F456059

General Info

Members Datasets Scaffolds Average Seq Length
503 357 1006 356

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0001218|Ga0451577_0001218_32940_34163
Length 407
Sequence MAIKRPVARARNLRCNLHKRSRPIASRRERIETGHRERQVMTETFYDVMRRQGITRRNFLKYCSLTAASLGFGPAYAQQIAKALETKPRMPVVWLHGLECTCCTESFIRSAHPLAKDVILSMISLDFDDTIMAAAGDQAIAALEDTISKYKGNYILAVEGNPPLNEDGMFCMPRGKPFVEKLKHVAKDARAVIAWGSCASWGCVQAAKPNPTMAVPIDKVITDKPIIKVPGCPPIAEVMSAVVTFVAAFDRIPELDRQGRPKMFYSQRIHDKCYRRPHFDAGQFVEEWDDFGARAGYCLYKIGCKGPTTYNSCSTTRWNERISFPIESGHGCIGCSEDGFWDKGSFYDRLTNIKAFGVEANADRVGLVVGGVAGAAIAAHAAVGALQRASNRGKTNAVAETTKAGGE

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
101 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
102 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
103 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
119 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
120 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
130 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
131 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
132 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
138 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
144 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
148 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
149 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
150 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
151 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
152 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
196 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
200 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
201 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
202 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
203 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
204 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
205 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
206 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
207 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
208 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
209 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
210 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
211 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
212 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
213 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
214 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
215 2516143018 Ensifer sp. BR816 Isolate Nodule
216 2519103095 Burkholderia sp. KJ006 Isolate Nodule
217 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
218 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
219 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
220 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
221 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
222 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
223 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
224 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
225 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
226 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
227 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
228 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
229 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
230 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
231 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
232 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
233 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
234 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
235 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
236 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
237 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
238 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
239 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
240 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
241 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
242 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
243 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
244 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
245 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
246 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
247 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
248 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
249 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
250 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
251 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
252 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
253 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
254 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
255 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
256 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
257 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
258 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
259 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
260 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
261 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
262 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
263 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
264 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
265 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
266 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
267 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
268 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
269 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
270 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
271 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
272 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
273 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
274 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
275 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
276 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
277 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
278 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
279 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
280 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
281 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
