F456083

General Info

Members Datasets Scaffolds Average Seq Length
503 282 499 165

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0467897|Ga0496100_0467897_363_953
Length 196
Sequence MEVRANGNGSLATGALKLVVRLGDPALSPFSEITAMRSLFPLVAICCALSTSPTRAQVAVQANPDQERLVASADPRLAANKRLVYDFWREVFEGGHMELAEKYMAESYIQHNPTVPTGRAAFVDFFSKFAKPKPIEPRIKAPLVSIVAEGDYVVLSFVREVAEPSDPAKKYTTTWFDMFRIENGKIAEHWDAAQKK

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
3 2643221717 Acidovorax sp. Root267 Isolate Unclassified
4 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
78 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
109 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
110 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
172 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
179 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
180 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
181 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
182 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
188 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
206 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
207 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
208 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
209 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
210 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
211 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
212 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
213 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
214 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
215 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
218 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
253 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
254 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
255 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
256 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
257 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
258 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
259 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
260 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
261 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
262 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
263 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
264 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
265 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
274 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
275 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
276 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
277 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
278 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
279 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
280 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
281 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
282 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0.4
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.33
Nodule 0.8
Rhizoplane 4.37
Rhizosphere 75.55
Stem 0
Stem Tuber 0
Unclassified 7.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1001041 3300002741 Bacteria 12688
2 rootH2_10012260 3300003320 Bacteria 5562
3 rootH2_10111248 3300003320 Bacteria 1843
4 Ga0055539_1000431 3300003752 Bacteria 14924
5 Ga0055539_1013020 3300003752 Bacteria 1020
6 Ga0055533_1000053 3300003756 Bacteria 199478
7 Ga0055525_1000904 3300003759 Bacteria 8472
8 Ga0055537_1000024 3300003773 Bacteria 111410
9 Ga0055534_1000032 3300003784 Bacteria 118890
10 Ga0055528_1000966 3300003790 Bacteria 19056
11 Ga0055528_1028158 3300003790 Bacteria 1557
12 Ga0058861_11900683 3300004800 Unclassified 595
13 Ga0065714_10011768 3300005288 Bacteria 3017
14 Ga0065712_10465691 3300005290 Bacteria 674
15 Ga0070658_10830315 3300005327 Unclassified 803
16 Ga0070676_10002126 3300005328 Bacteria 10087
17 Ga0070683_100056555 3300005329 Bacteria 3643
18 Ga0070683_100058603 3300005329 Bacteria 3577
19 Ga0070683_100818544 3300005329 Bacteria 893
20 Ga0070690_100021702 3300005330 Bacteria 3923
21 Ga0070690_100220684 3300005330 Bacteria 1328
22 Ga0070677_10053896 3300005333 Bacteria 1636
23 Ga0068869_100010105 3300005334 Bacteria 6142
24 Ga0068869_100011559 3300005334 Bacteria 5795
25 Ga0070666_10131553 3300005335 Bacteria 1739
26 Ga0070680_100051214 3300005336 Bacteria 3369
27 Ga0068868_100155238 3300005338 Bacteria 1887
28 Ga0070660_100012911 3300005339 Bacteria 5977
29 Ga0070660_100261118 3300005339 Unclassified 1414
30 Ga0070660_100425722 3300005339 Bacteria 1099
31 Ga0070660_100810723 3300005339 Bacteria 788
32 Ga0070691_10317542 3300005341 Unclassified 856
33 Ga0070687_100053513 3300005343 Bacteria 2099
34 Ga0070661_100084219 3300005344 Bacteria 2349
35 Ga0070692_10085496 3300005345 Bacteria 1706
36 Ga0070669_100009250 3300005353 Bacteria 7019
37 Ga0070669_100376804 3300005353 Bacteria 1157
38 Ga0070675_100154991 3300005354 Bacteria 1966
39 Ga0070675_100161966 3300005354 Bacteria 1924
40 Ga0070659_100018658 3300005366 Bacteria 5236
41 Ga0070667_100027534 3300005367 Bacteria 4729
42 Ga0070667_100036537 3300005367 Bacteria 4118
43 Ga0070713_100000354 3300005436 Bacteria 29691
44 Ga0070711_100059753 3300005439 Bacteria 2648
45 Ga0070700_100098425 3300005441 Bacteria 1923
46 Ga0070708_100273278 3300005445 Bacteria 1590
47 Ga0070708_101418248 3300005445 Bacteria 648
48 Ga0070663_100168608 3300005455 Bacteria 1691
49 Ga0070678_100529336 3300005456 Bacteria 1044
50 Ga0070662_100050729 3300005457 Bacteria 2993
51 Ga0070662_100077524 3300005457 Bacteria 2466
52 Ga0070662_100084458 3300005457 Bacteria 2371
53 Ga0070662_100330874 3300005457 Bacteria 1244
54 Ga0070681_10002016 3300005458 Bacteria 18381
55 Ga0070681_10016015 3300005458 Bacteria 7474
56 Ga0070681_10109705 3300005458 Unclassified 2699
57 Ga0068867_100012228 3300005459 Bacteria 6066
58 Ga0068867_100039561 3300005459 Bacteria 3438
59 Ga0068867_100435659 3300005459 Bacteria 1114
60 Ga0068867_100588602 3300005459 Bacteria 969
61 Ga0070679_100053871 3300005530 Bacteria 4005
62 Ga0070679_100120704 3300005530 Unclassified 2606
63 Ga0070679_100132052 3300005530 Bacteria 2478
64 Ga0070684_100497905 3300005535 Bacteria 1128
65 Ga0070684_100954743 3300005535 Bacteria 804
66 Ga0070697_100470548 3300005536 Bacteria 1096
67 Ga0070697_101579698 3300005536 Bacteria 586
68 Ga0068853_100040073 3300005539 Bacteria 3995
69 Ga0068853_100044626 3300005539 Bacteria 3795
70 Ga0068853_100134983 3300005539 Bacteria 2211
71 Ga0068853_100330876 3300005539 Bacteria 1413
72 Ga0070672_100022473 3300005543 Bacteria 4634
73 Ga0070672_100051863 3300005543 Bacteria 3201
74 Ga0070672_100156907 3300005543 Bacteria 1885
75 Ga0070665_100303469 3300005548 Unclassified 1600
76 Ga0070665_100606307 3300005548 Bacteria 1108
77 Ga0070704_100442518 3300005549 Bacteria 1117
78 Ga0068855_100057508 3300005563 Bacteria 4558
79 Ga0068855_100237110 3300005563 Bacteria 2040
80 Ga0068855_100393423 3300005563 Bacteria 1520
81 Ga0068857_100025633 3300005577 Bacteria 5191
82 Ga0068857_100032310 3300005577 Bacteria 4628
83 Ga0068857_100092003 3300005577 Bacteria 2715
84 Ga0068857_100396458 3300005577 Bacteria 1284
85 Ga0068854_100061685 3300005578 Bacteria 2716
86 Ga0068854_100160660 3300005578 Bacteria 1740
87 Ga0068854_100168430 3300005578 Bacteria 1702
88 Ga0068854_100393122 3300005578 Bacteria 1145
89 Ga0068856_100036308 3300005614 Bacteria 4832
90 Ga0068856_100277374 3300005614 Unclassified 1693
91 Ga0068852_100320618 3300005616 Bacteria 1505
92 Ga0068852_100994213 3300005616 Bacteria 857
93 Ga0068859_100116413 3300005617 Bacteria 2737
94 Ga0068859_100406000 3300005617 Unclassified 1458
95 Ga0068859_101000006 3300005617 Bacteria 918
96 Ga0068864_100012571 3300005618 Bacteria 7000
97 Ga0068864_101383900 3300005618 Bacteria 705
98 Ga0068861_100005189 3300005719 Bacteria 8780
99 Ga0068861_100031611 3300005719 Bacteria 3890
100 Ga0068851_10047688 3300005834 Bacteria 2170
101 Ga0068870_10016697 3300005840 Bacteria 3514
102 Ga0068870_10062422 3300005840 Bacteria 2007
103 Ga0068863_100339918 3300005841 Bacteria 1460
104 Ga0068863_100605033 3300005841 Bacteria 1085
