F456011

General Info

Members Datasets Scaffolds Average Seq Length
503 282 1006 110

Family's Representative Sequence

Representative Sequence 3300012497|Ga0157319_1000005|Ga0157319_100000568
Length 123
Sequence MAAALDPGYRREVGMSLWEAVLGILGMGAITVITRGFFMIPDREIPLPQWVRDGLRYAPLAALAAVIVPEIVMTQGELIHTWKDARLYATAVGTAYFFWRRGILGTIVSGTAVMLALRVGLGW

Samples

Sample ID Description Type Environment
1 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
146 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
147 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
148 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
173 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
174 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
175 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
176 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
177 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
178 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
179 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
182 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
183 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
184 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
185 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
186 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
187 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
188 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
189 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
190 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
191 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
192 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
193 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
194 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
207 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
208 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
209 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
218 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
221 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
222 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
223 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
224 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
225 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
234 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
235 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
236 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
237 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
238 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
243 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
244 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
249 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
250 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
251 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
252 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
253 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
254 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
255 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
256 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
257 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
258 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
259 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
260 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
261 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
262 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
263 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
264 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
265 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
266 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
267 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
268 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
269 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
270 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
271 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
272 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
273 2643221585 Pelomonas sp. Root662 Isolate Unclassified
274 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
275 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
276 2643221656 Pelomonas sp. Root405 Isolate Unclassified
277 2643221660 Methylibium sp. Root1272 Isolate Unclassified
278 2738541337 Pelomonas sp. BT06 Isolate Unclassified
279 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
280 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
281 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
282 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.08
Nodule 0
Rhizoplane 1.59
Rhizosphere 70.97
Stem 0
Stem Tuber 0
Unclassified 5.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157319_1000005 3300012497 Bacteria 372810
2 rootL2_10025863 3300003322 Bacteria 11506
3 rootL2_10061477 3300003322 Bacteria 3114
4 rootL2_10116229 3300003322 Bacteria 3142
5 rootH1_10097384 3300003323 Bacteria 1008
6 rootH1_10123845 3300003323 Bacteria 1469
7 Ga0055524_1001899 3300003775 Bacteria 11337
8 Ga0055524_1005470 3300003775 Bacteria 5668
9 Ga0055536_1063236 3300003781 Bacteria 758
10 Ga0055534_1001223 3300003784 Bacteria 10737
11 Ga0055540_1089246 3300003792 Bacteria 583
12 Ga0055531_10003649 3300003794 Bacteria 9704
13 Ga0055543_1008266 3300004625 Bacteria 2317
14 Ga0065165_1000766 3300005262 Bacteria 43430
15 Ga0065165_1036341 3300005262 Bacteria 1503
16 Ga0070658_10027589 3300005327 Bacteria 4554
17 Ga0070658_10045741 3300005327 Bacteria 3539
18 Ga0070676_10035853 3300005328 Bacteria 2855
19 Ga0070676_10490983 3300005328 Bacteria 870
20 Ga0070690_100042529 3300005330 Bacteria 2878
21 Ga0070690_100765681 3300005330 Bacteria 746
22 Ga0070670_100003414 3300005331 Bacteria 13178
23 Ga0070670_100196270 3300005331 Bacteria 1753
24 Ga0070677_10004050 3300005333 Bacteria 4759
25 Ga0068869_100035549 3300005334 Bacteria 3531
26 Ga0068869_100069618 3300005334 Bacteria 2602
27 Ga0068869_100375585 3300005334 Bacteria 1164
28 Ga0068869_100929572 3300005334 Bacteria 754
29 Ga0070666_10244673 3300005335 Bacteria 1269
30 Ga0068868_100024526 3300005338 Bacteria 4578
31 Ga0068868_100166995 3300005338 Bacteria 1821
32 Ga0068868_100517704 3300005338 Bacteria 1047
33 Ga0068868_101753813 3300005338 Unclassified 586
34 Ga0070689_100925738 3300005340 Bacteria 772
35 Ga0070668_101416548 3300005347 Unclassified 634
36 Ga0070669_100011004 3300005353 Bacteria 6422
37 Ga0070669_100015462 3300005353 Bacteria 5438
38 Ga0070669_100139434 3300005353 Bacteria 1868
39 Ga0070675_100004350 3300005354 Bacteria 10798
40 Ga0070675_101759879 3300005354 Bacteria 572
41 Ga0070675_101873005 3300005354 Unclassified 553
42 Ga0070671_100023470 3300005355 Bacteria 5048
43 Ga0070674_100025499 3300005356 Bacteria 3850
44 Ga0070674_100056518 3300005356 Unclassified 2721
45 Ga0070674_100556799 3300005356 Bacteria 963
46 Ga0070673_100029029 3300005364 Bacteria 4121
47 Ga0070673_100030662 3300005364 Bacteria 4029
48 Ga0070673_100258613 3300005364 Bacteria 1520
49 Ga0070673_101186928 3300005364 Bacteria 715
50 Ga0070688_100054849 3300005365 Bacteria 2498
51 Ga0070659_100312639 3300005366 Bacteria 1312
52 Ga0070667_100007833 3300005367 Bacteria 8861
53 Ga0070667_100030991 3300005367 Bacteria 4458
54 Ga0070667_100281248 3300005367 Bacteria 1494
55 Ga0070667_100635505 3300005367 Bacteria 985
56 Ga0070667_100981402 3300005367 Bacteria 788
57 Ga0070667_101103813 3300005367 Bacteria 741
58 Ga0070667_101360040 3300005367 Bacteria 666
59 Ga0070694_100012300 3300005444 Bacteria 5317
60 Ga0070708_100375870 3300005445 Bacteria 1340
61 Ga0070663_100487810 3300005455 Bacteria 1021
62 Ga0070663_100545367 3300005455 Bacteria 969
63 Ga0070678_100062594 3300005456 Bacteria 2748
64 Ga0070678_100249382 3300005456 Bacteria 1488
65 Ga0068867_100009501 3300005459 Bacteria 6859
66 Ga0068867_100081919 3300005459 Bacteria 2433
67 Ga0068867_100339248 3300005459 Bacteria 1251
68 Ga0070685_10774816 3300005466 Bacteria 705
69 Ga0070706_100015853 3300005467 Bacteria 6956
70 Ga0070698_102210236 3300005471 Bacteria 504
71 Ga0070699_100161539 3300005518 Bacteria 1983
72 Ga0068853_100534969 3300005539 Bacteria 1109
73 Ga0068853_102058082 3300005539 Bacteria 554
74 Ga0070672_100280979 3300005543 Bacteria 1407
