300046462 Bacteria 21066
295 Ga0495651_0038764 3300046462 Bacteria 3710
296 Ga0495651_0281769 3300046462 Bacteria 1122
297 Ga0495653_0002200 3300046463 Bacteria 15423
298 Ga0495653_0002698 3300046463 Bacteria 14142
299 Ga0495653_0161856 3300046463 Bacteria 1553
300 Ga0495580_0091042 3300046472 Bacteria 2123
301 Ga0495580_0126658 3300046472 Bacteria 1772
302 Ga0495580_0386363 3300046472 Bacteria 945
303 Ga0495580_0438206 3300046472 Bacteria 878
304 Ga0495580_0921654 3300046472 Unclassified 560
305 Ga0495664_0007459 3300046477 Bacteria 6073
306 Ga0495664_0035202 3300046477 Bacteria 2948
307 Ga0495664_0137609 3300046477 Bacteria 1480
308 Ga0495584_0000514 3300046491 Bacteria 26469
309 Ga0495585_0165841 3300046492 Bacteria 1144
310 Ga0495607_0185286 3300046501 Unclassified 1041
311 Ga0495608_0005341 3300046511 Bacteria 9181
312 Ga0495608_0031976 3300046511 Bacteria 3556
313 Ga0495608_0037775 3300046511 Bacteria 3246
314 Ga0495608_0203853 3300046511 Bacteria 1245
315 Ga0495616_0416865 3300046513 Bacteria 549
316 Ga0495618_0043950 3300046514 Bacteria 2818
317 Ga0495618_0114633 3300046514 Bacteria 1726
318 Ga0495628_0000440 3300046516 Bacteria 37864
319 Ga0495628_0001985 3300046516 Bacteria 18552
320 Ga0495628_0024095 3300046516 Bacteria 4985
321 Ga0495628_0037825 3300046516 Bacteria 3867
322 Ga0495628_0040671 3300046516 Bacteria 3713
323 Ga0495630_0004232 3300046517 Bacteria 10056
324 Ga0495630_0266545 3300046517 Bacteria 1308
325 Ga0495630_0356985 3300046517 Bacteria 1119
326 Ga0495630_0673388 3300046517 Bacteria 792
327 Ga0495644_0179386 3300046523 Unclassified 814
328 Ga0495666_0076979 3300046526 Bacteria 1581
329 Ga0495652_0002364 3300046529 Bacteria 19564
330 Ga0495652_0003314 3300046529 Bacteria 16013
331 Ga0495652_0007168 3300046529 Bacteria 10289
332 Ga0495652_0075012 3300046529 Bacteria 2811
333 Ga0495652_0150185 3300046529 Bacteria 1821
334 Ga0495665_0063684 3300046531 Bacteria 1946
335 Ga0495640_0302933 3300046533 Bacteria 992
336 Ga0495586_0001720 3300046535 Bacteria 11951
337 Ga0495586_0043773 3300046535 Bacteria 2411
338 Ga0495586_0266363 3300046535 Bacteria 979
339 Ga0495587_0004083 3300046536 Bacteria 9666
340 Ga0495645_0006667 3300046543 Bacteria 8021
341 Ga0495645_0074970 3300046543 Bacteria 2435
342 Ga0495645_0161874 3300046543 Bacteria 1547
343 Ga0495645_0237340 3300046543 Unclassified 1218
344 Ga0495667_0007600 3300046559 Bacteria 7357
345 Ga0495667_0014149 3300046559 Bacteria 5386
346 Ga0495667_0218311 3300046559 Bacteria 1217
347 Ga0495667_0295003 3300046559 Bacteria 1028
348 Ga0495634_0044234 3300046642 Bacteria 3015
349 Ga0495634_0507790 3300046642 Bacteria 706
350 Ga0495635_0083230 3300046663 Bacteria 2190
351 Ga0495635_0301742 3300046663 Bacteria 1074
352 Ga0495657_0008797 3300046675 Bacteria 7692
353 Ga0495657_0333791 3300046675 Bacteria 899