105 Ga0068863_100675434 3300005841 Bacteria 1025
106 Ga0068858_100135174 3300005842 Bacteria 2313
107 Ga0068860_100071343 3300005843 Bacteria 3301
108 Ga0068860_100099773 3300005843 Bacteria 2769
109 Ga0075365_10211254 3300006038 Bacteria 1360
110 Ga0075363_100345888 3300006048 Bacteria 868
111 Ga0075364_10075780 3300006051 Bacteria 2220
112 Ga0075364_10107788 3300006051 Bacteria 1857
113 Ga0075432_10118761 3300006058 Bacteria 991
114 Ga0070715_10052686 3300006163 Bacteria 1756
115 Ga0075362_10033180 3300006177 Bacteria 2244
116 Ga0075366_10003150 3300006195 Bacteria 8633
117 Ga0075366_10187311 3300006195 Bacteria 1257
118 Ga0075366_10298720 3300006195 Bacteria 985
119 Ga0075366_10340612 3300006195 Bacteria 919
120 Ga0097621_100127786 3300006237 Bacteria 2160
121 Ga0075370_10037398 3300006353 Bacteria 2729
122 Ga0075370_10133171 3300006353 Bacteria 1451
123 Ga0075370_10134881 3300006353 Bacteria 1442
124 Ga0075370_10172785 3300006353 Bacteria 1270
125 Ga0068871_100120278 3300006358 Bacteria 2218
126 Ga0068871_100513242 3300006358 Bacteria 1082
127 Ga0075434_100120027 3300006871 Plasmid 2644
128 Ga0068865_100090950 3300006881 Unclassified 2213
129 Ga0068865_100091220 3300006881 Bacteria 2211
130 Ga0068865_101021136 3300006881 Bacteria 725
131 Ga0075436_100006365 3300006914 Bacteria 8092
132 Ga0075436_100066246 3300006914 Unclassified 2496
133 Ga0097620_100116410 3300006931 Bacteria 2737
134 Ga0097620_100406008 3300006931 Unclassified 1458
135 Ga0097620_100999976 3300006931 Bacteria 918
136 Ga0079104_1026887 3300006946 Bacteria 1481
137 Ga0099826_10000060 3300006948 Bacteria 63334
138 Ga0105240_10022760 3300009093 Bacteria 8301
139 Ga0105240_10159984 3300009093 Bacteria 2676
140 Ga0111539_10178146 3300009094 Bacteria 2483
141 Ga0105245_10351175 3300009098 Bacteria 1461
142 Ga0105245_10485593 3300009098 Bacteria 1249
143 Ga0105243_10213221 3300009148 Bacteria 1702
144 Ga0105243_11209626 3300009148 Bacteria 769
145 Ga0105241_10084377 3300009174 Bacteria 2494
146 Ga0105241_10417827 3300009174 Bacteria 1180
147 Ga0105242_10020541 3300009176 Bacteria 5180
148 Ga0105242_10070260 3300009176 Bacteria 2903
149 Ga0105242_10237406 3300009176 Bacteria 1637
150 Ga0105242_10454557 3300009176 Bacteria 1208
151 Ga0105242_11288435 3300009176 Bacteria 754
152 Ga0105248_10009179 3300009177 Bacteria 10878
153 Ga0105248_10190636 3300009177 Bacteria 2310
154 Ga0105248_11189808 3300009177 Bacteria 862
155 Ga0105248_12053382 3300009177 Bacteria 650
156 Ga0105237_10056123 3300009545 Bacteria 3943
157 Ga0105237_10059483 3300009545 Bacteria 3823
158 Ga0105237_10210082 3300009545 Bacteria 1946
159 Ga0105237_10799964 3300009545 Bacteria 950
160 Ga0105238_10023381 3300009551 Bacteria 6300
161 Ga0105238_10032025 3300009551 Bacteria 5351
162 Ga0105238_10429979 3300009551 Bacteria 1316
163 Ga0105238_10818492 3300009551 Bacteria 947
164 Ga0105238_11003399 3300009551 Bacteria 856
165 Ga0105249_10000569 3300009553 Bacteria 33896
166 Ga0105249_10003872 3300009553 Bacteria 12918
167 Ga0105249_11083444 3300009553 Bacteria 871
168 Ga0105249_12200326 3300009553 Bacteria 624
169 Ga0105239_10014663 3300010375 Bacteria 8691
170 Ga0105239_10358556 3300010375 Unclassified 1646
171 Ga0105239_10652476 3300010375 Bacteria 1202
172 Ga0105239_10912263 3300010375 Bacteria 1008
173 Ga0105246_10079023 3300011119 Bacteria 2338
174 Ga0105246_10109160 3300011119 Bacteria 2029
175 Ga0105246_10410916 3300011119 Bacteria 1127
176 Ga0105246_10742460 3300011119 Bacteria 865
177 Ga0157373_10066827 3300013100 Bacteria 2542
178 Ga0157371_10025245 3300013102 Bacteria 4333
179 Ga0157371_10258903 3300013102 Bacteria 1254
180 Ga0157370_10001541 3300013104 Bacteria 28510
181 Ga0157370_10222859 3300013104 Bacteria 1746
182 Ga0157369_10023185 3300013105 Bacteria 6915
183 Ga0157369_10142239 3300013105 Bacteria 2538
184 Ga0157369_11300399 3300013105 Bacteria 741
185 Ga0157374_10058511 3300013296 Bacteria 3602
186 Ga0157374_10091768 3300013296 Bacteria 2897
187 Ga0157374_10122232 3300013296 Unclassified 2514
188 Ga0157374_10240355 3300013296 Bacteria 1781
189 Ga0157378_10140719 3300013297 Bacteria 2240
190 Ga0157378_10148686 3300013297 Bacteria 2181
191 Ga0157378_10460464 3300013297 Bacteria 1264
192 Ga0163162_10012159 3300013306 Bacteria 8403
193 Ga0163162_10033731 3300013306 Bacteria 5088
194 Ga0163162_10101102 3300013306 Bacteria 2975
195 Ga0163162_10133434 3300013306 Bacteria 2593
196 Ga0163162_10213487 3300013306 Bacteria 2060
197 Ga0163162_11671333 3300013306 Unclassified 727
198 Ga0157372_10094958 3300013307 Bacteria 3397
199 Ga0157372_11066491 3300013307 Bacteria 935
200 Ga0157372_11273651 3300013307 Bacteria 849
201 Ga0157375_10644805 3300013308 Bacteria 1216
202 Ga0157375_10760307 3300013308 Bacteria 1120
203 Ga0163163_10004182 3300014325 Bacteria 12299
204 Ga0163163_11011911 3300014325 Bacteria 894
205 Ga0157380_10009129 3300014326 Bacteria 7090
206 Ga0157380_10013980 3300014326 Bacteria 5862
207 Ga0157380_10044081 3300014326 Bacteria 3494
208 Ga0157380_10095641 3300014326 Bacteria 2461
209 Ga0157380_10649974 3300014326 Bacteria 1052
210 Ga0182008_10527408 3300014497 Bacteria 653
211 Ga0157377_10012006 3300014745 Bacteria 4344
212 Ga0157379_10073305 3300014968 Bacteria 3064
213 Ga0157379_10178067 3300014968 Bacteria 1921
214 Ga0163161_10004853 3300017792 Bacteria 9362
215 Ga0163161_10035355 3300017792 Bacteria 3576
216 Ga0163161_10082475 3300017792 Bacteria 2369
217 Ga0163161_10138081 3300017792 Bacteria 1844
218 Ga0163161_10371584 3300017792 Bacteria 1141
219 Ga0209674_100039 3300025226 Bacteria 402292
220 Ga0209563_100080 3300025230 Bacteria 199504
221 Ga0209646_1000076 3300025246 Bacteria 212891
222 Ga0209026_1000011 3300025250 Bacteria 507291
223 Ga0209677_100086 3300025253 Bacteria 112759
224 Ga0209677_100308 3300025253 Bacteria 32011
225 Ga0209759_1000034 3300025256 Bacteria 271209
226 Ga0209565_1000039 3300025263 Bacteria 278026
227 Ga0209673_1000284 3300025273 Bacteria 94932
228 Ga0209673_1010969 3300025273 Bacteria 3776
229 Ga0209675_1000030 3300025291 Bacteria 278026
230 Ga0209676_1043480 3300025292 Bacteria 1239
231 Ga0209025_1027189 3300025294 Bacteria 2845
232 Ga0209256_1017374 3300025299 Bacteria 2393
233 Ga0209051_1100523 3300025303 Bacteria 779
234 Ga0207697_10045534 3300025315 Bacteria 1806
235 Ga0207656_10022539 3300025321 Bacteria 2528
236 Ga0207656_10035588 3300025321 Bacteria 2086
237 Ga0207682_10020397 3300025893 Bacteria 2603
238 Ga0207688_10151691 3300025901 Bacteria 1369
239 Ga0207680_10043839 3300025903 Bacteria 2626
240 Ga0207685_10145516 3300025905 Unclassified 1067
241 Ga0207645_10011545 3300025907 Bacteria 6025
242 Ga0207643_10071058 3300025908 Bacteria 2003
243 Ga0207707_10000659 3300025912 Bacteria 34203
244 Ga0207707_10005489 3300025912 Bacteria 11084
245 Ga0207707_10031818 3300025912 Bacteria 4618
246 Ga0207695_10003912 3300025913 Bacteria 20607
247 Ga0207695_10447052 3300025913 Bacteria 1176
248 Ga0207671_10027936 3300025914 Bacteria 4217
249 Ga0207671_10244164 3300025914 Unclassified 1411
250 Ga0207671_10349354 3300025914 Bacteria 1173
251 Ga0207671_11010196 3300025914 Bacteria 655
252 Ga0207663_10253568 3300025916 Bacteria 1296
253 Ga0207660_10011567 3300025917 Bacteria 5750
254 Ga0207660_10187721 3300025917 Bacteria 1608
255 Ga0207662_10251795 3300025918 Bacteria 1159
256 Ga0207657_10038357 3300025919 Bacteria 4266
257 Ga0207657_10172224 3300025919 Unclassified 1753
258 Ga0207657_10402372 3300025919 Bacteria 1077
259 Ga0207657_10433327 3300025919 Bacteria 1032
260 Ga0207649_10142807 3300025920 Bacteria 1640
261 Ga0207652_10009622 3300025921 Bacteria 7774
262 Ga0207652_10039072 3300025921 Bacteria 4026
263 Ga0207652_10066830 3300025921 Bacteria 3117
264 Ga0207681_10032317 3300025923 Bacteria 3425
265 Ga0207681_10217441 3300025923 Bacteria 1476
266 Ga0207681_11133662 3300025923 Bacteria 657
267 Ga0207694_10003748 3300025924 Bacteria 12049
268 Ga0207694_10028071 3300025924 Bacteria 4290
269 Ga0207694_10219270 3300025924 Bacteria 1551
270 Ga0207694_10225409 3300025924 Bacteria 1529
271 Ga0207694_10448911 3300025924 Bacteria 1076
272 Ga0207694_10931963 3300025924 Bacteria 735
273 Ga0207659_10002492 3300025926 Bacteria 10978
274 Ga0207659_10076750 3300025926 Bacteria 2457