282 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
283 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
284 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
285 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
286 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
287 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
288 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
289 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
290 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
291 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
292 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
293 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
294 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
295 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
296 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
297 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
298 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
299 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
300 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
301 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
302 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
303 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
304 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
305 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
306 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
307 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
308 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
309 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
310 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
311 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
312 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
313 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
314 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
315 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
316 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
317 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
318 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
319 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
320 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
321 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
322 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
323 3004167301 Mesorhizobium loti 582 Isolate Unclassified
324 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
325 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
326 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
327 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
328 639633007 Azoarcus olearius BH72 Isolate Unclassified
329 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
330 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
331 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
332 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
333 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
334 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
335 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
336 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
337 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
338 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
339 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
340 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
341 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
342 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
343 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
344 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
345 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
346 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
347 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
348 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
349 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
350 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
351 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
352 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
353 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
354 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
355 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
356 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
357 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.19
Metatranscriptomes 0.4
Isolates 31.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.58
Nodule 20.08
Rhizoplane 2.98
Rhizosphere 60.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0001218 3300042876 Bacteria 35907
2 JGI25153J46596_10000150 3300003215 Bacteria 70192
3 JGI25153J46596_10000180 3300003215 Bacteria 62334
4 Ga0055540_1000617 3300003792 Bacteria 25319
5 Ga0055540_1013072 3300003792 Bacteria 2560
6 Ga0055531_10009278 3300003794 Bacteria 5051
7 Ga0055543_1003851 3300004625 Bacteria 4253
8 Ga0065165_1001625 3300005262 Bacteria 22861
9 Ga0065165_1003965 3300005262 Bacteria 9698
10 Ga0070676_10000393 3300005328 Bacteria 20308
11 Ga0070670_100155415 3300005331 Bacteria 1981
12 Ga0068869_100048140 3300005334 Bacteria 3081
13 Ga0070666_10006476 3300005335 Bacteria 7200
14 Ga0070666_10024451 3300005335 Bacteria 3935
15 Ga0070666_10041628 3300005335 Bacteria 3071
16 Ga0068868_100037298 3300005338 Bacteria 3767
17 Ga0068868_100137470 3300005338 Bacteria 2004
18 Ga0070689_100074609 3300005340 Bacteria 2654
19 Ga0070687_100010275 3300005343 Bacteria 4042
20 Ga0070687_100044884 3300005343 Bacteria 2254
21 Ga0070668_100003780 3300005347 Bacteria 11184
22 Ga0070669_100001443 3300005353 Bacteria 17220
23 Ga0070669_100158773 3300005353 Bacteria 1755
24 Ga0070675_100008300 3300005354 Bacteria 8057
25 Ga0070675_100013438 3300005354 Bacteria 6435
26 Ga0070675_100023126 3300005354 Bacteria 4967
27 Ga0070671_100049116 3300005355 Bacteria 3510
28 Ga0070674_100002913 3300005356 Bacteria 9480
29 Ga0070673_100008382 3300005364 Bacteria 6871
30 Ga0070673_100102334 3300005364 Bacteria 2361
31 Ga0070688_100166522 3300005365 Bacteria 1518
32 Ga0070659_100290440 3300005366 Bacteria 1362
33 Ga0070667_100000887 3300005367 Bacteria 27641
34 Ga0070678_100029659 3300005456 Bacteria 3749
35 Ga0070662_100015855 3300005457 Bacteria 5055
36 Ga0068867_100003067 3300005459 Bacteria 11772
37 Ga0068867_100069700 3300005459 Bacteria 2626