354 Ga0495599_0000599 3300046678 Bacteria 20565
355 Ga0495623_0003511 3300046679 Bacteria 10376
356 Ga0495623_0032885 3300046679 Bacteria 3331
357 Ga0495623_0070397 3300046679 Bacteria 2179
358 Ga0495623_0184505 3300046679 Bacteria 1210
359 Ga0495646_0016002 3300046680 Bacteria 4760
360 Ga0495646_0050600 3300046680 Bacteria 2518
361 Ga0495646_0099679 3300046680 Bacteria 1667
362 Ga0495658_0254465 3300046683 Bacteria 1105
363 Ga0495613_0317170 3300046689 Bacteria 1076
364 Ga0495624_0001011 3300046690 Bacteria 22252
365 Ga0495624_0015875 3300046690 Bacteria 5072
366 Ga0495624_0268003 3300046690 Bacteria 1032
367 Ga0495624_0441819 3300046690 Bacteria 779
368 Ga0495670_0082114 3300046691 Bacteria 1643
369 Ga0495600_0001191 3300046809 Bacteria 14224
370 Ga0495600_0236988 3300046809 Bacteria 1163
371 Ga0495604_0002842 3300047317 Bacteria 13895
372 Ga0495604_0020297 3300047317 Bacteria 5310
373 Ga0495604_0020756 3300047317 Bacteria 5245
374 Ga0495604_0214311 3300047317 Bacteria 1329
375 Ga0495604_0536967 3300047317 Bacteria 755
376 Ga0495674_0002377 3300047319 Bacteria 18413
377 Ga0495674_0098688 3300047319 Bacteria 2487
378 Ga0495674_0123487 3300047319 Bacteria 2186
379 Ga0495674_0166887 3300047319 Bacteria 1839
380 Ga0495674_0742159 3300047319 Bacteria 767
381 Ga0495676_1040581 3300047321 Bacteria 522
382 Ga0495680_0000749 3300047322 Bacteria 36388
383 Ga0495680_0002400 3300047322 Bacteria 19224
384 Ga0495680_0022613 3300047322 Bacteria 5237
385 Ga0495680_0184289 3300047322 Bacteria 1505
386 Ga0495675_0000052 3300047444 Bacteria 79959
387 Ga0495675_0006137 3300047444 Bacteria 7360
388 Ga0495675_0008673 3300047444 Bacteria 6306
389 Ga0495675_0012773 3300047444 Bacteria 5289
390 Ga0495675_0274882 3300047444 Bacteria 1006
391 Ga0495684_0000552 3300047471 Bacteria 30354
392 Ga0495684_0007925 3300047471 Bacteria 8215
393 Ga0495684_0354820 3300047471 Bacteria 1040
394 Ga0495684_0589543 3300047471 Bacteria 751
395 Ga0495593_0070934 3300047673 Bacteria 1809
396 Ga0495593_0481510 3300047673 Bacteria 622
397 Ga0495602_0057258 3300048088 Bacteria 3420
398 Ga0495602_0125468 3300048088 Bacteria 2057
399 Ga0495602_0345393 3300048088 Bacteria 1075
400 Ga0495602_0465379 3300048088 Bacteria 890
401 Ga0495602_0493939 3300048088 Bacteria 857
402 Ga0495614_0009961 3300048089 Bacteria 4195
403 Ga0496109_0260685 3300048912 Bacteria 1633
404 Ga0496110_0002838 3300048913 Bacteria 13081
405 Ga0496110_0474358 3300048913 Bacteria 1140
406 Ga0496112_0368592 3300048915 Bacteria 1378
407 Ga0496115_0235880 3300048918 Bacteria 1508
408 Ga0501031_0035628 3300049568 Bacteria 3246
409 Ga0501031_0038437 3300049568 Bacteria 3123
410 Ga0501032_0101273 3300049569 Bacteria 1908
411 Ga0501032_0334591 3300049569 Bacteria 976
412 Ga0501033_0061105 3300049570 Bacteria 2777
413 Ga0501033_0207265 3300049570 Bacteria 1399
414 Ga0501033_0803781 3300049570 Bacteria 636