275 Ga0207659_10247410 3300025926 Bacteria 1445
276 Ga0207687_10150824 3300025927 Bacteria 1774
277 Ga0207700_10000042 3300025928 Bacteria 95374
278 Ga0207700_10046915 3300025928 Bacteria 3199
279 Ga0207644_10036181 3300025931 Bacteria 3464
280 Ga0207690_10562072 3300025932 Bacteria 928
281 Ga0207706_10005161 3300025933 Bacteria 12189
282 Ga0207706_10008889 3300025933 Bacteria 9248
283 Ga0207706_10044023 3300025933 Bacteria 3956
284 Ga0207706_10084338 3300025933 Bacteria 2793
285 Ga0207686_10174068 3300025934 Bacteria 1520
286 Ga0207686_10259800 3300025934 Bacteria 1273
287 Ga0207709_10758658 3300025935 Bacteria 780
288 Ga0207670_10202421 3300025936 Bacteria 1509
289 Ga0207669_10187339 3300025937 Bacteria 1489
290 Ga0207704_10217864 3300025938 Bacteria 1410
291 Ga0207704_10750755 3300025938 Bacteria 811
292 Ga0207691_10062232 3300025940 Bacteria 3388
293 Ga0207691_10120956 3300025940 Bacteria 2320
294 Ga0207691_10152371 3300025940 Bacteria 2032
295 Ga0207711_11185065 3300025941 Bacteria 705
296 Ga0207689_10001974 3300025942 Bacteria 19384
297 Ga0207689_11115018 3300025942 Bacteria 665
298 Ga0207661_10102901 3300025944 Bacteria 2402
299 Ga0207661_10548899 3300025944 Bacteria 1058
300 Ga0207679_10777047 3300025945 Bacteria 872
301 Ga0207667_10016391 3300025949 Bacteria 8376
302 Ga0207712_10012913 3300025961 Bacteria 5345
303 Ga0207640_10003720 3300025981 Bacteria 8226
304 Ga0207640_10011731 3300025981 Bacteria 4969
305 Ga0207640_11287717 3300025981 Bacteria 652
306 Ga0207658_10019916 3300025986 Bacteria 4643
307 Ga0207677_10408679 3300026023 Bacteria 1153
308 Ga0207703_10284764 3300026035 Bacteria 1502
309 Ga0207639_10029330 3300026041 Bacteria 4026
310 Ga0207639_10041066 3300026041 Bacteria 3458
311 Ga0207678_10131623 3300026067 Bacteria 2134
312 Ga0207678_10151848 3300026067 Bacteria 1978
313 Ga0207708_10023978 3300026075 Bacteria 4614
314 Ga0207708_10060490 3300026075 Bacteria 2891
315 Ga0207702_10000629 3300026078 Bacteria 38750
316 Ga0207702_10103635 3300026078 Bacteria 2517
317 Ga0207702_10387769 3300026078 Unclassified 1345
318 Ga0207702_10455126 3300026078 Bacteria 1242
319 Ga0207641_10008687 3300026088 Bacteria 8388
320 Ga0207641_10598225 3300026088 Bacteria 1079
321 Ga0207648_10070394 3300026089 Bacteria 3050
322 Ga0207648_10142257 3300026089 Bacteria 2115
323 Ga0207648_10485509 3300026089 Bacteria 1129
324 Ga0207676_10377507 3300026095 Bacteria 1319
325 Ga0207676_10626560 3300026095 Bacteria 1036
326 Ga0207674_10003424 3300026116 Bacteria 19421
327 Ga0207674_10028856 3300026116 Bacteria 5849
328 Ga0207674_10050033 3300026116 Bacteria 4272
329 Ga0207674_11382604 3300026116 Bacteria 673
330 Ga0207675_100001938 3300026118 Bacteria 20656
331 Ga0207675_100007765 3300026118 Bacteria 10122
332 Ga0207675_100083851 3300026118 Bacteria 2990
333 Ga0207683_10072087 3300026121 Bacteria 3055
334 Ga0207683_10630202 3300026121 Bacteria 993
335 Ga0207698_10152496 3300026142 Bacteria 2008
336 Ga0207698_10219974 3300026142 Bacteria 1715
337 Ga0207698_10705365 3300026142 Bacteria 1004
338 Ga0209281_1018195 3300027111 Bacteria 1410
339 Ga0209282_1000200 3300027666 Bacteria 32028
340 Ga0268266_10382765 3300028379 Unclassified 1327
341 Ga0268264_10098843 3300028381 Bacteria 2531
342 Ga0268264_10121829 3300028381 Bacteria 2299
343 Ga0268264_10142931 3300028381 Bacteria 2136
344 Ga0268264_10804598 3300028381 Bacteria 939
345 Ga0307517_10010923 3300028786 Bacteria 12650
346 Ga0307517_10046677 3300028786 Bacteria 4510
347 Ga0307515_10000494 3300028794 Bacteria 94354
348 Ga0307515_10006088 3300028794 Bacteria 24256
349 Ga0307515_10009239 3300028794 Bacteria 19087
350 Ga0307515_10082687 3300028794 Bacteria 4148
351 Ga0307515_10170950 3300028794 Bacteria 2166
352 Ga0265338_10536592 3300028800 Unclassified 820
353 Ga0307512_10068043 3300030522 Bacteria 2675
354 Ga0316183_1055656 3300030742 Bacteria 922
355 Ga0316181_1015265 3300030744 Bacteria 2855
356 Ga0316182_1055903 3300030745 Bacteria 3230
357 Ga0265762_1014174 3300030760 Unclassified 1437
358 Ga0265340_10206473 3300031247 Bacteria 883
359 Ga0307513_10575214 3300031456 Bacteria 837
360 Ga0307509_10000539 3300031507 Bacteria 64754
361 Ga0307509_10072227 3300031507 Bacteria 3596
362 Ga0307509_10347080 3300031507 Bacteria 1209
363 Ga0307408_100047574 3300031548 Bacteria 3072
364 Ga0307408_100063098 3300031548 Bacteria 2709
365 Ga0307408_100086886 3300031548 Bacteria 2351
366 Ga0307408_100163198 3300031548 Bacteria 1771
367 Ga0307408_100224888 3300031548 Bacteria 1533
368 Ga0307408_100453789 3300031548 Bacteria 1112
369 Ga0307508_10000096 3300031616 Bacteria 103730
370 Ga0307508_10236145 3300031616 Bacteria 1426
371 Ga0307508_10335597 3300031616 Bacteria 1103
372 Ga0307514_10001231 3300031649 Bacteria 33814
373 Ga0307514_10153233 3300031649 Bacteria 1542
374 Ga0307514_10351129 3300031649 Bacteria 786
375 Ga0307516_10090180 3300031730 Bacteria 2895
376 Ga0307516_10269340 3300031730 Bacteria 1390
377 Ga0307516_10354710 3300031730 Bacteria 1132
378 Ga0307516_10573541 3300031730 Bacteria 782
379 Ga0307412_10111493 3300031911 Bacteria 1954
380 Ga0307412_10679616 3300031911 Bacteria 881
381 Ga0307412_11471020 3300031911 Bacteria 618
382 Ga0307416_100286733 3300032002 Bacteria 1627
383 Ga0307414_10147855 3300032004 Bacteria 1849
384 Ga0307411_10490879 3300032005 Bacteria 1036
385 Ga0307411_10589050 3300032005 Bacteria 954
386 Ga0307510_10003423 3300033180 Bacteria 18505
387 Ga0307510_10268142 3300033180 Bacteria 1185
388 Ga0373941_0168374 3300035115 Bacteria 815
389 Ga0373954_0373190 3300035118 Unclassified 705
390 Ga0373931_0003874 3300035691 Bacteria 6768
391 Ga0373935_0546657 3300035692 Bacteria 844
392 Ga0373927_0101859 3300035695 Bacteria 1868
393 Ga0373937_0310763 3300036401 Bacteria 1491
394 Ga0373937_0503464 3300036401 Unclassified 1151
395 Ga0373937_1130246 3300036401 Bacteria 732
396 Ga0373925_0217508 3300037068 Unclassified 1524
397 Ga0395898_0019622 3300037466 Bacteria 6877
398 Ga0395901_0005935 3300038443 Bacteria 12368
399 Ga0436365_1749871 3300039437 Bacteria 626
400 Ga0439436_0037395 3300041404 Bacteria 1398
401 Ga0451793_0865086 3300041452 Bacteria 991
402 Ga0451833_0293784 3300041491 Bacteria 595
403 Ga0451845_0372831 3300041501 Bacteria 1179
404 Ga0439450_085492 3300042008 Bacteria 788
405 Ga0439462_0036299 3300042015 Bacteria 1312
406 Ga0439446_0002979 3300042156 Bacteria 4143
407 Ga0439464_0000864 3300042439 Bacteria 6731
408 Ga0439460_0050819 3300042461 Bacteria 1243
409 Ga0466969_0000007 3300044656 Bacteria 152114
410 Ga0466965_0137763 3300044683 Bacteria 1269
411 Ga0453684_0145668 3300044712 Bacteria 2822
412 Ga0466968_0321227 3300044735 Bacteria 748
413 Ga0466960_0228235 3300044901 Bacteria 1027
414 Ga0466959_0010140 3300045049 Bacteria 6721
415 Ga0451576_0021520 3300045051 Bacteria 7010
416 Ga0451576_0422154 3300045051 Bacteria 1399
417 Ga0495592_0001842 3300046454 Bacteria 14907
418 Ga0495603_0295143 3300046455 Bacteria 931
419 Ga0495629_0176874 3300046459 Bacteria 1480
420 Ga0495629_0572389 3300046459 Bacteria 757
421 Ga0495638_0160895 3300046460 Bacteria 1295
422 Ga0495638_0187590 3300046460 Bacteria 1175
423 Ga0495580_0392266 3300046472 Bacteria 937
424 Ga0495582_0000735 3300046473 Bacteria 18080
425 Ga0495639_0442915 3300046475 Bacteria 659
426 Ga0495648_0300800 3300046524 Bacteria 752
427 Ga0495625_0256635 3300046660 Unclassified 1133
428 Ga0495623_0536880 3300046679 Unclassified 614
429 Ga0495646_0129244 3300046680 Bacteria 1423
430 Ga0495658_0001903 3300046683 Bacteria 10657
431 Ga0495658_0160983 3300046683 Bacteria 1384
432 Ga0495658_0192311 3300046683 Bacteria 1269
433 Ga0495658_0276635 3300046683 Bacteria 1059
434 Ga0495686_0286517 3300047472 Bacteria 914
435 Ga0496100_0341428 3300048903 Bacteria 1129
436 Ga0496100_0467897 3300048903 Bacteria 968
437 Ga0496101_0073045 3300048904 Bacteria 2519
438 Ga0496102_0042644 3300048905 Bacteria 4112
439 Ga0496103_0510190 3300048906 Bacteria 769
440 Ga0496104_0009677 3300048907 Bacteria 8587
441 Ga0496104_0382199 3300048907 Bacteria 1321
442 Ga0496105_0005715 3300048908 Bacteria 9468
443 Ga0496105_0008178 3300048908 Bacteria 8130
444 Ga0496105_0331156 3300048908 Bacteria 1219
445 Ga0496106_0205695 3300048909 Bacteria 1567