38 Ga0070672_100008958 3300005543 Bacteria 6878
39 Ga0070672_100009355 3300005543 Bacteria 6751
40 Ga0070672_100019910 3300005543 Bacteria 4882
41 Ga0070686_100168170 3300005544 Bacteria 1549
42 Ga0068852_100086358 3300005616 Bacteria 2797
43 Ga0068859_100082469 3300005617 Bacteria 3258
44 Ga0068864_100001415 3300005618 Bacteria 19823
45 Ga0068864_100026433 3300005618 Bacteria 4895
46 Ga0068864_100084460 3300005618 Bacteria 2790
47 Ga0068866_10004654 3300005718 Bacteria 5631
48 Ga0068861_100018220 3300005719 Bacteria 4998
49 Ga0068863_100004468 3300005841 Bacteria 13789
50 Ga0068863_100257549 3300005841 Bacteria 1686
51 Ga0068858_100004458 3300005842 Bacteria 13724
52 Ga0068860_100011639 3300005843 Bacteria 8678
53 Ga0068862_100110557 3300005844 Bacteria 2411
54 Ga0075366_10057163 3300006195 Bacteria 2318
55 Ga0068871_100087019 3300006358 Bacteria 2597
56 Ga0097620_100082468 3300006931 Bacteria 3258
57 Ga0105247_10225838 3300009101 Bacteria 1269
58 Ga0105243_10004700 3300009148 Bacteria 10751
59 Ga0105248_10004043 3300009177 Bacteria 16206
60 Ga0105248_10028921 3300009177 Bacteria 6178
61 Ga0105237_10002315 3300009545 Bacteria 23664
62 Ga0105238_10356769 3300009551 Bacteria 1451
63 Ga0105249_10131415 3300009553 Bacteria 2391
64 Ga0123341_1033858 3300009765 Bacteria 3668
65 Ga0105239_10174477 3300010375 Bacteria 2404
66 Ga0157374_10058334 3300013296 Bacteria 3607
67 Ga0157378_10063125 3300013297 Bacteria 3309
68 Ga0163162_10016781 3300013306 Bacteria 7159
69 Ga0163162_10063788 3300013306 Bacteria 3728
70 Ga0157375_10065712 3300013308 Bacteria 3617
71 Ga0157375_10068813 3300013308 Bacteria 3544
72 Ga0163163_10004302 3300014325 Bacteria 12130
73 Ga0163163_10037177 3300014325 Bacteria 4735
74 Ga0157380_10004665 3300014326 Bacteria 9538
75 Ga0157380_10011783 3300014326 Bacteria 6324
76 Ga0182008_10008018 3300014497 Bacteria 5787
77 Ga0157379_10008120 3300014968 Bacteria 9116
78 Ga0157379_10014031 3300014968 Bacteria 7022
79 Ga0157379_10066865 3300014968 Bacteria 3213
80 Ga0182006_1000266 3300015261 Bacteria 47778
81 Ga0163161_10013368 3300017792 Bacteria 5711
82 Ga0163161_10038902 3300017792 Bacteria 3412
83 Ga0213872_10001299 3300021361 Bacteria 16642
84 Ga0209564_1007353 3300025295 Bacteria 5703
85 Ga0209758_1000024 3300025297 Bacteria 591966
86 Ga0209758_1000068 3300025297 Bacteria 286488
87 Ga0209256_1004080 3300025299 Bacteria 9483
88 Ga0209051_1000049 3300025303 Bacteria 287483
89 Ga0209051_1001129 3300025303 Bacteria 24438
90 Ga0209257_1001033 3300025304 Bacteria 37252
91 Ga0207696_1000003 3300025711 Bacteria 860639
92 Ga0207682_10021607 3300025893 Bacteria 2533
93 Ga0207642_10008696 3300025899 Bacteria 3498
94 Ga0207680_10010985 3300025903 Bacteria 4556
95 Ga0207680_10023388 3300025903 Bacteria 3374
96 Ga0207680_10063211 3300025903 Bacteria 2265
97 Ga0207645_10001199 3300025907 Bacteria 21383
98 Ga0207671_10003143 3300025914 Bacteria 16762
99 Ga0207662_10030966 3300025918 Bacteria 3108
100 Ga0207657_10160486 3300025919 Bacteria 1826
101 Ga0207681_10007235 3300025923 Bacteria 6805
102 Ga0207694_10262157 3300025924 Bacteria 1416
103 Ga0207650_10097542 3300025925 Bacteria 2256
104 Ga0207659_10029004 3300025926 Bacteria 3766
105 Ga0207659_10130674 3300025926 Bacteria 1938
106 Ga0207659_10155157 3300025926 Bacteria 1791
107 Ga0207706_10032818 3300025933 Bacteria 4621
108 Ga0207706_10042940 3300025933 Bacteria 4007
109 Ga0207709_10044760 3300025935 Bacteria 2677
110 Ga0207669_10011243 3300025937 Bacteria 4348
111 Ga0207691_10000478 3300025940 Bacteria 39659
112 Ga0207691_10025267 3300025940 Bacteria 5578
113 Ga0207691_10027238 3300025940 Bacteria 5362
114 Ga0207711_10002213 3300025941 Bacteria 17466
115 Ga0207711_10086435 3300025941 Bacteria 2749
116 Ga0207689_10011324 3300025942 Bacteria 7651
117 Ga0207689_10033976 3300025942 Bacteria 4236
118 Ga0207679_10293735 3300025945 Bacteria 1398
119 Ga0207651_10006032 3300025960 Bacteria 6290
120 Ga0207668_10013820 3300025972 Bacteria 4984
121 Ga0207677_10012105 3300026023 Bacteria 4945
122 Ga0207677_10015226 3300026023 Bacteria 4516
123 Ga0207677_10022626 3300026023 Bacteria 3866
124 Ga0207703_10010796 3300026035 Bacteria 7125
125 Ga0207703_10013536 3300026035 Bacteria 6355
126 Ga0207703_10251131 3300026035 Bacteria 1594
127 Ga0207639_10072248 3300026041 Bacteria 2701
128 Ga0207678_10113745 3300026067 Bacteria 2309
129 Ga0207641_10013482 3300026088 Bacteria 6703
130 Ga0207641_10176331 3300026088 Bacteria 1954
131 Ga0207648_10002309 3300026089 Bacteria 20583
132 Ga0207648_10157597 3300026089 Bacteria 2004
133 Ga0207676_10040770 3300026095 Bacteria 3560
134 Ga0207676_10068800 3300026095 Bacteria 2833
135 Ga0207674_10443132 3300026116 Bacteria 1255
136 Ga0207675_100057446 3300026118 Bacteria 3631
137 Ga0207683_10018082 3300026121 Bacteria 6011
138 Ga0207698_10027582 3300026142 Bacteria 4034
139 Ga0268266_10246262 3300028379 Bacteria 1652
140 Ga0268264_10018560 3300028381 Bacteria 5689
141 Ga0268264_10029862 3300028381 Bacteria 4468
142 Ga0265319_1002940 3300028563 Bacteria 9070
143 Ga0265334_10000361 3300028573 Bacteria 24442
144 Ga0265318_10007974 3300028577 Bacteria 4750
145 Ga0265323_10000433 3300028653 Bacteria 23943
146 Ga0265322_10002926 3300028654 Bacteria 5200
147 Ga0265336_10000097 3300028666 Bacteria 66270
148 Ga0265336_10000302 3300028666 Bacteria 33498
149 Ga0307517_10096258 3300028786 Bacteria 2373
150 Ga0307515_10000014 3300028794 Bacteria 562358
151 Ga0265338_10000104 3300028800 Bacteria 156596
152 Ga0265338_10000161 3300028800 Bacteria 122364
153 Ga0265338_10003197 3300028800 Bacteria 23360
154 Ga0265324_10000001 3300029957 Bacteria 562975
155 Ga0265324_10008179 3300029957 Bacteria 4176
156 Ga0265324_10020300 3300029957 Bacteria 2388
157 Ga0265330_10000062 3300031235 Bacteria 95409
158 Ga0265330_10032772 3300031235 Bacteria 2327
159 Ga0265332_10000001 3300031238 Bacteria 863783
160 Ga0265332_10000339 3300031238 Bacteria 35321
161 Ga0265332_10004009 3300031238 Bacteria 7004
162 Ga0265328_10000071 3300031239 Bacteria 54442
163 Ga0265328_10001187 3300031239 Bacteria 12056
164 Ga0265328_10001393 3300031239 Bacteria 11137
165 Ga0265328_10004053 3300031239 Bacteria 6412
166 Ga0265328_10004713 3300031239 Bacteria 5894
167 Ga0265328_10024553 3300031239 Bacteria 2275
168 Ga0265328_10033135 3300031239 Bacteria 1916
169 Ga0265320_10001569 3300031240 Bacteria 16419
170 Ga0265325_10001227 3300031241 Bacteria 18265