415 Ga0501036_0051644 3300049572 Bacteria 3481
416 Ga0501036_1037888 3300049572 Unclassified 670
417 Ga0501037_0069693 3300049573 Bacteria 2559
418 Ga0501038_0045147 3300049574 Bacteria 3826
419 Ga0501038_0069200 3300049574 Bacteria 2998
420 Ga0501039_0106236 3300049575 Bacteria 2193
421 Ga0501039_0599381 3300049575 Unclassified 863
422 Ga0501040_0009148 3300049576 Bacteria 6451
423 Ga0501040_0285029 3300049576 Bacteria 1180
424 Ga0501041_0032609 3300049577 Bacteria 3148
425 Ga0501042_0047030 3300049578 Bacteria 3076
426 Ga0501042_0137599 3300049578 Bacteria 1760
427 Ga0501042_0316593 3300049578 Bacteria 1127
428 Ga0501043_0021451 3300049579 Bacteria 5064
429 Ga0501043_0075928 3300049579 Bacteria 2640
430 Ga0501046_0205332 3300049580 Bacteria 1465
431 Ga0501069_0006872 3300049585 Bacteria 5951
432 Ga0501071_0178335 3300049587 Bacteria 1591
433 Ga0501071_0186920 3300049587 Bacteria 1553
434 Ga0501072_0038905 3300049588 Bacteria 3733
435 Ga0501073_0117794 3300049589 Bacteria 1840
436 Ga0501074_0015783 3300049590 Bacteria 5490
437 Ga0501075_0011388 3300049591 Bacteria 6295
438 Ga0501075_0421638 3300049591 Bacteria 1017
439 Ga0501076_0074285 3300049592 Bacteria 2723
440 Ga0501077_0035193 3300049593 Bacteria 3188
441 Ga0501077_0093619 3300049593 Bacteria 1904
442 Ga0501261_008752 3300049690 Bacteria 1311
443 Ga0501079_0146658 3300049741 Bacteria 1839
444 Ga0501079_0153067 3300049741 Bacteria 1797
445 Ga0501079_0591276 3300049741 Bacteria 873
446 Ga0501080_0026919 3300049742 Bacteria 5347
447 Ga0501080_0138942 3300049742 Bacteria 2247
448 Ga0501080_0272490 3300049742 Bacteria 1540
449 Ga0501083_0071568 3300049744 Bacteria 2305
450 Ga0501083_0600827 3300049744 Bacteria 716
451 Ga0501280_000043 3300049776 Bacteria 37252
452 Ga0501035_0104446 3300049822 Bacteria 2484
453 Ga0501044_0808761 3300049823 Bacteria 816
454 Ga0501045_0069240 3300049824 Bacteria 2593
455 Ga0501045_0159011 3300049824 Bacteria 1681
456 Ga0501045_0484746 3300049824 Bacteria 918
457 nmdc:mga03683_74782_c1 3300050489 Bacteria 1454
458 nmdc:mga03n38_95803_c1 3300050490 Bacteria 1422
459 nmdc:mga05p37_100422_c1 3300050507 Bacteria 3564
460 nmdc:mga05p37_362304_c1 3300050507 Bacteria 1704
461 nmdc:mga05p37_502565_c1 3300050507 Bacteria 1391
462 nmdc:mga09592_642191_c1 3300050508 Bacteria 907
463 nmdc:mga09592_8945_c1 3300050508 Bacteria 8142
464 nmdc:mga0qj67_151302_c1 3300050509 Bacteria 1883
465 nmdc:mga0qj67_67053_c1 3300050509 Bacteria 2859
466 nmdc:mga06r32_266814_c1 3300050510 Bacteria 1699
467 nmdc:mga06r32_453846_c1 3300050510 Unclassified 1261
468 nmdc:mga08y16_194281_c1 3300050511 Bacteria 2104
469 nmdc:mga08y16_206762_c1 3300050511 Unclassified 2033
470 nmdc:mga08y16_344281_c1 3300050511 Bacteria 1532
471 nmdc:mga0n895_16357_c1 3300050512 Bacteria 6802
472 nmdc:mga0n895_476348_c1 3300050512 Bacteria 1259