446 Ga0496107_0008125 3300048910 Bacteria 7255
447 Ga0496108_0151169 3300048911 Bacteria 2003
448 Ga0496109_0493766 3300048912 Bacteria 1155
449 Ga0496110_0128942 3300048913 Bacteria 2283
450 Ga0496111_0011766 3300048914 Bacteria 5907
451 Ga0496113_0413339 3300048916 Bacteria 1083
452 Ga0496114_0132627 3300048917 Bacteria 2152
453 Ga0496114_0216839 3300048917 Bacteria 1679
454 Ga0496114_0543147 3300048917 Bacteria 1027
455 Ga0496115_0067730 3300048918 Bacteria 2888
456 Ga0496121_0003714 3300048924 Bacteria 21408
457 Ga0496124_0383803 3300048927 Bacteria 981
458 Ga0496125_0378511 3300048928 Unclassified 835
459 Ga0501290_080086 3300049513 Bacteria 556
460 Ga0501292_000649 3300049515 Bacteria 4255
461 Ga0501294_005705 3300049517 Bacteria 1182
462 Ga0501298_013683 3300049521 Bacteria 1440
463 Ga0501222_005931 3300049662 Bacteria 1643
464 Ga0501223_016442 3300049663 Bacteria 1462
465 Ga0501228_035337 3300049666 Bacteria 630
466 Ga0501257_011650 3300049686 Bacteria 2010
467 Ga0501221_015817 3300049704 Bacteria 1420
468 Ga0501229_000249 3300049706 Bacteria 6050
469 Ga0501265_000809 3300049762 Bacteria 3449
470 Ga0501278_002450 3300049774 Bacteria 1306
471 nmdc:mga03683_218344_c1 3300050489 Bacteria 879
472 nmdc:mga03683_4601_c2 3300050489 Bacteria 2321
473 nmdc:mga03n38_81204_c1 3300050490 Bacteria 1524
474 nmdc:mga0k408_129630_c1 3300050493 Bacteria 1497
475 nmdc:mga0k408_317763_c1 3300050493 Bacteria 929
476 nmdc:mga0k408_415463_c1 3300050493 Unclassified 800
477 nmdc:mga0k408_41621_c1 3300050493 Bacteria 2645
478 nmdc:mga0k408_423409_c1 3300050493 Bacteria 792
479 nmdc:mga0k408_595_c2 3300050493 Bacteria 18958
480 nmdc:mga0k408_8383_c1 3300050493 Bacteria 5544
481 nmdc:mga06z11_840865_c1 3300050494 Bacteria 559
482 nmdc:mga07m45_30356_c1 3300050496 Bacteria 2994
483 nmdc:mga07m45_49910_c1 3300050496 Bacteria 2357
484 nmdc:mga0n895_477305_c1 3300050512 Bacteria 1258
485 nmdc:mga0rr50_142929_c1 3300050513 Bacteria 1926
486 nmdc:mga08x19_133226_c1 3300050514 Unclassified 1673
487 nmdc:mga0a205_39992_c1 3300050515 Plasmid 4514
488 Ga0495595_0441510 3300053084 Unclassified 661
489 Ga0500644_0001797 3300053088 Bacteria 5543
490 Ga0500651_0343774 3300053093 Bacteria 848
491 Ga0500562_005799 3300053108 Bacteria 3109
492 Ga0500594_0015901 3300053118 Bacteria 1822
493 Ga0500652_103671 3300053131 Unclassified 1189
494 Ga0500559_0000278 3300053136 Bacteria 39648
495 Ga0500559_0001149 3300053136 Bacteria 15966
496 Ga0500622_0000413 3300053156 Bacteria 40682
497 Ga0500622_0004660 3300053156 Bacteria 8483
498 Ga0500634_0050967 3300053161 Bacteria 2228
499 Ga0500599_012565 3300053736 Bacteria 1138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100224888 Ga0307408_1002248882 131
2 3300006051 Ga0075364_10107788 Ga0075364_101077883 142
3 3300031548 Ga0307408_100453789 Ga0307408_1004537892 144
4 3300032005 Ga0307411_10490879 Ga0307411_104908792 144
5 3300031911 Ga0307412_11471020 Ga0307412_114710201 145
6 3300006946 Ga0079104_1026887 Ga0079104_10268871 146
7 3300027111 Ga0209281_1018195 Ga0209281_10181951 146
8 3300031548 Ga0307408_100047574 Ga0307408_1000475744 147
9 3300032002 Ga0307416_100286733 Ga0307416_1002867333 150
10 3300053136 Ga0500559_0001149 Ga0500559_0001149_8396_8854 151
11 3300036401 Ga0373937_1130246 Ga0373937_1130246_94_585 157
12 3300039437 Ga0436365_1749871 Ga0436365_1749871_78_557 157
13 3300050513 nmdc:mga0rr50_142929_c1 nmdc:mga0rr50_142929_c1_149_622 157
14 iso_pu_bacteria 2547132374 2548498921 157
15 iso_pu_bacteria 2643221717 2644648380 157
16 3300005458 Ga0070681_10002016 Ga0070681_1000201612 158
17 3300005458 Ga0070681_10016015 Ga0070681_100160154 158
18 3300005530 Ga0070679_100053871 Ga0070679_1000538713 158
19 3300005530 Ga0070679_100132052 Ga0070679_1001320524 158
20 3300005563 Ga0068855_100237110 Ga0068855_1002371102 158
21 3300009551 Ga0105238_10818492 Ga0105238_108184922 158
22 3300013104 Ga0157370_10222859 Ga0157370_102228592 158
23 3300013296 Ga0157374_10122232 Ga0157374_101222322 158
24 3300025912 Ga0207707_10005489 Ga0207707_100054895 158
25 3300025912 Ga0207707_10031818 Ga0207707_100318187 158
26 3300025913 Ga0207695_10003912 Ga0207695_1000391221 158
27 3300025917 Ga0207660_10187721 Ga0207660_101877213 158
28 3300025921 Ga0207652_10039072 Ga0207652_100390724 158
29 3300025921 Ga0207652_10066830 Ga0207652_100668303 158
30 3300025924 Ga0207694_10219270 Ga0207694_102192701 158
31 3300025924 Ga0207694_10931963 Ga0207694_109319631 158
32 iso_pu_bacteria 2738541276 2738715568 158
33 3300041452 Ga0451793_0865086 Ga0451793_0865086_237_737 159
34 iso_pu_bacteria 2643221628 2644158967 159
35 3300004800 Ga0058861_11900683 Ga0058861_119006831 160
36 3300005327 Ga0070658_10830315 Ga0070658_108303151 160
37 3300005336 Ga0070680_100051214 Ga0070680_1000512142 160
38 3300005339 Ga0070660_100261118 Ga0070660_1002611182 160
39 3300005341 Ga0070691_10317542 Ga0070691_103175421 160
40 3300005458 Ga0070681_10109705 Ga0070681_101097054 160
41 3300005530 Ga0070679_100120704 Ga0070679_1001207042 160
42 3300005535 Ga0070684_100954743 Ga0070684_1009547431 160
43 3300005563 Ga0068855_100057508 Ga0068855_1000575086 160
44 3300005614 Ga0068856_100277374 Ga0068856_1002773742 160
45 3300006195 Ga0075366_10298720 Ga0075366_102987201 160
46 3300006914 Ga0075436_100006365 Ga0075436_10000636510 160
47 3300009093 Ga0105240_10022760 Ga0105240_100227607 160
48 3300009551 Ga0105238_10023381 Ga0105238_100233814 160
49 3300010375 Ga0105239_10358556 Ga0105239_103585563 160
50 3300013104 Ga0157370_10001541 Ga0157370_1000154123 160
51 3300013105 Ga0157369_10023185 Ga0157369_100231854 160
52 3300013307 Ga0157372_11066491 Ga0157372_110664912 160
53 3300025912 Ga0207707_10000659 Ga0207707_1000065915 160
54 3300025913 Ga0207695_10447052 Ga0207695_104470522 160
55 3300025914 Ga0207671_10244164 Ga0207671_102441642 160
56 3300025917 Ga0207660_10011567 Ga0207660_100115674 160
57 3300025919 Ga0207657_10172224 Ga0207657_101722242 160
58 3300025921 Ga0207652_10009622 Ga0207652_100096228 160
59 3300025924 Ga0207694_10003748 Ga0207694_1000374813 160
60 3300025949 Ga0207667_10016391 Ga0207667_100163918 160
61 3300026078 Ga0207702_10387769 Ga0207702_103877692 160
62 3300028794 Ga0307515_10006088 Ga0307515_1000608814 160
63 3300031730 Ga0307516_10573541 Ga0307516_105735411 160
64 3300049513 Ga0501290_080086 Ga0501290_080086_10_492 160
65 3300049662 Ga0501222_005931 Ga0501222_005931_264_746 160
66 3300049663 Ga0501223_016442 Ga0501223_016442_267_749 160
67 3300049704 Ga0501221_015817 Ga0501221_015817_296_778 160
68 3300049706 Ga0501229_000249 Ga0501229_000249_4505_4987 160
69 3300050493 nmdc:mga0k408_317763_c1 nmdc:mga0k408_317763_c1_418_900 160
70 3300005330 Ga0070690_100220684 Ga0070690_1002206843 161
71 3300005353 Ga0070669_100376804 Ga0070669_1003768042 161
72 3300005367 Ga0070667_100027534 Ga0070667_1000275346 161
73 3300005459 Ga0068867_100588602 Ga0068867_1005886022 161
74 3300005543 Ga0070672_100156907 Ga0070672_1001569072 161
75 3300005548 Ga0070665_100303469 Ga0070665_1003034692 161
76 3300005548 Ga0070665_100606307 Ga0070665_1006063071 161
77 3300005617 Ga0068859_100406000 Ga0068859_1004060002 161
78 3300005834 Ga0068851_10047688 Ga0068851_100476883 161
79 3300005840 Ga0068870_10062422 Ga0068870_100624223 161
80 3300005841 Ga0068863_100605033 Ga0068863_1006050332 161
81 3300005843 Ga0068860_100099773 Ga0068860_1000997733 161
82 3300006177 Ga0075362_10033180 Ga0075362_100331802 161
83 3300006237 Ga0097621_100127786 Ga0097621_1001277862 161
84 3300006358 Ga0068871_100120278 Ga0068871_1001202783 161
85 3300006881 Ga0068865_101021136 Ga0068865_1010211361 161
86 3300006931 Ga0097620_100406008 Ga0097620_1004060083 161
87 3300009098 Ga0105245_10485593 Ga0105245_104855931 161
88 3300009176 Ga0105242_10454557 Ga0105242_104545572 161
89 3300011119 Ga0105246_10742460 Ga0105246_107424601 161
90 3300013296 Ga0157374_10091768 Ga0157374_100917683 161
91 3300013297 Ga0157378_10148686 Ga0157378_101486863 161
92 3300013306 Ga0163162_10101102 Ga0163162_101011023 161
93 3300013308 Ga0157375_10760307 Ga0157375_107603072 161
94 3300014325 Ga0163163_10004182 Ga0163163_1000418210 161
95 3300014325 Ga0163163_11011911 Ga0163163_110119111 161