171 Ga0265329_10009083 3300031242 Bacteria 3729
172 Ga0265340_10033036 3300031247 Bacteria 2578
173 Ga0265331_10000097 3300031250 Bacteria 119610
174 Ga0265331_10000554 3300031250 Bacteria 33793
175 Ga0265331_10003879 3300031250 Bacteria 9457
176 Ga0265331_10003988 3300031250 Bacteria 9326
177 Ga0265331_10118287 3300031250 Bacteria 1212
178 Ga0265327_10000326 3300031251 Bacteria 90862
179 Ga0265327_10000424 3300031251 Bacteria 77145
180 Ga0265327_10001313 3300031251 Bacteria 32413
181 Ga0265327_10002143 3300031251 Bacteria 21796
182 Ga0265327_10008477 3300031251 Bacteria 7646
183 Ga0265327_10009241 3300031251 Bacteria 7147
184 Ga0265327_10023399 3300031251 Bacteria 3660
185 Ga0265327_10073280 3300031251 Bacteria 1708
186 Ga0265316_10000062 3300031344 Bacteria 113912
187 Ga0265316_10037018 3300031344 Bacteria 3943
188 Ga0265316_10082686 3300031344 Bacteria 2460
189 Ga0265316_10152051 3300031344 Bacteria 1733
190 Ga0307514_10001865 3300031649 Bacteria 23265
191 Ga0316575_10001277 3300031665 Bacteria 8018
192 Ga0316575_10018992 3300031665 Bacteria 2624
193 Ga0316575_10027897 3300031665 Bacteria 2198
194 Ga0316579_10108310 3300031691 Bacteria 1333
195 Ga0265314_10000145 3300031711 Bacteria 106541
196 Ga0265314_10013504 3300031711 Bacteria 6593
197 Ga0265314_10023641 3300031711 Bacteria 4679
198 Ga0265342_10008758 3300031712 Bacteria 7217
199 Ga0316576_10001718 3300031727 Bacteria 12041
200 Ga0316576_10003426 3300031727 Bacteria 9282
201 Ga0316576_10013277 3300031727 Bacteria 5467
202 Ga0316576_10029606 3300031727 Bacteria 3872
203 Ga0316576_10054467 3300031727 Bacteria 2917
204 Ga0316576_10078370 3300031727 Bacteria 2449
205 Ga0316576_10088631 3300031727 Bacteria 2303
206 Ga0316576_10153328 3300031727 Bacteria 1736
207 Ga0316578_10002063 3300031728 Bacteria 8587
208 Ga0316578_10003378 3300031728 Bacteria 7283
209 Ga0316578_10013977 3300031728 Bacteria 4271
210 Ga0316578_10024849 3300031728 Bacteria 3364
211 Ga0307516_10000045 3300031730 Bacteria 132787
212 Ga0307516_10037777 3300031730 Bacteria 4824
213 Ga0316577_10003932 3300031733 Bacteria 7591
214 Ga0316577_10005492 3300031733 Bacteria 6647
215 Ga0307412_10069513 3300031911 Bacteria 2397
216 Ga0307414_10019849 3300032004 Bacteria 4174
217 Ga0316583_10003566 3300032133 Bacteria 5493
218 Ga0316585_10002811 3300032137 Bacteria 4732
219 Ga0316580_10000281 3300032139 Bacteria 10978
220 Ga0316580_10000524 3300032139 Bacteria 8884
221 Ga0316586_1013122 3300033527 Bacteria 1293
222 Ga0316588_1008356 3300033528 Bacteria 2128
223 Ga0373932_0010994 3300035112 Bacteria 2203
224 Ga0373943_0062692 3300035170 Bacteria 1862
225 Ga0373955_0059480 3300035172 Bacteria 2105
226 Ga0373962_0018273 3300035242 Bacteria 1823
227 Ga0316574_0003264 3300035398 Bacteria 8330
228 Ga0316574_0013319 3300035398 Bacteria 4722
229 Ga0316574_0014042 3300035398 Bacteria 4618
230 Ga0316574_0020264 3300035398 Bacteria 3935
231 Ga0316574_0020732 3300035398 Bacteria 3893
232 Ga0316574_0021758 3300035398 Bacteria 3811
233 Ga0316574_0070687 3300035398 Bacteria 2204
234 Ga0316574_0091483 3300035398 Bacteria 1940
235 Ga0373931_0001033 3300035691 Bacteria 11770
236 Ga0373931_0133244 3300035691 Bacteria 1432
237 Ga0373935_0022681 3300035692 Bacteria 3853
238 Ga0373927_0097621 3300035695 Bacteria 1910
239 Ga0373937_0034939 3300036401 Bacteria 4573
240 Ga0316582_0002562 3300036647 Bacteria 8603
241 Ga0316582_0002929 3300036647 Bacteria 8209
242 Ga0316582_0003978 3300036647 Bacteria 7381
243 Ga0316582_0017756 3300036647 Bacteria 4125
244 Ga0316582_0077802 3300036647 Bacteria 2160
245 Ga0316584_0015904 3300036712 Bacteria 5389
246 Ga0316584_0021360 3300036712 Bacteria 4704
247 Ga0316584_0026583 3300036712 Bacteria 4255
248 Ga0373925_0030595 3300037068 Bacteria 3952
249 Ga0395905_0120508 3300037471 Bacteria 2466
250 Ga0400490_19791 3300038726 Bacteria 50140
251 Ga0400491_03189 3300038727 Bacteria 26612
252 Ga0400485_07611 3300038735 Bacteria 2586
253 Ga0400488_17409 3300038741 Bacteria 1445
254 Ga0400488_48434 3300038741 Bacteria 7344
255 Ga0400483_139513 3300039062 Bacteria 13214
256 Ga0400483_202939 3300039062 Bacteria 1395
257 Ga0400487_53906 3300039110 Bacteria 25837
258 Ga0436361_0472389 3300039447 Bacteria 28663
259 Ga0436361_0500419 3300039447 Bacteria 18953
260 Ga0451798_0757322 3300041458 Bacteria 1681
261 Ga0451853_1153182 3300041512 Bacteria 1720
262 Ga0439464_0038008 3300042439 Bacteria 1367
263 Ga0439460_0033083 3300042461 Bacteria 1484
264 Ga0451577_0000002 3300042876 Bacteria 1731375
265 Ga0451577_0000184 3300042876 Bacteria 132503
266 Ga0451577_0000235 3300042876 Bacteria 109693
267 Ga0451577_0018355 3300042876 Bacteria 6446
268 Ga0451577_0021540 3300042876 Bacteria 5896
269 Ga0451577_0043927 3300042876 Bacteria 4001
270 Ga0451577_0052041 3300042876 Bacteria 3656
271 Ga0451577_0074155 3300042876 Bacteria 3035
272 Ga0451577_0078834 3300042876 Bacteria 2936
273 Ga0451577_0140959 3300042876 Bacteria 2166
274 Ga0453683_0000011 3300044673 Bacteria 412765
275 Ga0453684_0000002 3300044712 Bacteria 1731375
276 Ga0453684_0000040 3300044712 Bacteria 690210
277 Ga0453684_0000906 3300044712 Bacteria 98768
278 Ga0453684_0001929 3300044712 Bacteria 53615
279 Ga0453684_0004720 3300044712 Bacteria 28190
280 Ga0453684_0022832 3300044712 Bacteria 9261
281 Ga0453684_0028763 3300044712 Bacteria 7913
282 Ga0453684_0041535 3300044712 Bacteria 6218
283 Ga0453684_0075094 3300044712 Bacteria 4251
284 Ga0453684_0089259 3300044712 Bacteria 3813
285 Ga0453684_0168148 3300044712 Bacteria 2586
286 Ga0453684_0188914 3300044712 Bacteria 2411
287 Ga0453684_0452227 3300044712 Bacteria 1429
288 Ga0451576_0000004 3300045051 Bacteria 1312238
289 Ga0451576_0000131 3300045051 Bacteria 190667
290 Ga0451576_0000184 3300045051 Bacteria 157166
291 Ga0451576_0004755 3300045051 Bacteria 17429
292 Ga0451576_0009566 3300045051 Bacteria 11225
293 Ga0451576_0103691 3300045051 Bacteria 2958
294 Ga0451576_0109414 3300045051 Bacteria 2876
295 Ga0451576_0127572 3300045051 Bacteria 2651
296 Ga0451576_0129413 3300045051 Bacteria 2631
297 Ga0451576_0357190 3300045051 Bacteria 1530
298 Ga0495580_0125269 3300046472 Bacteria 1783
299 Ga0495652_0104854 3300046529 Bacteria 2286
300 Ga0495640_0071075 3300046533 Bacteria 2336
301 Ga0495645_0057342 3300046543 Bacteria 2827
302 Ga0495647_0015711 3300046681 Bacteria 2657
303 Ga0495604_0007303 3300047317 Bacteria 8749