473 nmdc:mga0rr50_31965_c1 3300050513 Bacteria 3743
474 nmdc:mga08x19_25871_c1 3300050514 Bacteria 3660
475 nmdc:mga0a205_307381_c1 3300050515 Bacteria 1458
476 nmdc:mga0a205_8953_c1 3300050515 Bacteria 9124
477 Ga0495601_0001534 3300053077 Bacteria 12756
478 Ga0495601_0145113 3300053077 Bacteria 1549
479 Ga0495601_0153058 3300053077 Bacteria 1506
480 Ga0495601_0283431 3300053077 Bacteria 1080
481 Ga0495601_0502673 3300053077 Bacteria 782
482 Ga0495612_0024132 3300053078 Bacteria 2441
483 Ga0495612_0196516 3300053078 Bacteria 889
484 Ga0495655_0103157 3300053083 Bacteria 847
485 Ga0495619_0025034 3300053085 Bacteria 3829
486 Ga0495619_0077876 3300053085 Bacteria 2228
487 Ga0495619_0170524 3300053085 Bacteria 1505
488 Ga0500568_0074221 3300053139 Bacteria 1298
489 Ga0500573_0057090 3300053140 Bacteria 2241
490 Ga0500574_035283 3300053141 Bacteria 1369
491 Ga0500619_001300 3300053154 Bacteria 4378
492 Ga0501084_0145998 3300054114 Bacteria 1992
493 Ga0501082_0043176 3300060353 Bacteria 3887
494 Ga0501082_0366166 3300060353 Bacteria 1257
495 Ga0530510_0118727 3300061734 Bacteria 1941
496 Ga0530510_0223921 3300061734 Bacteria 1398
497 Ga0530510_0295568 3300061734 Unclassified 1211
498 Ga0530510_0778762 3300061734 Bacteria 730
499 2857478486 2857472729 Bacteria 6568124
500 2862512828 2862507626 Bacteria 9425308
501 2980178725 2980176882 Bacteria 5397533
502 8004024826 8004021418 Bacteria 4313954
503 8004027257 8004025490 Bacteria 4327753
504 8054797462 8054795415 Bacteria 9785225
505 Ga0070706_101189505
506 SwRhRL2b_contig_1076093
507 JGI24735J21928_10034918
508 JGI25162J39368_1000091
509 JGI25165J46597_1000172
510 Ga0055538_1000063
511 Ga0055539_1000096
512 Ga0055533_1000107
513 Ga0055525_1000140
514 Ga0055541_1000064
515 Ga0065714_10003796
516 Ga0065714_10064959
517 Ga0065714_10102297
518 Ga0065704_10070204
519 Ga0065704_10425804
520 Ga0065715_10042533
521 Ga0065707_10023534
522 Ga0065707_10108041
523 Ga0068869_100306587
524 Ga0070680_100064264
525 Ga0070692_10235235
526 Ga0070668_100352428
527 Ga0070675_100176390
528 Ga0070675_100236627
529 Ga0070671_100585077
530 Ga0070671_101678582
531 Ga0070674_100970213
532 Ga0070673_100479252
533 Ga0070673_100510455
534 Ga0070673_102149529
535 Ga0070703_10455437
536 Ga0070714_100114091
537 Ga0070714_100283025
538 Ga0070713_100092710
539 Ga0070710_10279421
540 Ga0070711_100020515
541 Ga0070711_100518417
542 Ga0070705_100519062
543 Ga0070694_100547988
544 Ga0070694_100643524
545 Ga0070694_101156342
546 Ga0070708_100021049
547 Ga0070708_100026406
548 Ga0070708_100250830
549 Ga0070708_100277900
550 Ga0070708_100457586
551 Ga0070708_101633258
552 Ga0070708_101663009
553 Ga0070663_100615438
554 Ga0070681_10122890
555 Ga0068867_101617856
556 Ga0070707_100000180
557 Ga0070707_100035574
558 Ga0070707_100062148
559 Ga0070707_100338024
560 Ga0070698_100046196