96 3300014326 Ga0157380_10095641 Ga0157380_100956413 161
97 3300017792 Ga0163161_10004853 Ga0163161_100048534 161
98 3300017792 Ga0163161_10138081 Ga0163161_101380813 161
99 3300017792 Ga0163161_10371584 Ga0163161_103715842 161
100 3300025321 Ga0207656_10022539 Ga0207656_100225391 161
101 3300025903 Ga0207680_10043839 Ga0207680_100438393 161
102 3300025908 Ga0207643_10071058 Ga0207643_100710582 161
103 3300025923 Ga0207681_10217441 Ga0207681_102174412 161
104 3300025923 Ga0207681_11133662 Ga0207681_111336621 161
105 3300025926 Ga0207659_10002492 Ga0207659_100024924 161
106 3300025931 Ga0207644_10036181 Ga0207644_100361813 161
107 3300025933 Ga0207706_10084338 Ga0207706_100843383 161
108 3300025936 Ga0207670_10202421 Ga0207670_102024212 161
109 3300025937 Ga0207669_10187339 Ga0207669_101873392 161
110 3300025938 Ga0207704_10750755 Ga0207704_107507551 161
111 3300025940 Ga0207691_10152371 Ga0207691_101523713 161
112 3300025986 Ga0207658_10019916 Ga0207658_100199166 161
113 3300026067 Ga0207678_10151848 Ga0207678_101518483 161
114 3300026088 Ga0207641_10008687 Ga0207641_100086878 161
115 3300026089 Ga0207648_10142257 Ga0207648_101422573 161
116 3300026121 Ga0207683_10072087 Ga0207683_100720873 161
117 3300026142 Ga0207698_10705365 Ga0207698_107053652 161
118 3300028379 Ga0268266_10382765 Ga0268266_103827652 161
119 3300028381 Ga0268264_10121829 Ga0268264_101218293 161
120 3300028786 Ga0307517_10046677 Ga0307517_100466773 161
121 3300031247 Ga0265340_10206473 Ga0265340_102064731 161
122 3300031456 Ga0307513_10575214 Ga0307513_105752141 161
123 3300031507 Ga0307509_10347080 Ga0307509_103470802 161
124 3300031616 Ga0307508_10236145 Ga0307508_102361451 161
125 3300031616 Ga0307508_10335597 Ga0307508_103355971 161
126 3300031730 Ga0307516_10090180 Ga0307516_100901804 161
127 3300031730 Ga0307516_10269340 Ga0307516_102693402 161
128 3300032004 Ga0307414_10147855 Ga0307414_101478553 161
129 3300032005 Ga0307411_10589050 Ga0307411_105890502 161
130 3300041404 Ga0439436_0037395 Ga0439436_0037395_259_744 161
131 3300042015 Ga0439462_0036299 Ga0439462_0036299_477_962 161
132 3300042156 Ga0439446_0002979 Ga0439446_0002979_3239_3724 161
133 3300046455 Ga0495603_0295143 Ga0495603_0295143_66_551 161
134 3300046459 Ga0495629_0176874 Ga0495629_0176874_62_547 161
135 3300046460 Ga0495638_0160895 Ga0495638_0160895_61_546 161
136 3300046460 Ga0495638_0187590 Ga0495638_0187590_27_512 161
137 3300046475 Ga0495639_0442915 Ga0495639_0442915_48_533 161
138 3300046660 Ga0495625_0256635 Ga0495625_0256635_470_955 161
139 3300046679 Ga0495623_0536880 Ga0495623_0536880_15_527 161
140 3300046683 Ga0495658_0192311 Ga0495658_0192311_109_594 161
141 3300046683 Ga0495658_0276635 Ga0495658_0276635_368_853 161
142 3300048903 Ga0496100_0341428 Ga0496100_0341428_503_988 161
143 3300048907 Ga0496104_0382199 Ga0496104_0382199_435_920 161
144 3300048908 Ga0496105_0005715 Ga0496105_0005715_3369_3854 161
145 3300048917 Ga0496114_0216839 Ga0496114_0216839_843_1328 161
146 3300048917 Ga0496114_0543147 Ga0496114_0543147_163_648 161
147 3300048924 Ga0496121_0003714 Ga0496121_0003714_19241_19732 161
148 3300048927 Ga0496124_0383803 Ga0496124_0383803_418_909 161
149 3300048928 Ga0496125_0378511 Ga0496125_0378511_24_515 161
150 3300050489 nmdc:mga03683_4601_c2 nmdc:mga03683_4601_c2_1407_1907 161
151 3300050490 nmdc:mga03n38_81204_c1 nmdc:mga03n38_81204_c1_744_1244 161
152 3300050493 nmdc:mga0k408_129630_c1 nmdc:mga0k408_129630_c1_945_1430 161
153 3300053084 Ga0495595_0441510 Ga0495595_0441510_56_541 161
154 3300053088 Ga0500644_0001797 Ga0500644_0001797_4040_4525 161
155 3300003773 Ga0055537_1000024 Ga0055537_100002487 162
156 3300003784 Ga0055534_1000032 Ga0055534_100003293 162
157 3300003790 Ga0055528_1000966 Ga0055528_10009669 162
158 3300003790 Ga0055528_1028158 Ga0055528_10281581 162
159 3300005288 Ga0065714_10011768 Ga0065714_100117683 162
160 3300005290 Ga0065712_10465691 Ga0065712_104656911 162
161 3300005329 Ga0070683_100056555 Ga0070683_1000565552 162
162 3300005333 Ga0070677_10053896 Ga0070677_100538962 162
163 3300005339 Ga0070660_100425722 Ga0070660_1004257222 162
164 3300005354 Ga0070675_100154991 Ga0070675_1001549912 162
165 3300005366 Ga0070659_100018658 Ga0070659_1000186583 162
166 3300005436 Ga0070713_100000354 Ga0070713_10000035416 162
167 3300005439 Ga0070711_100059753 Ga0070711_1000597532 162
168 3300005445 Ga0070708_100273278 Ga0070708_1002732781 162
169 3300005445 Ga0070708_101418248 Ga0070708_1014182481 162
170 3300005457 Ga0070662_100050729 Ga0070662_1000507293 162
171 3300005457 Ga0070662_100330874 Ga0070662_1003308742 162
172 3300005459 Ga0068867_100012228 Ga0068867_1000122285 162
173 3300005459 Ga0068867_100435659 Ga0068867_1004356592 162
174 3300005536 Ga0070697_100470548 Ga0070697_1004705481 162
175 3300005536 Ga0070697_101579698 Ga0070697_1015796981 162
176 3300005539 Ga0068853_100040073 Ga0068853_1000400733 162
177 3300005539 Ga0068853_100134983 Ga0068853_1001349835 162
178 3300005543 Ga0070672_100022473 Ga0070672_1000224734 162
179 3300005543 Ga0070672_100051863 Ga0070672_1000518634 162
180 3300005577 Ga0068857_100025633 Ga0068857_1000256333 162
181 3300005577 Ga0068857_100396458 Ga0068857_1003964581 162
182 3300005578 Ga0068854_100061685 Ga0068854_1000616853 162
183 3300005578 Ga0068854_100168430 Ga0068854_1001684302 162
184 3300005578 Ga0068854_100393122 Ga0068854_1003931222 162
185 3300005617 Ga0068859_101000006 Ga0068859_1010000062 162
186 3300006038 Ga0075365_10211254 Ga0075365_102112542 162
187 3300006048 Ga0075363_100345888 Ga0075363_1003458882 162
188 3300006051 Ga0075364_10075780 Ga0075364_100757803 162
189 3300006058 Ga0075432_10118761 Ga0075432_101187612 162
190 3300006163 Ga0070715_10052686 Ga0070715_100526862 162
191 3300006195 Ga0075366_10003150 Ga0075366_100031503 162
192 3300006195 Ga0075366_10187311 Ga0075366_101873112 162
193 3300006195 Ga0075366_10340612 Ga0075366_103406122 162
194 3300006353 Ga0075370_10037398 Ga0075370_100373982 162
195 3300006353 Ga0075370_10133171 Ga0075370_101331712 162
196 3300006353 Ga0075370_10134881 Ga0075370_101348813 162
197 3300006353 Ga0075370_10172785 Ga0075370_101727852 162
198 3300006871 Ga0075434_100120027 Ga0075434_1001200273 162
199 3300006914 Ga0075436_100066246 Ga0075436_1000662461 162
200 3300006931 Ga0097620_100999976 Ga0097620_1009999761 162
201 3300006948 Ga0099826_10000060 Ga0099826_1000006028 162
202 3300009093 Ga0105240_10159984 Ga0105240_101599842 162
203 3300009148 Ga0105243_11209626 Ga0105243_112096261 162
204 3300009176 Ga0105242_11288435 Ga0105242_112884351 162
205 3300009177 Ga0105248_10190636 Ga0105248_101906362 162
206 3300009177 Ga0105248_12053382 Ga0105248_120533821 162
207 3300009545 Ga0105237_10799964 Ga0105237_107999642 162
208 3300009551 Ga0105238_10032025 Ga0105238_100320253 162
209 3300010375 Ga0105239_10912263 Ga0105239_109122632 162
210 3300011119 Ga0105246_10109160 Ga0105246_101091604 162
211 3300011119 Ga0105246_10410916 Ga0105246_104109162 162
212 3300013100 Ga0157373_10066827 Ga0157373_100668272 162
213 3300013102 Ga0157371_10025245 Ga0157371_100252453 162
214 3300013105 Ga0157369_10142239 Ga0157369_101422392 162
215 3300013296 Ga0157374_10240355 Ga0157374_102403551 162
216 3300013297 Ga0157378_10460464 Ga0157378_104604643 162
217 3300013306 Ga0163162_11671333 Ga0163162_116713331 162
218 3300014497 Ga0182008_10527408 Ga0182008_105274081 162
219 3300025263 Ga0209565_1000039 Ga0209565_100003993 162
220 3300025273 Ga0209673_1000284 Ga0209673_100028437 162
221 3300025273 Ga0209673_1010969 Ga0209673_10109693 162
222 3300025291 Ga0209675_1000030 Ga0209675_100003093 162
223 3300025292 Ga0209676_1043480 Ga0209676_10434801 162
224 3300025294 Ga0209025_1027189 Ga0209025_10271893 162
225 3300025299 Ga0209256_1017374 Ga0209256_10173743 162
226 3300025303 Ga0209051_1100523 Ga0209051_11005231 162
227 3300025321 Ga0207656_10035588 Ga0207656_100355883 162
228 3300025893 Ga0207682_10020397 Ga0207682_100203972 162
229 3300025905 Ga0207685_10145516 Ga0207685_101455161 162
230 3300025914 Ga0207671_11010196 Ga0207671_110101961 162
231 3300025916 Ga0207663_10253568 Ga0207663_102535682 162
232 3300025919 Ga0207657_10038357 Ga0207657_100383573 162
233 3300025919 Ga0207657_10433327 Ga0207657_104333272 162