304 Ga0495673_0018142 3300047469 Bacteria 3556
305 Ga0496103_0095356 3300048906 Bacteria 1880
306 Ga0496104_0000191 3300048907 Bacteria 55466
307 Ga0496104_0005644 3300048907 Bacteria 10956
308 Ga0496104_0028502 3300048907 Bacteria 5175
309 Ga0496105_0000652 3300048908 Bacteria 23235
310 Ga0496105_0030815 3300048908 Bacteria 4396
311 Ga0496106_0027718 3300048909 Bacteria 4220
312 Ga0496106_0189509 3300048909 Bacteria 1635
313 Ga0496108_0101631 3300048911 Bacteria 2453
314 Ga0496109_0360693 3300048912 Bacteria 1373
315 Ga0496112_0041257 3300048915 Bacteria 4514
316 Ga0496113_0008594 3300048916 Bacteria 6659
317 Ga0496115_0129938 3300048918 Bacteria 2076
318 Ga0496115_0221957 3300048918 Bacteria 1559
319 Ga0496117_0000125 3300048920 Bacteria 168885
320 Ga0496118_0000016 3300048921 Bacteria 549586
321 Ga0496119_0000249 3300048922 Bacteria 76081
322 Ga0496119_0029066 3300048922 Bacteria 3758
323 Ga0496124_0019438 3300048927 Bacteria 6321
324 Ga0496125_0000122 3300048928 Bacteria 174898
325 Ga0496126_0000719 3300048929 Bacteria 60201
326 Ga0496126_0008641 3300048929 Bacteria 10947
327 Ga0496126_0052867 3300048929 Bacteria 3688
328 Ga0501036_0191190 3300049572 Bacteria 1722
329 Ga0501039_0007508 3300049575 Bacteria 8327
330 Ga0501042_0025731 3300049578 Bacteria 4135
331 Ga0501071_0210374 3300049587 Bacteria 1462
332 Ga0501072_0006022 3300049588 Bacteria 9246
333 Ga0501075_0000093 3300049591 Bacteria 41092
334 Ga0501076_0012952 3300049592 Bacteria 6243
335 Ga0501076_0035856 3300049592 Bacteria 3882
336 Ga0501079_0003861 3300049741 Bacteria 11056
337 Ga0501081_0186353 3300049743 Bacteria 1502
338 Ga0501035_0000513 3300049822 Bacteria 43481
339 Ga0501045_0094618 3300049824 Bacteria 2210
340 Ga0495601_0177573 3300053077 Bacteria 1392
341 Ga0500572_000865 3300053111 Bacteria 9388
342 Ga0500559_0000184 3300053136 Bacteria 49756
343 Ga0501084_0014321 3300054114 Bacteria 6571
344 Ga0501082_0008157 3300060353 Bacteria 9035
345 Ga0530510_0000686 3300061734 Bacteria 21870
346 2501069471 2501025501 Bacteria 7768574
347 2501411705 2501025504 Bacteria 8008976
348 2507506703 2507262055 Bacteria 8048963
349 2511109202 2510917015 Bacteria 7950052
350 2512034972 2511231221 Bacteria 6846400
351 2512531126 2512047086 Bacteria 6850303
352 2513572792 2513237084 Bacteria 7231967
353 2513592296 2513237087 Bacteria 5817514
354 2513695585 2513237101 Bacteria 7952346
355 2513720986 2513237104 Bacteria 10034502
356 2513885741 2513237140 Bacteria 7076289
357 2513930134 2513237146 Bacteria 7166346
358 2514590525 2513237351 Bacteria 6968952
359 2515612667 2515154107 Bacteria 6795637
360 2516025425 2515154189 Bacteria 9629850
361 2516209940 2516143018 Bacteria 6951533
362 2519462723 2519103095 Bacteria 6629912
363 2523105967 2522572158 Bacteria 6514390
364 2524441379 2524023205 Bacteria 8918781
365 2526211334 2526164512 Bacteria 4025691
366 2574429555 2574179768 Bacteria 4907129
367 2585291800 2582581311 Bacteria 6763856
368 2587759797 2585428062 Bacteria 6842168
369 2599414140 2599185170 Bacteria 7295545
370 2723571786 2721755686 Bacteria 7343952
371 2723843986 2721755755 Bacteria 8322773
372 2725952265 2724679232 Bacteria 7646494
373 2728749685 2728368998 Bacteria 8720350
374 2739347759 2738543031 Bacteria 5769731
375 2745079997 2744054633 Bacteria 8678936
376 2776914944 2775507049 Bacteria 6284736
377 2792624246 2791355091 Bacteria 6135441
378 2792630386 2791355092 Bacteria 6248105
379 2792841454 2791355137 Bacteria 9654227
380 2793060717 2791355196 Bacteria 7323613
381 2805922523 2802429603 Bacteria 8777136
382 2817262601 2816332253 Bacteria 6764532
383 2817276328 2816332256 Bacteria 6891714
384 2817453770 2816332286 Bacteria 6853759
385 2818238516 2816332527 Bacteria 8933356
386 2824680656 2824679649 Bacteria 8248951
387 2828306709 2828305725 Bacteria 4916900
388 2838042069 2838035591 Bacteria 7166484
389 2838665441 2838661181 Bacteria 7385261
390 2841962502 2841957949 Bacteria 8652217
391 2844322819 2844315083 Bacteria 8138177
392 2852392517 2852387548 Bacteria 8025568
393 2856289687 2856287931 Bacteria 7223934
394 2857364419 2857357740 Bacteria 9937880
395 2870074192 2870068957 Bacteria 8925310
396 2874172855 2874168670 Bacteria 8062617
397 2874614042 2874612657 Bacteria 8252029
398 2874626535 2874620515 Bacteria 8290088
399 2876811995 2876808645 Bacteria 8824342
400 2879100414 2879099564 Bacteria 10442239
401 2879113951 2879110137 Bacteria 8907982
402 2885312467 2885305155 Bacteria 7348390
403 2885333489 2885326080 Bacteria 7134805
404 2885369521 2885366525 Bacteria 8326213
405 2885382276 2885374607 Bacteria 8927485
406 2885389786 2885383462 Bacteria 9473874
407 2888381169 2888378607 Bacteria 9652610
408 2889041847 2889033259 Bacteria 9099371
409 2891092623 2891088606 Bacteria 4762464
410 2891633843 2891633521 Bacteria 4602265
411 2894513380 2894510363 Bacteria 5121143
412 2896390531 2896384573 Bacteria 7700774
413 2897804481 2897803580 Bacteria 7000062
414 2898796354 2898795034 Bacteria 4294459
415 2899806945 2899803654 Bacteria 5577784
416 2903734665 2903727486 Bacteria 8281579
417 2904671876 2904666416 Bacteria 8226587
418 2906605024 2906602504 Bacteria 8295279
419 2906629265 2906626472 Bacteria 8826946
420 2913298640 2913295892 Bacteria 6333755
421 2919139979 2919138771 Bacteria 5281312
422 2920767091 2920760137 Bacteria 7427611
423 2922366337 2922361189 Bacteria 7436256
424 2922386605 2922386360 Bacteria 7017218
425 2932792776 2932784394 Bacteria 9704911
426 2932801145 2932794094 Bacteria 7915132
427 2932809123 2932801729 Bacteria 7987968
428 2932815996 2932809354 Bacteria 9135765
429 2932825330 2932818245 Bacteria 9955613
430 2932834939 2932828146 Bacteria 9745859
431 2933019733 2933016740 Bacteria 6355406
432 2935613907 2935608549 Bacteria 8203142
433 2935625110 2935616580 Bacteria 9032984
434 2935647356 2935638405 Bacteria 10015038
435 2935652658 2935648319 Bacteria 8801166
436 2935661357 2935656913 Bacteria 8965014
437 2935673787 2935665750 Bacteria 9571747
438 2935712702 2935703347 Bacteria 10242284
439 2935785185 2935777560 Bacteria 8077691
440 2935809624 2935801545 Bacteria 9301974
441 2935818621 2935810662 Bacteria 9401221
442 2935836755 2935827899 Bacteria 10038562
443 2935843499 2935837841 Bacteria 9454360
444 2935863739 2935855204 Bacteria 9035059
445 2935873499 2935864058 Bacteria 9784707
446 2935882089 2935873716 Bacteria 9632195