561 Ga0070698_100125729
562 Ga0070698_100355632
563 Ga0070698_100460703
564 Ga0070698_100676366
565 Ga0070699_100191657
566 Ga0070679_100408827
567 Ga0070679_101259550
568 Ga0070697_100000005
569 Ga0070697_100022453
570 Ga0070697_100048365
571 Ga0070697_100384582
572 Ga0070697_100538900
573 Ga0070697_100653247
574 Ga0070672_100074170
575 Ga0070695_100079216
576 Ga0070695_100407967
577 Ga0070695_100451053
578 Ga0070695_101110141
579 Ga0070696_100044931
580 Ga0070696_100191427
581 Ga0070693_100496091
582 Ga0070704_100018840
583 Ga0070664_100327440
584 Ga0068857_100011737
585 Ga0068857_100138578
586 Ga0068857_101952901
587 Ga0068852_102169014
588 Ga0068859_100515553
589 Ga0068859_101526519
590 Ga0068864_100097619
591 Ga0068864_100904254
592 Ga0068864_101556041
593 Ga0068861_100369342
594 Ga0068870_10086662
595 Ga0068863_100288829
596 Ga0068862_100483026
597 Ga0068862_100613639
598 Ga0081540_1100041
599 Ga0081539_10000537
600 Ga0070717_10061488
601 Ga0070717_10097175
602 Ga0075363_100128124
603 Ga0070716_100172492
604 Ga0070712_100120754
605 Ga0070712_100519776
606 Ga0070712_100565908
607 Ga0070712_101029278
608 Ga0075362_10009309
609 Ga0075428_100000473
610 Ga0075428_100002493
611 Ga0075428_100014976
612 Ga0075428_100036926
613 Ga0075428_100054851
614 Ga0075428_100628910
615 Ga0075430_100073884
616 Ga0075430_100168329
617 Ga0075431_100369732
618 Ga0075433_10009221
619 Ga0075433_10288698
620 Ga0075434_100037528
621 Ga0075429_100118791
622 Ga0075429_100894791
623 Ga0075436_100150731
624 Ga0097620_100515584
625 Ga0097620_101526226
626 Ga0075435_100017523
627 Ga0099794_10030822
628 Ga0099794_10043592
629 Ga0099794_10140349
630 Ga0099794_10171024
631 Ga0105240_10064633
632 Ga0111539_10121713
633 Ga0111539_12245647
634 Ga0105245_10111288
635 Ga0105245_10799325
636 Ga0105245_11771878
637 Ga0105247_10444596
638 Ga0114129_10173698
639 Ga0114129_10293173
640 Ga0114129_11460666
641 Ga0105243_10152002
642 Ga0105243_11275342
643 Ga0105242_10301814
644 Ga0105248_10513874
645 Ga0105248_11183718
646 Ga0105249_10283864
647 Ga0105246_11568988
648 Ga0157373_10000290
649 Ga0157371_10000438
650 Ga0157371_10524551
651 Ga0157370_10062920
652 Ga0157374_10014842
653 Ga0157378_10003951
654 Ga0163162_10198842
655 Ga0163162_11748735
656 Ga0163163_10015400
657 Ga0157380_10535743
658 Ga0182008_10013648
659 Ga0157377_10109281
660 Ga0182006_1003490
661 Ga0213873_10164467
662 Ga0213875_10088762
663 Ga0228598_1003365
664 Ga0228598_1004249
665 Ga0209760_102118
666 Ga0209784_100079
667 Ga0209566_100093
668 Ga0209674_100115
669 Ga0209563_100113
670 Ga0207427_100588
671 Ga0209437_100176
672 Ga0209677_100072
673 Ga0209233_1000183
674 Ga0209025_1110993
675 Ga0207653_10000414
676 Ga0207692_10508166
677 Ga0207647_10416485
678 Ga0207699_10008521
679 Ga0207684_10148644
680 Ga0207707_10319672
681 Ga0207695_10082582
682 Ga0207693_10123712