234 3300025924 Ga0207694_10028071 Ga0207694_100280713 162
235 3300025926 Ga0207659_10247410 Ga0207659_102474102 162
236 3300025928 Ga0207700_10000042 Ga0207700_1000004249 162
237 3300025928 Ga0207700_10046915 Ga0207700_100469152 162
238 3300025933 Ga0207706_10008889 Ga0207706_100088893 162
239 3300025935 Ga0207709_10758658 Ga0207709_107586581 162
240 3300025940 Ga0207691_10062232 Ga0207691_100622323 162
241 3300025941 Ga0207711_11185065 Ga0207711_111850651 162
242 3300025942 Ga0207689_11115018 Ga0207689_111150182 162
243 3300025944 Ga0207661_10548899 Ga0207661_105488992 162
244 3300025981 Ga0207640_10003720 Ga0207640_100037207 162
245 3300025981 Ga0207640_11287717 Ga0207640_112877172 162
246 3300026041 Ga0207639_10041066 Ga0207639_100410663 162
247 3300026078 Ga0207702_10455126 Ga0207702_104551262 162
248 3300026089 Ga0207648_10485509 Ga0207648_104855092 162
249 3300026116 Ga0207674_10028856 Ga0207674_100288563 162
250 3300026116 Ga0207674_11382604 Ga0207674_113826041 162
251 3300027666 Ga0209282_1000200 Ga0209282_100020028 162
252 3300028794 Ga0307515_10000494 Ga0307515_1000049423 162
253 3300028794 Ga0307515_10009239 Ga0307515_1000923914 162
254 3300028794 Ga0307515_10082687 Ga0307515_100826874 162
255 3300028794 Ga0307515_10170950 Ga0307515_101709501 162
256 3300028800 Ga0265338_10536592 Ga0265338_105365921 162
257 3300030522 Ga0307512_10068043 Ga0307512_100680433 162
258 3300030742 Ga0316183_1055656 Ga0316183_10556562 162
259 3300030744 Ga0316181_1015265 Ga0316181_10152653 162
260 3300030745 Ga0316182_1055903 Ga0316182_10559032 162
261 3300030760 Ga0265762_1014174 Ga0265762_10141742 162
262 3300031507 Ga0307509_10000539 Ga0307509_1000053940 162
263 3300031507 Ga0307509_10072227 Ga0307509_100722272 162
264 3300031548 Ga0307408_100063098 Ga0307408_1000630982 162
265 3300031548 Ga0307408_100086886 Ga0307408_1000868864 162
266 3300031548 Ga0307408_100163198 Ga0307408_1001631981 162
267 3300031616 Ga0307508_10000096 Ga0307508_1000009636 162
268 3300031649 Ga0307514_10001231 Ga0307514_1000123131 162
269 3300031649 Ga0307514_10351129 Ga0307514_103511292 162
270 3300031730 Ga0307516_10354710 Ga0307516_103547102 162
271 3300031911 Ga0307412_10111493 Ga0307412_101114932 162
272 3300031911 Ga0307412_10679616 Ga0307412_106796162 162
273 3300033180 Ga0307510_10003423 Ga0307510_100034233 162
274 3300033180 Ga0307510_10268142 Ga0307510_102681423 162
275 3300035118 Ga0373954_0373190 Ga0373954_0373190_118_630 162
276 3300035692 Ga0373935_0546657 Ga0373935_0546657_280_768 162
277 3300035695 Ga0373927_0101859 Ga0373927_0101859_82_570 162
278 3300036401 Ga0373937_0310763 Ga0373937_0310763_932_1423 162
279 3300036401 Ga0373937_0503464 Ga0373937_0503464_118_630 162
280 3300041501 Ga0451845_0372831 Ga0451845_0372831_238_726 162
281 3300042008 Ga0439450_085492 Ga0439450_085492_40_528 162
282 3300042439 Ga0439464_0000864 Ga0439464_0000864_1613_2101 162
283 3300042461 Ga0439460_0050819 Ga0439460_0050819_680_1168 162
284 3300044712 Ga0453684_0145668 Ga0453684_0145668_12_500 162
285 3300044735 Ga0466968_0321227 Ga0466968_0321227_15_503 162
286 3300045051 Ga0451576_0422154 Ga0451576_0422154_54_542 162
287 3300046454 Ga0495592_0001842 Ga0495592_0001842_11735_12223 162
288 3300046459 Ga0495629_0572389 Ga0495629_0572389_101_589 162
289 3300046524 Ga0495648_0300800 Ga0495648_0300800_18_506 162
290 3300046680 Ga0495646_0129244 Ga0495646_0129244_624_1112 162
291 3300046683 Ga0495658_0160983 Ga0495658_0160983_131_619 162
292 3300048907 Ga0496104_0009677 Ga0496104_0009677_5743_6255 162
293 3300048908 Ga0496105_0008178 Ga0496105_0008178_1535_2047 162
294 3300048917 Ga0496114_0132627 Ga0496114_0132627_1520_2032 162
295 3300049515 Ga0501292_000649 Ga0501292_000649_1095_1583 162
296 3300049517 Ga0501294_005705 Ga0501294_005705_481_969 162
297 3300049521 Ga0501298_013683 Ga0501298_013683_51_539 162
298 3300049666 Ga0501228_035337 Ga0501228_035337_30_518 162
299 3300049686 Ga0501257_011650 Ga0501257_011650_1084_1572 162
300 3300049762 Ga0501265_000809 Ga0501265_000809_164_652 162
301 3300049774 Ga0501278_002450 Ga0501278_002450_359_847 162
302 3300050489 nmdc:mga03683_218344_c1 nmdc:mga03683_218344_c1_50_538 162
303 3300050493 nmdc:mga0k408_415463_c1 nmdc:mga0k408_415463_c1_20_508 162
304 3300050493 nmdc:mga0k408_41621_c1 nmdc:mga0k408_41621_c1_1725_2228 162
305 3300050493 nmdc:mga0k408_423409_c1 nmdc:mga0k408_423409_c1_203_706 162
306 3300050493 nmdc:mga0k408_595_c2 nmdc:mga0k408_595_c2_17227_17730 162
307 3300050494 nmdc:mga06z11_840865_c1 nmdc:mga06z11_840865_c1_22_528 162
308 3300050496 nmdc:mga07m45_30356_c1 nmdc:mga07m45_30356_c1_278_766 162
309 3300050496 nmdc:mga07m45_49910_c1 nmdc:mga07m45_49910_c1_428_934 162
310 3300050512 nmdc:mga0n895_477305_c1 nmdc:mga0n895_477305_c1_627_1118 162
311 3300050514 nmdc:mga08x19_133226_c1 nmdc:mga08x19_133226_c1_1108_1599 162
312 3300050515 nmdc:mga0a205_39992_c1 nmdc:mga0a205_39992_c1_841_1332 162
313 3300053093 Ga0500651_0343774 Ga0500651_0343774_335_823 162
314 3300053156 Ga0500622_0004660 Ga0500622_0004660_1359_1847 162
315 3300053161 Ga0500634_0050967 Ga0500634_0050967_1428_1916 162
316 3300005328 Ga0070676_10002126 Ga0070676_100021267 163
317 3300005329 Ga0070683_100058603 Ga0070683_1000586032 163
318 3300005334 Ga0068869_100011559 Ga0068869_1000115593 163
319 3300005338 Ga0068868_100155238 Ga0068868_1001552382 163
320 3300005339 Ga0070660_100012911 Ga0070660_1000129115 163
321 3300005343 Ga0070687_100053513 Ga0070687_1000535132 163
322 3300005344 Ga0070661_100084219 Ga0070661_1000842193 163
323 3300005345 Ga0070692_10085496 Ga0070692_100854962 163
324 3300005353 Ga0070669_100009250 Ga0070669_1000092504 163
325 3300005354 Ga0070675_100161966 Ga0070675_1001619663 163
326 3300005367 Ga0070667_100036537 Ga0070667_1000365373 163
327 3300005441 Ga0070700_100098425 Ga0070700_1000984251 163
328 3300005455 Ga0070663_100168608 Ga0070663_1001686082 163
329 3300005456 Ga0070678_100529336 Ga0070678_1005293361 163
330 3300005457 Ga0070662_100084458 Ga0070662_1000844582 163
331 3300005459 Ga0068867_100039561 Ga0068867_1000395612 163
332 3300005535 Ga0070684_100497905 Ga0070684_1004979052 163
333 3300005539 Ga0068853_100330876 Ga0068853_1003308762 163
334 3300005563 Ga0068855_100393423 Ga0068855_1003934232 163
335 3300005616 Ga0068852_100994213 Ga0068852_1009942132 163
336 3300005617 Ga0068859_100116413 Ga0068859_1001164132 163
337 3300005618 Ga0068864_100012571 Ga0068864_1000125716 163
338 3300005618 Ga0068864_101383900 Ga0068864_1013839001 163
339 3300005719 Ga0068861_100005189 Ga0068861_1000051898 163
340 3300005840 Ga0068870_10016697 Ga0068870_100166973 163
341 3300005841 Ga0068863_100675434 Ga0068863_1006754342 163
342 3300005842 Ga0068858_100135174 Ga0068858_1001351742 163
343 3300005843 Ga0068860_100071343 Ga0068860_1000713433 163
344 3300006358 Ga0068871_100513242 Ga0068871_1005132422 163
345 3300006881 Ga0068865_100091220 Ga0068865_1000912203 163
346 3300006931 Ga0097620_100116410 Ga0097620_1001164102 163
347 3300009094 Ga0111539_10178146 Ga0111539_101781462 163
348 3300009148 Ga0105243_10213221 Ga0105243_102132212 163
349 3300009174 Ga0105241_10084377 Ga0105241_100843772 163
350 3300009177 Ga0105248_10009179 Ga0105248_100091791 163
351 3300009551 Ga0105238_11003399 Ga0105238_110033991 163
352 3300009553 Ga0105249_10000569 Ga0105249_100005694 163
353 3300009553 Ga0105249_11083444 Ga0105249_110834442 163
354 3300013102 Ga0157371_10258903 Ga0157371_102589032 163
355 3300013296 Ga0157374_10058511 Ga0157374_100585113 163
356 3300013306 Ga0163162_10033731 Ga0163162_100337313 163
357 3300013306 Ga0163162_10213487 Ga0163162_102134872 163
358 3300013307 Ga0157372_10094958 Ga0157372_100949582 163
359 3300014326 Ga0157380_10009129 Ga0157380_100091295 163
360 3300014326 Ga0157380_10044081 Ga0157380_100440812 163
361 3300017792 Ga0163161_10035355 Ga0163161_100353553 163
362 3300017792 Ga0163161_10082475 Ga0163161_100824751 163
363 3300025315 Ga0207697_10045534 Ga0207697_100455342 163
364 3300025901 Ga0207688_10151691 Ga0207688_101516912 163
365 3300025907 Ga0207645_10011545 Ga0207645_100115456 163
366 3300025914 Ga0207671_10349354 Ga0207671_103493542 163
367 3300025918 Ga0207662_10251795 Ga0207662_102517951 163