75 Ga0070672_101067563 3300005543 Bacteria 717
76 Ga0070686_100387400 3300005544 Bacteria 1060
77 Ga0070695_100056118 3300005545 Bacteria 2541
78 Ga0070665_100617021 3300005548 Bacteria 1098
79 Ga0068855_100295258 3300005563 Bacteria 1796
80 Ga0068855_100373932 3300005563 Bacteria 1566
81 Ga0068855_100694222 3300005563 Bacteria 1090
82 Ga0068855_100698766 3300005563 Bacteria 1085
83 Ga0068855_101756886 3300005563 Bacteria 631
84 Ga0070664_100311290 3300005564 Bacteria 1425
85 Ga0070664_100553105 3300005564 Bacteria 1064
86 Ga0070664_100806634 3300005564 Bacteria 878
87 Ga0068857_100066640 3300005577 Bacteria 3204
88 Ga0068854_100976738 3300005578 Bacteria 748
89 Ga0068852_100022166 3300005616 Bacteria 5089
90 Ga0068852_100550760 3300005616 Bacteria 1154
91 Ga0068859_100438095 3300005617 Bacteria 1403
92 Ga0068864_100042869 3300005618 Bacteria 3873
93 Ga0068864_100077065 3300005618 Bacteria 2915
94 Ga0068866_10500051 3300005718 Unclassified 804
95 Ga0068851_10792820 3300005834 Bacteria 588
96 Ga0068870_10807346 3300005840 Unclassified 656
97 Ga0068863_100081713 3300005841 Bacteria 3061
98 Ga0068863_101853791 3300005841 Bacteria 613
99 Ga0068860_100145313 3300005843 Bacteria 2282
100 Ga0068860_100531308 3300005843 Bacteria 1177
101 Ga0068860_102241349 3300005843 Bacteria 567
102 Ga0068862_101197829 3300005844 Bacteria 758
103 Ga0075368_10223649 3300006042 Bacteria 800
104 Ga0075368_10423803 3300006042 Bacteria 587
105 Ga0075363_100048564 3300006048 Bacteria 2257
106 Ga0075363_100814255 3300006048 Bacteria 568
107 Ga0075364_10129658 3300006051 Bacteria 1692
108 Ga0075362_10012094 3300006177 Bacteria 3418
109 Ga0075362_10060539 3300006177 Bacteria 1712
110 Ga0075362_10106014 3300006177 Bacteria 1319
111 Ga0075362_10133695 3300006177 Bacteria 1181
112 Ga0075362_10186319 3300006177 Bacteria 1007
113 Ga0075367_10041758 3300006178 Bacteria 2682
114 Ga0075367_10056206 3300006178 Bacteria 2338
115 Ga0075367_10064345 3300006178 Bacteria 2193
116 Ga0075369_10005802 3300006186 Bacteria 4636
117 Ga0075366_10002582 3300006195 Bacteria 9312
118 Ga0075366_10006447 3300006195 Bacteria 6430
119 Ga0075366_10008772 3300006195 Bacteria 5630
120 Ga0075366_10010788 3300006195 Bacteria 5138
121 Ga0075366_10014601 3300006195 Bacteria 4487
122 Ga0075366_10059058 3300006195 Bacteria 2278
123 Ga0075366_10114967 3300006195 Bacteria 1620
124 Ga0075366_10204926 3300006195 Bacteria 1200
125 Ga0075366_10323681 3300006195 Bacteria 945
126 Ga0075366_10779479 3300006195 Unclassified 594
127 Ga0097621_100011871 3300006237 Bacteria 6440
128 Ga0075370_10017140 3300006353 Bacteria 3910
129 Ga0075370_10024046 3300006353 Bacteria 3361
130 Ga0075370_10028638 3300006353 Bacteria 3097
131 Ga0075370_10098102 3300006353 Bacteria 1694
132 Ga0075370_10170640 3300006353 Bacteria 1279
133 Ga0075428_101064909 3300006844 Unclassified 855
134 Ga0075430_101713508 3300006846 Bacteria 516
135 Ga0075429_100075242 3300006880 Unclassified 2941
136 Ga0075429_100826422 3300006880 Bacteria 811
137 Ga0075429_101201061 3300006880 Unclassified 662
138 Ga0068865_100739504 3300006881 Bacteria 844
139 Ga0097620_100438102 3300006931 Bacteria 1403
140 Ga0105244_10234219 3300009036 Bacteria 859
141 Ga0105240_10098295 3300009093 Bacteria 3565
142 Ga0105240_12400279 3300009093 Bacteria 546
143 Ga0111539_10120247 3300009094 Bacteria 3077
144 Ga0111539_10121836 3300009094 Unclassified 3056
145 Ga0111539_10463118 3300009094 Bacteria 1476
146 Ga0105245_10099594 3300009098 Bacteria 2687
147 Ga0105245_10106715 3300009098 Bacteria 2599
148 Ga0105245_10241511 3300009098 Bacteria 1751
149 Ga0105245_11148120 3300009098 Bacteria 824
150 Ga0105243_10000489 3300009148 Bacteria 40413
151 Ga0105243_10056202 3300009148 Bacteria 3129
152 Ga0105243_10057050 3300009148 Bacteria 3109
153 Ga0105243_10284988 3300009148 Bacteria 1490
154 Ga0105243_11490850 3300009148 Bacteria 700
155 Ga0105241_10824779 3300009174 Bacteria 856
156 Ga0105242_10585602 3300009176 Bacteria 1075
157 Ga0105242_12743467 3300009176 Bacteria 543
158 Ga0105248_11292786 3300009177 Bacteria 825
159 Ga0105237_10031125 3300009545 Bacteria 5411
160 Ga0105237_10506490 3300009545 Bacteria 1214