683 Ga0207693_10503291
684 Ga0207660_10133770
685 Ga0207652_11009594
686 Ga0207646_10000059
687 Ga0207646_10202355
688 Ga0207646_10457038
689 Ga0207650_10837209
690 Ga0207659_10130492
691 Ga0207659_10168689
692 Ga0207700_10258515
693 Ga0207700_11281460
694 Ga0207664_10463908
695 Ga0207709_10107514
696 Ga0207669_11354464
697 Ga0207665_10080971
698 Ga0207665_10093590
699 Ga0207665_10110098
700 Ga0207665_10144682
701 Ga0207679_10162464
702 Ga0207651_10437632
703 Ga0207668_10576454
704 Ga0207640_10169489
705 Ga0207658_10330195
706 Ga0207708_10217882
707 Ga0207708_10618564
708 Ga0207708_11484020
709 Ga0207641_10340253
710 Ga0207641_10588932
711 Ga0207676_10119873
712 Ga0207676_10855061
713 Ga0207674_10018708
714 Ga0207674_10274089
715 Ga0207675_100071191
716 Ga0207698_11914202
717 Ga0209588_1007319
718 Ga0209588_1027800
719 Ga0209588_1121424
720 Ga0207428_10366089
721 Ga0265319_1001080
722 Ga0265319_1172589
723 Ga0265318_10030776
724 Ga0265338_10149228
725 Ga0265760_10020749
726 Ga0265330_10002532
727 Ga0265320_10001615
728 Ga0265340_10009210
729 Ga0265340_10038002
730 Ga0265339_10076050
731 Ga0265316_10000552
732 Ga0265316_10020207
733 Ga0265314_10001011
734 Ga0265314_10028074
735 Ga0265314_10118474
736 Ga0265314_10617914
737 Ga0265342_10525742
738 Ga0307410_11089508
739 Ga0307406_10083718
740 Ga0307412_10000023
741 Ga0307412_10246938
742 Ga0307414_10010177
743 Ga0307415_101135935
744 Ga0316214_1047812
745 Ga0373950_0010558
746 Ga0373934_0048450
747 Ga0373951_0156419
748 Ga0373923_0012262
749 Ga0373939_0006323
750 Ga0373954_0054550
751 Ga0373954_0130625
752 Ga0373954_0147851
753 Ga0373956_0078891
754 Ga0373960_0031418
755 Ga0373946_0544456
756 Ga0373955_0121762
757 Ga0373961_0003721
758 Ga0373931_0016034
759 Ga0373935_0099655
760 Ga0373935_1436786
761 Ga0373927_0236432
762 Ga0373927_0445859
763 Ga0373933_0014456
764 Ga0373933_0120810
765 Ga0373933_0859726
766 Ga0373947_0019071
767 Ga0373937_0013061
768 Ga0373937_0203482
769 Ga0373937_1759268
770 Ga0395900_0000092
771 Ga0395898_0062156
772 Ga0436365_0676843
773 Ga0436360_0390745
774 Ga0436360_0402163
775 Ga0436360_0828304
776 Ga0436360_1371142
777 Ga0436361_0226691
778 Ga0436363_0346351
779 Ga0436362_0327735
780 Ga0436362_0471209
781 Ga0436362_0741091
782 Ga0436362_1265168
783 Ga0439438_132388
784 Ga0439446_0208453
785 Ga0451577_0698003
786 Ga0466972_0387886
787 Ga0453683_0864481
788 Ga0466965_0041071
789 Ga0453684_0366180
790 Ga0466957_0181588
791 Ga0466960_0039662
792 Ga0451576_0536133
793 Ga0495592_0073078
794 Ga0495592_0094625
795 Ga0495592_0152299
796 Ga0495638_0317948
797 Ga0495651_0000024
798 Ga0495651_0001072
799 Ga0495651_0038764
800 Ga0495651_0281769
801 Ga0495653_0002200
802 Ga0495653_0002698
803 Ga0495653_0161856
804 Ga0495580_0091042
805 Ga0495580_0126658
806 Ga0495580_0386363
807 Ga0495580_0438206
808 Ga0495580_0921654