368 3300025920 Ga0207649_10142807 Ga0207649_101428072 163
369 3300025923 Ga0207681_10032317 Ga0207681_100323173 163
370 3300025924 Ga0207694_10225409 Ga0207694_102254092 163
371 3300025926 Ga0207659_10076750 Ga0207659_100767503 163
372 3300025927 Ga0207687_10150824 Ga0207687_101508241 163
373 3300025932 Ga0207690_10562072 Ga0207690_105620722 163
374 3300025933 Ga0207706_10005161 Ga0207706_100051614 163
375 3300025938 Ga0207704_10217864 Ga0207704_102178642 163
376 3300025942 Ga0207689_10001974 Ga0207689_1000197416 163
377 3300025944 Ga0207661_10102901 Ga0207661_101029012 163
378 3300025945 Ga0207679_10777047 Ga0207679_107770471 163
379 3300025961 Ga0207712_10012913 Ga0207712_100129133 163
380 3300026023 Ga0207677_10408679 Ga0207677_104086792 163
381 3300026035 Ga0207703_10284764 Ga0207703_102847642 163
382 3300026067 Ga0207678_10131623 Ga0207678_101316232 163
383 3300026075 Ga0207708_10023978 Ga0207708_100239784 163
384 3300026075 Ga0207708_10060490 Ga0207708_100604903 163
385 3300026078 Ga0207702_10103635 Ga0207702_101036352 163
386 3300026088 Ga0207641_10598225 Ga0207641_105982252 163
387 3300026089 Ga0207648_10070394 Ga0207648_100703942 163
388 3300026095 Ga0207676_10377507 Ga0207676_103775071 163
389 3300026095 Ga0207676_10626560 Ga0207676_106265601 163
390 3300026116 Ga0207674_10050033 Ga0207674_100500336 163
391 3300026118 Ga0207675_100001938 Ga0207675_10000193816 163
392 3300026118 Ga0207675_100083851 Ga0207675_1000838513 163
393 3300026121 Ga0207683_10630202 Ga0207683_106302022 163
394 3300026142 Ga0207698_10219974 Ga0207698_102199742 163
395 3300028381 Ga0268264_10142931 Ga0268264_101429312 163
396 3300028381 Ga0268264_10804598 Ga0268264_108045982 163
397 3300035115 Ga0373941_0168374 Ga0373941_0168374_262_753 163
398 3300035691 Ga0373931_0003874 Ga0373931_0003874_1380_1871 163
399 3300044656 Ga0466969_0000007 Ga0466969_0000007_63001_63495 163
400 3300045049 Ga0466959_0010140 Ga0466959_0010140_31_525 163
401 3300046472 Ga0495580_0392266 Ga0495580_0392266_227_718 163
402 3300046473 Ga0495582_0000735 Ga0495582_0000735_14621_15112 163
403 3300046683 Ga0495658_0001903 Ga0495658_0001903_1738_2229 163
404 3300048904 Ga0496101_0073045 Ga0496101_0073045_497_988 163
405 3300048905 Ga0496102_0042644 Ga0496102_0042644_1100_1591 163
406 3300048906 Ga0496103_0510190 Ga0496103_0510190_202_693 163
407 3300048908 Ga0496105_0331156 Ga0496105_0331156_650_1141 163
408 3300048909 Ga0496106_0205695 Ga0496106_0205695_383_874 163
409 3300048910 Ga0496107_0008125 Ga0496107_0008125_4940_5431 163
410 3300048911 Ga0496108_0151169 Ga0496108_0151169_497_988 163
411 3300048912 Ga0496109_0493766 Ga0496109_0493766_581_1072 163
412 3300048913 Ga0496110_0128942 Ga0496110_0128942_307_798 163
413 3300048914 Ga0496111_0011766 Ga0496111_0011766_1271_1762 163
414 3300048916 Ga0496113_0413339 Ga0496113_0413339_347_838 163
415 3300048918 Ga0496115_0067730 Ga0496115_0067730_510_1001 163
416 3300003752 Ga0055539_1000431 Ga0055539_100043111 164
417 3300003756 Ga0055533_1000053 Ga0055533_1000053147 164
418 3300003759 Ga0055525_1000904 Ga0055525_10009048 164
419 3300005457 Ga0070662_100077524 Ga0070662_1000775243 164
420 3300005577 Ga0068857_100032310 Ga0068857_1000323104 164
421 3300005616 Ga0068852_100320618 Ga0068852_1003206181 164
422 3300005841 Ga0068863_100339918 Ga0068863_1003399182 164
423 3300009098 Ga0105245_10351175 Ga0105245_103511752 164
424 3300009545 Ga0105237_10059483 Ga0105237_100594833 164
425 3300009545 Ga0105237_10210082 Ga0105237_102100822 164
426 3300010375 Ga0105239_10652476 Ga0105239_106524762 164
427 3300013308 Ga0157375_10644805 Ga0157375_106448052 164
428 3300014745 Ga0157377_10012006 Ga0157377_100120064 164
429 3300025226 Ga0209674_100039 Ga0209674_10003947 164
430 3300025230 Ga0209563_100080 Ga0209563_10008047 164
431 3300025253 Ga0209677_100086 Ga0209677_10008647 164
432 3300025914 Ga0207671_10027936 Ga0207671_100279362 164
433 3300025933 Ga0207706_10044023 Ga0207706_100440236 164
434 3300026142 Ga0207698_10152496 Ga0207698_101524963 164
435 3300041491 Ga0451833_0293784 Ga0451833_0293784_42_536 164
436 3300044683 Ga0466965_0137763 Ga0466965_0137763_379_873 164
437 3300044901 Ga0466960_0228235 Ga0466960_0228235_13_507 164
438 3300050493 nmdc:mga0k408_8383_c1 nmdc:mga0k408_8383_c1_614_1108 164
439 3300005335 Ga0070666_10131553 Ga0070666_101315532 165
440 3300006881 Ga0068865_100090950 Ga0068865_1000909503 165
441 3300009177 Ga0105248_11189808 Ga0105248_111898082 165
442 3300009545 Ga0105237_10056123 Ga0105237_100561235 165
443 3300009553 Ga0105249_12200326 Ga0105249_122003261 165
444 3300013306 Ga0163162_10133434 Ga0163162_101334342 165
445 3300014326 Ga0157380_10649974 Ga0157380_106499742 165
446 3300014968 Ga0157379_10073305 Ga0157379_100733053 165
447 3300014968 Ga0157379_10178067 Ga0157379_101780672 165
448 3300025940 Ga0207691_10120956 Ga0207691_101209562 165
449 3300028381 Ga0268264_10098843 Ga0268264_100988433 165
450 3300028786 Ga0307517_10010923 Ga0307517_1001092320 165
451 3300031649 Ga0307514_10153233 Ga0307514_101532333 165
452 3300037068 Ga0373925_0217508 Ga0373925_0217508_51_566 165
453 3300045051 Ga0451576_0021520 Ga0451576_0021520_3638_4156 165
454 3300047472 Ga0495686_0286517 Ga0495686_0286517_136_648 165
455 3300048903 Ga0496100_0467897 Ga0496100_0467897_363_953 165
456 3300053108 Ga0500562_005799 Ga0500562_005799_1734_2246 165
457 3300053118 Ga0500594_0015901 Ga0500594_0015901_1131_1643 165
458 3300053131 Ga0500652_103671 Ga0500652_103671_192_704 165
459 3300053136 Ga0500559_0000278 Ga0500559_0000278_30917_31429 165
460 3300053156 Ga0500622_0000413 Ga0500622_0000413_31396_31908 165
461 3300053736 Ga0500599_012565 Ga0500599_012565_448_960 165
462 3300005549 Ga0070704_100442518 Ga0070704_1004425182 166
463 3300009176 Ga0105242_10070260 Ga0105242_100702604 166
464 3300009176 Ga0105242_10237406 Ga0105242_102374062 166
465 3300009553 Ga0105249_10003872 Ga0105249_1000387212 166
466 3300013306 Ga0163162_10012159 Ga0163162_100121593 166
467 3300014326 Ga0157380_10013980 Ga0157380_100139802 166
468 3300025934 Ga0207686_10174068 Ga0207686_101740683 166
469 3300002741 JGI25157J39369_1001041 JGI25157J39369_10010418 167
470 3300003320 rootH2_10012260 rootH2_100122607 167
471 3300003320 rootH2_10111248 rootH2_101112482 167
472 3300003752 Ga0055539_1013020 Ga0055539_10130202 167
473 3300005329 Ga0070683_100818544 Ga0070683_1008185442 167
474 3300005330 Ga0070690_100021702 Ga0070690_1000217026 167
475 3300005334 Ga0068869_100010105 Ga0068869_1000101056 167
476 3300005339 Ga0070660_100810723 Ga0070660_1008107231 167
477 3300005539 Ga0068853_100044626 Ga0068853_1000446265 167
478 3300005577 Ga0068857_100092003 Ga0068857_1000920033 167
479 3300005578 Ga0068854_100160660 Ga0068854_1001606603 167
480 3300005614 Ga0068856_100036308 Ga0068856_1000363086 167
481 3300005719 Ga0068861_100031611 Ga0068861_1000316113 167
482 3300009174 Ga0105241_10417827 Ga0105241_104178272 167
483 3300009176 Ga0105242_10020541 Ga0105242_100205415 167
484 3300009551 Ga0105238_10429979 Ga0105238_104299791 167
485 3300010375 Ga0105239_10014663 Ga0105239_100146634 167
486 3300011119 Ga0105246_10079023 Ga0105246_100790233 167
487 3300013105 Ga0157369_11300399 Ga0157369_113003992 167
488 3300013297 Ga0157378_10140719 Ga0157378_101407193 167
489 3300013307 Ga0157372_11273651 Ga0157372_112736512 167
490 3300025246 Ga0209646_1000076 Ga0209646_1000076115 167
491 3300025250 Ga0209026_1000011 Ga0209026_1000011299 167
492 3300025253 Ga0209677_100308 Ga0209677_10030810 167
493 3300025256 Ga0209759_1000034 Ga0209759_1000034177 167
494 3300025919 Ga0207657_10402372 Ga0207657_104023722 167
495 3300025924 Ga0207694_10448911 Ga0207694_104489112 167
496 3300025934 Ga0207686_10259800 Ga0207686_102598003 167
497 3300025981 Ga0207640_10011731 Ga0207640_100117316 167
498 3300026041 Ga0207639_10029330 Ga0207639_100293303 167
499 3300026078 Ga0207702_10000629 Ga0207702_1000062928 167
500 3300026116 Ga0207674_10003424 Ga0207674_1000342417 167
501 3300026118 Ga0207675_100007765 Ga0207675_10000776510 167
502 3300037466 Ga0395898_0019622 Ga0395898_0019622_1825_2328 167
503 3300038443 Ga0395901_0005935 Ga0395901_0005935_1332_1835 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