447 2935889661 2935883170 Bacteria 7964738
448 2935916073 2935908558 Bacteria 8568796
449 2935924974 2935916978 Bacteria 9113783
450 2935933556 2935926038 Bacteria 8601059
451 2935942079 2935934488 Bacteria 8602579
452 2935950532 2935942939 Bacteria 8599779
453 2935958992 2935951376 Bacteria 8602333
454 2935967082 2935959822 Bacteria 7869783
455 2935975048 2935967501 Bacteria 8603075
456 2935991373 2935984226 Bacteria 8302647
457 2935999960 2935992306 Bacteria 9802711
458 2936015644 2936011229 Bacteria 8801034
459 2936024278 2936019824 Bacteria 8804134
460 2936033529 2936028420 Bacteria 8965941
461 2936045344 2936037263 Bacteria 9446081
462 2936051387 2936046547 Bacteria 8903709
463 2936063505 2936055302 Bacteria 8785755
464 2939575051 2939573065 Bacteria 4926053
465 2941547321 2941538514 Bacteria 9402094
466 2968085836 2968083720 Bacteria 7351627
467 2989395096 2989392574 Bacteria 4554005
468 2998346369 2998344455 Bacteria 4222996
469 3004174993 3004167301 Bacteria 8330599
470 3004341958 3004334049 Bacteria 8449246
471 3005589804 3005587118 Bacteria 7794411
472 3005602586 3005594810 Bacteria 8716512
473 3005726056 3005718088 Bacteria 8283608
474 639788953 639633007 Bacteria 4376040
475 642598903 642555112 Bacteria 8676562
476 8006970915 8006964411 Bacteria 8966052
477 8006990293 8006984368 Bacteria 9651211
478 8006999322 8006994254 Bacteria 8309700
479 8016512216 8016511872 Bacteria 9921665
480 8016527368 8016522445 Bacteria 8156687
481 8016532459 8016530956 Bacteria 8155261
482 8016545679 8016539877 Bacteria 8155419
483 8016556425 8016548790 Bacteria 8155074
484 8016564782 8016557553 Bacteria 8154380
485 8016583272 8016575299 Bacteria 8154085
486 8016602441 8016595262 Bacteria 8149947
487 8016617260 8016613128 Bacteria 8794220
488 8017066812 8017057580 Bacteria 10023680
489 8018130827 8018127388 Bacteria 7351159
490 8019532274 8019530166 Bacteria 8155624
491 8019585792 8019576017 Bacteria 10049540
492 8019593779 8019586578 Bacteria 10212056
493 8019597697 8019597564 Bacteria 10041141
494 8019610684 8019608314 Bacteria 10042931
495 8019650924 8019648815 Bacteria 10014479
496 8019692918 8019687851 Bacteria 8712826
497 8020809758 8020807995 Bacteria 6801506
498 8040178252 8040173305 Bacteria 6827067
499 8046771001 8046767195 Bacteria 7547379
500 8054008934 8054002106 Bacteria 7987183
501 8056680060 8056673599 Bacteria 7871253
502 8056976520 8056967851 Bacteria 9038162
503 8057580026 8057575449 Bacteria 7367519
504 Ga0451577_0001218
505 JGI25153J46596_10000150
506 JGI25153J46596_10000180
507 Ga0055540_1000617
508 Ga0055540_1013072
509 Ga0055531_10009278
510 Ga0055543_1003851
511 Ga0065165_1001625
512 Ga0065165_1003965
513 Ga0070676_10000393
514 Ga0070670_100155415
515 Ga0068869_100048140
516 Ga0070666_10006476
517 Ga0070666_10024451
518 Ga0070666_10041628
519 Ga0068868_100037298
520 Ga0068868_100137470
521 Ga0070689_100074609
522 Ga0070687_100010275
523 Ga0070687_100044884
524 Ga0070668_100003780
525 Ga0070669_100001443
526 Ga0070669_100158773
527 Ga0070675_100008300
528 Ga0070675_100013438
529 Ga0070675_100023126
530 Ga0070671_100049116
531 Ga0070674_100002913
532 Ga0070673_100008382
533 Ga0070673_100102334
534 Ga0070688_100166522
535 Ga0070659_100290440
536 Ga0070667_100000887
537 Ga0070678_100029659
538 Ga0070662_100015855
539 Ga0068867_100003067
540 Ga0068867_100069700
541 Ga0070672_100008958
542 Ga0070672_100009355
543 Ga0070672_100019910
544 Ga0070686_100168170
545 Ga0068852_100086358
546 Ga0068859_100082469
547 Ga0068864_100001415
548 Ga0068864_100026433
549 Ga0068864_100084460
550 Ga0068866_10004654
551 Ga0068861_100018220
552 Ga0068863_100004468
553 Ga0068863_100257549
554 Ga0068858_100004458
555 Ga0068860_100011639
556 Ga0068862_100110557
557 Ga0075366_10057163
558 Ga0068871_100087019
559 Ga0097620_100082468
560 Ga0105247_10225838
561 Ga0105243_10004700
562 Ga0105248_10004043
563 Ga0105248_10028921
564 Ga0105237_10002315
565 Ga0105238_10356769
566 Ga0105249_10131415
567 Ga0123341_1033858
568 Ga0105239_10174477
569 Ga0157374_10058334
570 Ga0157378_10063125
571 Ga0163162_10016781
572 Ga0163162_10063788
573 Ga0157375_10065712
574 Ga0157375_10068813
575 Ga0163163_10004302
576 Ga0163163_10037177
577 Ga0157380_10004665
578 Ga0157380_10011783
579 Ga0182008_10008018
580 Ga0157379_10008120
581 Ga0157379_10014031
582 Ga0157379_10066865
583 Ga0182006_1000266
584 Ga0163161_10013368
585 Ga0163161_10038902
586 Ga0213872_10001299
587 Ga0209564_1007353
588 Ga0209758_1000024
589 Ga0209758_1000068
590 Ga0209256_1004080
591 Ga0209051_1000049
592 Ga0209051_1001129
593 Ga0209257_1001033
594 Ga0207696_1000003
595 Ga0207682_10021607
596 Ga0207642_10008696
597 Ga0207680_10010985
598 Ga0207680_10023388
599 Ga0207680_10063211
600 Ga0207645_10001199
601 Ga0207671_10003143
602 Ga0207662_10030966
603 Ga0207657_10160486
604 Ga0207681_10007235
605 Ga0207694_10262157
606 Ga0207650_10097542
607 Ga0207659_10029004
608 Ga0207659_10130674
609 Ga0207659_10155157
610 Ga0207706_10032818
611 Ga0207706_10042940
612 Ga0207709_10044760
613 Ga0207669_10011243
614 Ga0207691_10000478
615 Ga0207691_10025267
616 Ga0207691_10027238
617 Ga0207711_10002213
618 Ga0207711_10086435
619 Ga0207689_10011324
620 Ga0207689_10033976
621 Ga0207679_10293735
622 Ga0207651_10006032
623 Ga0207668_10013820
624 Ga0207677_10012105
625 Ga0207677_10015226
626 Ga0207677_10022626
627 Ga0207703_10010796
628 Ga0207703_10013536
629 Ga0207703_10251131
630 Ga0207639_10072248
631 Ga0207678_10113745
632 Ga0207641_10013482
633 Ga0207641_10176331
634 Ga0207648_10002309
635 Ga0207648_10157597
636 Ga0207676_10040770
637 Ga0207676_10068800
638 Ga0207674_10443132
639 Ga0207675_100057446
640 Ga0207683_10018082
641 Ga0207698_10027582
642 Ga0268266_10246262
643 Ga0268264_10018560
644 Ga0268264_10029862
645 Ga0265319_1002940
646 Ga0265334_10000361
647 Ga0265318_10007974
648 Ga0265323_10000433
649 Ga0265322_10002926
650 Ga0265336_10000097
651 Ga0265336_10000302
652 Ga0307517_10096258
653 Ga0307515_10000014
654 Ga0265338_10000104
655 Ga0265338_10000161
656 Ga0265338_10003197
657 Ga0265324_10000001
658 Ga0265324_10008179
659 Ga0265324_10020300
660 Ga0265330_10000062
661 Ga0265330_10032772
662 Ga0265332_10000001
663 Ga0265332_10000339
664 Ga0265332_10004009
665 Ga0265328_10000071
666 Ga0265328_10001187
667 Ga0265328_10001393
668 Ga0265328_10004053
669 Ga0265328_10004713
670 Ga0265328_10024553
671 Ga0265328_10033135
672 Ga0265320_10001569