809 Ga0495664_0007459
810 Ga0495664_0035202
811 Ga0495664_0137609
812 Ga0495584_0000514
813 Ga0495585_0165841
814 Ga0495607_0185286
815 Ga0495608_0005341
816 Ga0495608_0031976
817 Ga0495608_0037775
818 Ga0495608_0203853
819 Ga0495616_0416865
820 Ga0495618_0043950
821 Ga0495618_0114633
822 Ga0495628_0000440
823 Ga0495628_0001985
824 Ga0495628_0024095
825 Ga0495628_0037825
826 Ga0495628_0040671
827 Ga0495630_0004232
828 Ga0495630_0266545
829 Ga0495630_0356985
830 Ga0495630_0673388
831 Ga0495644_0179386
832 Ga0495666_0076979
833 Ga0495652_0002364
834 Ga0495652_0003314
835 Ga0495652_0007168
836 Ga0495652_0075012
837 Ga0495652_0150185
838 Ga0495665_0063684
839 Ga0495640_0302933
840 Ga0495586_0001720
841 Ga0495586_0043773
842 Ga0495586_0266363
843 Ga0495587_0004083
844 Ga0495645_0006667
845 Ga0495645_0074970
846 Ga0495645_0161874
847 Ga0495645_0237340
848 Ga0495667_0007600
849 Ga0495667_0014149
850 Ga0495667_0218311
851 Ga0495667_0295003
852 Ga0495634_0044234
853 Ga0495634_0507790
854 Ga0495635_0083230
855 Ga0495635_0301742
856 Ga0495657_0008797
857 Ga0495657_0333791
858 Ga0495599_0000599
859 Ga0495623_0003511
860 Ga0495623_0032885
861 Ga0495623_0070397
862 Ga0495623_0184505
863 Ga0495646_0016002
864 Ga0495646_0050600
865 Ga0495646_0099679
866 Ga0495658_0254465
867 Ga0495613_0317170
868 Ga0495624_0001011
869 Ga0495624_0015875
870 Ga0495624_0268003
871 Ga0495624_0441819
872 Ga0495670_0082114
873 Ga0495600_0001191
874 Ga0495600_0236988
875 Ga0495604_0002842
876 Ga0495604_0020297
877 Ga0495604_0020756
878 Ga0495604_0214311
879 Ga0495604_0536967
880 Ga0495674_0002377
881 Ga0495674_0098688
882 Ga0495674_0123487
883 Ga0495674_0166887
884 Ga0495674_0742159
885 Ga0495676_1040581
886 Ga0495680_0000749
887 Ga0495680_0002400
888 Ga0495680_0022613
889 Ga0495680_0184289
890 Ga0495675_0000052
891 Ga0495675_0006137
892 Ga0495675_0008673
893 Ga0495675_0012773
894 Ga0495675_0274882
895 Ga0495684_0000552
896 Ga0495684_0007925
897 Ga0495684_0354820
898 Ga0495684_0589543
899 Ga0495593_0070934
900 Ga0495593_0481510
901 Ga0495602_0057258
902 Ga0495602_0125468
903 Ga0495602_0345393
904 Ga0495602_0465379
905 Ga0495602_0493939
906 Ga0495614_0009961
907 Ga0496109_0260685
908 Ga0496110_0002838
909 Ga0496110_0474358
910 Ga0496112_0368592
911 Ga0496115_0235880
912 Ga0501031_0035628
913 Ga0501031_0038437
914 Ga0501032_0101273
915 Ga0501032_0334591
916 Ga0501033_0061105
917 Ga0501033_0207265
918 Ga0501033_0803781
919 Ga0501036_0051644
920 Ga0501036_1037888
921 Ga0501037_0069693
922 Ga0501038_0045147
923 Ga0501038_0069200
924 Ga0501039_0106236
925 Ga0501039_0599381
926 Ga0501040_0009148
927 Ga0501040_0285029
928 Ga0501041_0032609
929 Ga0501042_0047030
930 Ga0501042_0137599
931 Ga0501042_0316593
932 Ga0501043_0021451
933 Ga0501043_0075928
934 Ga0501046_0205332
935 Ga0501069_0006872
936 Ga0501071_0178335
937 Ga0501071_0186920