84

189

0.92

PF07366

SnoaL

SnoaL-like polyketide cyclase

82

195

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bng-assembly1.cif.gz_B structure of an m.tuberculosis leh-like epoxide hydrolase 0.6926 46 160
5tpj-assembly1.cif.gz_A crystal structure of a de novo designed protein with curved beta-sheet 0.6925 50 160
2bng-assembly1.cif.gz_C-2 structure of an m.tuberculosis leh-like epoxide hydrolase 0.6904 45 160
4xdv-assembly2.cif.gz_E crystal structure of the l74f/m78v/i80v/l114f mutant of leh complexed with cyclohexanediol 0.6796 35 160
3g0k-assembly1.cif.gz_A-2 crystal structure of a protein of unknown function with a cystatin-like fold (saro_2880) from novosphingobium aromaticivorans dsm at 1.30 a resolution 0.6779 42 167
ID Description Score Start End Superfamily
af_B0S750_62_245_1.20.870.10 Mainly Alpha;Up-down Bundle;Son of sevenless (SoS) protein; Chain S, domain 1;Son of sevenless (SoS) protein Chain: S domain 1 0.7593 111 147 1.20.870.10
4kvhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7391 48 166 3.10.450.50
af_Q4CRZ1_58_338_2.120.10.10 Mainly Beta;6 Propeller;Neuraminidase; 0.7291 116 157 2.120.10.10
af_Q54S79_439_628_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7281 122 153 2.130.10.10
4kvhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.727 48 166 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1A8TEE5-F1-model_v4 SnoaL-like domain protein 0.9707 26 166 GO:0030638
AF-A0A349Z003-F1-model_v4 SnoaL-like domain-containing protein 0.9697 27 167 GO:0030638
AF-A0A3N7JVE8-F1-model_v4 SnoaL-like domain-containing protein 0.9668 26 167 GO:0030638
AF-A0A7K1SFG3-F1-model_v4 Uncharacterized protein 0.9614 64 128
AF-A0A8A7W0I0-F1-model_v4 deleted 0.9601 26 167

Feature Viewer

pLDDT pTM Quality
92.48 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map