673 Ga0265325_10001227
674 Ga0265329_10009083
675 Ga0265340_10033036
676 Ga0265331_10000097
677 Ga0265331_10000554
678 Ga0265331_10003879
679 Ga0265331_10003988
680 Ga0265331_10118287
681 Ga0265327_10000326
682 Ga0265327_10000424
683 Ga0265327_10001313
684 Ga0265327_10002143
685 Ga0265327_10008477
686 Ga0265327_10009241
687 Ga0265327_10023399
688 Ga0265327_10073280
689 Ga0265316_10000062
690 Ga0265316_10037018
691 Ga0265316_10082686
692 Ga0265316_10152051
693 Ga0307514_10001865
694 Ga0316575_10001277
695 Ga0316575_10018992
696 Ga0316575_10027897
697 Ga0316579_10108310
698 Ga0265314_10000145
699 Ga0265314_10013504
700 Ga0265314_10023641
701 Ga0265342_10008758
702 Ga0316576_10001718
703 Ga0316576_10003426
704 Ga0316576_10013277
705 Ga0316576_10029606
706 Ga0316576_10054467
707 Ga0316576_10078370
708 Ga0316576_10088631
709 Ga0316576_10153328
710 Ga0316578_10002063
711 Ga0316578_10003378
712 Ga0316578_10013977
713 Ga0316578_10024849
714 Ga0307516_10000045
715 Ga0307516_10037777
716 Ga0316577_10003932
717 Ga0316577_10005492
718 Ga0307412_10069513
719 Ga0307414_10019849
720 Ga0316583_10003566
721 Ga0316585_10002811
722 Ga0316580_10000281
723 Ga0316580_10000524
724 Ga0316586_1013122
725 Ga0316588_1008356
726 Ga0373932_0010994
727 Ga0373943_0062692
728 Ga0373955_0059480
729 Ga0373962_0018273
730 Ga0316574_0003264
731 Ga0316574_0013319
732 Ga0316574_0014042
733 Ga0316574_0020264
734 Ga0316574_0020732
735 Ga0316574_0021758
736 Ga0316574_0070687
737 Ga0316574_0091483
738 Ga0373931_0001033
739 Ga0373931_0133244
740 Ga0373935_0022681
741 Ga0373927_0097621
742 Ga0373937_0034939
743 Ga0316582_0002562
744 Ga0316582_0002929
745 Ga0316582_0003978
746 Ga0316582_0017756
747 Ga0316582_0077802
748 Ga0316584_0015904
749 Ga0316584_0021360
750 Ga0316584_0026583
751 Ga0373925_0030595
752 Ga0395905_0120508
753 Ga0400490_19791
754 Ga0400491_03189
755 Ga0400485_07611
756 Ga0400488_17409
757 Ga0400488_48434
758 Ga0400483_139513
759 Ga0400483_202939
760 Ga0400487_53906
761 Ga0436361_0472389
762 Ga0436361_0500419
763 Ga0451798_0757322
764 Ga0451853_1153182
765 Ga0439464_0038008
766 Ga0439460_0033083
767 Ga0451577_0000002
768 Ga0451577_0000184
769 Ga0451577_0000235
770 Ga0451577_0018355
771 Ga0451577_0021540
772 Ga0451577_0043927
773 Ga0451577_0052041
774 Ga0451577_0074155
775 Ga0451577_0078834
776 Ga0451577_0140959
777 Ga0453683_0000011
778 Ga0453684_0000002
779 Ga0453684_0000040
780 Ga0453684_0000906
781 Ga0453684_0001929
782 Ga0453684_0004720
783 Ga0453684_0022832
784 Ga0453684_0028763
785 Ga0453684_0041535
786 Ga0453684_0075094
787 Ga0453684_0089259
788 Ga0453684_0168148
789 Ga0453684_0188914
790 Ga0453684_0452227
791 Ga0451576_0000004
792 Ga0451576_0000131
793 Ga0451576_0000184
794 Ga0451576_0004755
795 Ga0451576_0009566
796 Ga0451576_0103691
797 Ga0451576_0109414
798 Ga0451576_0127572
799 Ga0451576_0129413
800 Ga0451576_0357190
801 Ga0495580_0125269
802 Ga0495652_0104854
803 Ga0495640_0071075
804 Ga0495645_0057342
805 Ga0495647_0015711
806 Ga0495604_0007303
807 Ga0495673_0018142
808 Ga0496103_0095356
809 Ga0496104_0000191
810 Ga0496104_0005644
811 Ga0496104_0028502
812 Ga0496105_0000652
813 Ga0496105_0030815
814 Ga0496106_0027718
815 Ga0496106_0189509
816 Ga0496108_0101631
817 Ga0496109_0360693
818 Ga0496112_0041257
819 Ga0496113_0008594
820 Ga0496115_0129938
821 Ga0496115_0221957
822 Ga0496117_0000125
823 Ga0496118_0000016
824 Ga0496119_0000249
825 Ga0496119_0029066
826 Ga0496124_0019438
827 Ga0496125_0000122
828 Ga0496126_0000719
829 Ga0496126_0008641
830 Ga0496126_0052867
831 Ga0501036_0191190
832 Ga0501039_0007508
833 Ga0501042_0025731
834 Ga0501071_0210374
835 Ga0501072_0006022
836 Ga0501075_0000093
837 Ga0501076_0012952
838 Ga0501076_0035856
839 Ga0501079_0003861
840 Ga0501081_0186353
841 Ga0501035_0000513
842 Ga0501045_0094618
843 Ga0495601_0177573
844 Ga0500572_000865
845 Ga0500559_0000184
846 Ga0501084_0014321
847 Ga0501082_0008157
848 Ga0530510_0000686
849 2501069471
850 2501411705
851 2507506703
852 2511109202
853 2512034972
854 2512531126
855 2513572792
856 2513592296
857 2513695585
858 2513720986
859 2513885741
860 2513930134
861 2514590525
862 2515612667
863 2516025425
864 2516209940
865 2519462723
866 2523105967
867 2524441379
868 2526211334
869 2574429555
870 2585291800
871 2587759797
872 2599414140
873 2723571786
874 2723843986
875 2725952265
876 2728749685
877 2739347759
878 2745079997
879 2776914944
880 2792624246
881 2792630386
882 2792841454
883 2793060717
884 2805922523
885 2817262601
886 2817276328
887 2817453770
888 2818238516
889 2824680656
890 2828306709
891 2838042069
892 2838665441
893 2841962502
894 2844322819
895 2852392517
896 2856289687
897 2857364419
898 2870074192
899 2874172855
900 2874614042
901 2874626535
902 2876811995
903 2879100414
904 2879113951
905 2885312467
906 2885333489
907 2885369521
908 2885382276
909 2885389786
910 2888381169
911 2889041847
912 2891092623
913 2891633843
914 2894513380
915 2896390531
916 2897804481
917 2898796354
918 2899806945
919 2903734665
920 2904671876
921 2906605024
922 2906629265
923 2913298640
924 2919139979
925 2920767091
926 2922366337
927 2922386605
928 2932792776
929 2932801145
930 2932809123
931 2932815996
932 2932825330
933 2932834939
934 2933019733
935 2935613907
936 2935625110
937 2935647356
938 2935652658
939 2935661357
940 2935673787
941 2935712702
942 2935785185
943 2935809624
944 2935818621
945 2935836755
946 2935843499
947 2935863739
948 2935873499
949 2935882089
950 2935889661
951 2935916073
952 2935924974
953 2935933556
954 2935942079
955 2935950532
956 2935958992
957 2935967082
958 2935975048
959 2935991373
960 2935999960
961 2936015644
962 2936024278
963 2936033529
964 2936045344
965 2936051387
966 2936063505
967 2939575051
968 2941547321
969 2968085836
970 2989395096
971 2998346369
972 3004174993
973 3004341958
974 3005589804
975 3005602586
976 3005726056
977 639788953
978 642598903
979 8006970915
980 8006990293
981 8006999322
982 8016512216
983 8016527368
984 8016532459
985 8016545679
986 8016556425
987 8016564782
988 8016583272
989 8016602441
990 8016617260
991 8017066812
992 8018130827
993 8019532274
994 8019585792
995 8019593779
996 8019597697
997 8019610684
998 8019650924
999 8019692918
1000 8020809758
1001 8040178252
1002 8046771001
1003 8054008934
1004 8056680060
1005 8056976520
1006 8057580026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14720