938 Ga0501072_0038905
939 Ga0501073_0117794
940 Ga0501074_0015783
941 Ga0501075_0011388
942 Ga0501075_0421638
943 Ga0501076_0074285
944 Ga0501077_0035193
945 Ga0501077_0093619
946 Ga0501261_008752
947 Ga0501079_0146658
948 Ga0501079_0153067
949 Ga0501079_0591276
950 Ga0501080_0026919
951 Ga0501080_0138942
952 Ga0501080_0272490
953 Ga0501083_0071568
954 Ga0501083_0600827
955 Ga0501280_000043
956 Ga0501035_0104446
957 Ga0501044_0808761
958 Ga0501045_0069240
959 Ga0501045_0159011
960 Ga0501045_0484746
961 nmdc:mga03683_74782_c1
962 nmdc:mga03n38_95803_c1
963 nmdc:mga05p37_100422_c1
964 nmdc:mga05p37_362304_c1
965 nmdc:mga05p37_502565_c1
966 nmdc:mga09592_642191_c1
967 nmdc:mga09592_8945_c1
968 nmdc:mga0qj67_151302_c1
969 nmdc:mga0qj67_67053_c1
970 nmdc:mga06r32_266814_c1
971 nmdc:mga06r32_453846_c1
972 nmdc:mga08y16_194281_c1
973 nmdc:mga08y16_206762_c1
974 nmdc:mga08y16_344281_c1
975 nmdc:mga0n895_16357_c1
976 nmdc:mga0n895_476348_c1
977 nmdc:mga0rr50_31965_c1
978 nmdc:mga08x19_25871_c1
979 nmdc:mga0a205_307381_c1
980 nmdc:mga0a205_8953_c1
981 Ga0495601_0001534
982 Ga0495601_0145113
983 Ga0495601_0153058
984 Ga0495601_0283431
985 Ga0495601_0502673
986 Ga0495612_0024132
987 Ga0495612_0196516
988 Ga0495655_0103157
989 Ga0495619_0025034
990 Ga0495619_0077876
991 Ga0495619_0170524
992 Ga0500568_0074221
993 Ga0500573_0057090
994 Ga0500574_035283
995 Ga0500619_001300
996 Ga0501084_0145998
997 Ga0501082_0043176
998 Ga0501082_0366166
999 Ga0530510_0118727
1000 Ga0530510_0223921
1001 Ga0530510_0295568
1002 Ga0530510_0778762
1003 2857478486
1004 2862512828
1005 2980178725
1006 8004024826
1007 8004027257
1008 8054797462

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

29

143

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9416 22 175
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9368 22 175
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9352 22 175
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9246 22 175
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9244 22 175
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9283 22 175 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9159 22 175 3.10.180.10
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7838 27 90 3.30.720.100
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7716 28 134 3.10.180.10
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7629 27 90 3.30.720.100
ID Description Score Start End GO Terms
AF-A0A6N8J3M1-F1-model_v4 PhnB-like domain-containing protein 1 120 176
AF-S4MYN5-F1-model_v4 PhnB-like domain-containing protein 0.9981 98 177
AF-A0A4V1SQP6-F1-model_v4 VOC family protein 0.9971 121 177
AF-A0A2V7U7S1-F1-model_v4 PhnB-like domain-containing protein 0.9966 107 176
AF-I7ZHF7-F1-model_v4 Putative 3-demethylubiquinone-93-methyltransferase protein 0.9925 121 177 GO:0008168
GO:0032259

Map