NiFe_hyd_SSU_C

NiFe/NiFeSe hydrogenase small subunit C-terminal

265

348

0.96

PF01058

Oxidored_q6

NADH ubiquinone oxidoreductase, 20 Kd subunit

100

246

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cc1-assembly1.cif.gz_S crystal structure of a reduced, active form of the ni-fe-se hydrogenase from desulfomicrobium baculatum 0.7625 52 251
8dqv-assembly1.cif.gz_B the 1.52 angstrom cryoem structure of the [nife]-hydrogenase huc from mycobacterium smegmatis - catalytic dimer (huc2s2l) 0.6916 53 253
6rtp-assembly1.cif.gz_A the 3d structure of [nifese] hydrogenase g50t variant from desulfovibrio vulgaris hildenborough at 1.10 angstrom resolution 0.6276 49 291
3ze6-assembly1.cif.gz_A 3d structure of the ni-fe-se hydrogenase from d. vulgaris hildenborough in the as-isolated oxidized state at 1.50 angstroms 0.6219 52 291
4c3o-assembly3.cif.gz_D structure and function of an oxygen tolerant nife hydrogenase from salmonella 0.6094 51 310
ID Description Score Start End Superfamily
5mdjS01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit 0.8447 52 227 3.40.50.700
5mdjS01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit 0.8401 52 227 3.40.50.700
5xvbS01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit 0.8379 52 224 3.40.50.700
1cc1S01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit 0.836 52 224 3.40.50.700
3myrC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit 0.8261 52 224 3.40.50.700
ID Description Score Start End GO Terms
AF-A0A376YCN4-F1-model_v4 hydrogenase (acceptor) (EC 1.12.99.6) (NiFe hydrogenase) 0.8786 95 192 GO:0005886
GO:0008901
GO:0009055
GO:0009061
GO:0009375
GO:0033748
GO:0044569
GO:0051538
AF-Q53159-F1-model_v4 Hydrogenase 0.8635 88 159 GO:0008901
GO:0009055
GO:0009061
GO:0009375
GO:0016020
GO:0044569
GO:0051536
AF-A0A836T4Z8-F1-model_v4 deleted 0.8598 5 229
AF-A0A2N7XSU9-F1-model_v4 hydrogenase (acceptor) (EC 1.12.99.6) 0.8577 95 175 GO:0008901
GO:0009055
GO:0009061
GO:0009375
GO:0016020
GO:0033748
GO:0044569
GO:0051538
AF-A0A836T4Z8-F1-model_v4 deleted 0.8528 5 229

Map