161 Ga0105239_10023383 3300010375 Bacteria 6805
162 Ga0157370_10358596 3300013104 Bacteria 1344
163 Ga0157374_10080174 3300013296 Bacteria 3095
164 Ga0157374_10729287 3300013296 Bacteria 1005
165 Ga0157378_10143330 3300013297 Bacteria 2220
166 Ga0157378_13078130 3300013297 Bacteria 518
167 Ga0163162_11084433 3300013306 Bacteria 907
168 Ga0157375_10033812 3300013308 Bacteria 4863
169 Ga0157375_10522856 3300013308 Bacteria 1350
170 Ga0157375_10903992 3300013308 Bacteria 1027
171 Ga0157375_10922627 3300013308 Bacteria 1016
172 Ga0163163_11496004 3300014325 Bacteria 736
173 Ga0157380_10179506 3300014326 Unclassified 1859
174 Ga0157380_10307606 3300014326 Bacteria 1463
175 Ga0157380_10590906 3300014326 Bacteria 1097
176 Ga0157380_12087817 3300014326 Bacteria 629
177 Ga0157380_12226390 3300014326 Bacteria 612
178 Ga0157377_10000077 3300014745 Bacteria 75271
179 Ga0157377_10272007 3300014745 Bacteria 1107
180 Ga0157379_10966939 3300014968 Bacteria 810
181 Ga0157379_11890658 3300014968 Bacteria 588
182 Ga0157376_10990471 3300014969 Bacteria 863
183 Ga0157376_12255690 3300014969 Unclassified 583
184 Ga0163161_10001219 3300017792 Bacteria 19374
185 Ga0163161_10065527 3300017792 Bacteria 2651
186 Ga0213872_10128527 3300021361 Bacteria 1117
187 Ga0209677_105193 3300025253 Bacteria 3474
188 Ga0209455_1028811 3300025272 Bacteria 966
189 Ga0209758_1073813 3300025297 Bacteria 1061
190 Ga0209256_1000309 3300025299 Bacteria 85294
191 Ga0209256_1023220 3300025299 Bacteria 1855
192 Ga0209051_1007273 3300025303 Bacteria 6078
193 Ga0209257_1002326 3300025304 Bacteria 19172
194 Ga0209257_1032325 3300025304 Bacteria 1661
195 Ga0207697_10004565 3300025315 Bacteria 6596
196 Ga0207656_10045511 3300025321 Bacteria 1878
197 Ga0207656_10504775 3300025321 Unclassified 614
198 Ga0207682_10011208 3300025893 Bacteria 3505
199 Ga0207642_11006220 3300025899 Bacteria 537
200 Ga0207688_10213383 3300025901 Bacteria 1160
201 Ga0207680_10348443 3300025903 Bacteria 1040
202 Ga0207645_10003162 3300025907 Bacteria 12608
203 Ga0207645_10232502 3300025907 Bacteria 1217
204 Ga0207643_10171044 3300025908 Bacteria 1311
205 Ga0207705_10144208 3300025909 Bacteria 1780
206 Ga0207705_10175571 3300025909 Bacteria 1615
207 Ga0207705_10181296 3300025909 Bacteria 1589
208 Ga0207684_10002367 3300025910 Bacteria 19084
209 Ga0207695_10079037 3300025913 Bacteria 3335
210 Ga0207695_11598150 3300025913 Bacteria 532
211 Ga0207671_10015278 3300025914 Bacteria 6025
212 Ga0207657_10150628 3300025919 Bacteria 1895
213 Ga0207681_10002834 3300025923 Bacteria 10974
214 Ga0207681_10131484 3300025923 Bacteria 1851
215 Ga0207681_10134710 3300025923 Bacteria 1831
216 Ga0207650_10003691 3300025925 Bacteria 10470
217 Ga0207650_10182601 3300025925 Bacteria 1672
218 Ga0207659_10002681 3300025926 Bacteria 10604
219 Ga0207659_10378475 3300025926 Bacteria 1180
220 Ga0207687_10101679 3300025927 Bacteria 2116
221 Ga0207687_10487454 3300025927 Bacteria 1027
222 Ga0207644_10023056 3300025931 Bacteria 4259
223 Ga0207690_10415328 3300025932 Bacteria 1075
224 Ga0207686_10264082 3300025934 Bacteria 1263
225 Ga0207709_10002810 3300025935 Bacteria 10709
226 Ga0207709_10184216 3300025935 Bacteria 1477
227 Ga0207709_10215309 3300025935 Bacteria 1381
228 Ga0207709_10393470 3300025935 Bacteria 1058
229 Ga0207670_10294568 3300025936 Bacteria 1269
230 Ga0207669_10297446 3300025937 Bacteria 1225
231 Ga0207669_10445882 3300025937 Unclassified 1024
232 Ga0207704_10648529 3300025938 Bacteria 869
233 Ga0207691_10008269 3300025940 Bacteria 9988
234 Ga0207691_10620987 3300025940 Bacteria 914
235 Ga0207689_10047091 3300025942 Bacteria 3562
236 Ga0207689_10112300 3300025942 Bacteria 2240
237 Ga0207689_10248767 3300025942 Bacteria 1470
238 Ga0207679_10076374 3300025945 Bacteria 2545
239 Ga0207679_10236988 3300025945 Bacteria 1544
240 Ga0207679_10754633 3300025945 Bacteria 885
241 Ga0207667_10363874 3300025949 Bacteria 1475
242 Ga0207651_10048180 3300025960 Bacteria 2878
243 Ga0207651_10221793 3300025960 Bacteria 1529
244 Ga0207668_10632106 3300025972 Unclassified 935
245 Ga0207658_10035310 3300025986 Bacteria 3579
246 Ga0207658_10036529 3300025986 Bacteria 3523
247 Ga0207658_10611311 3300025986 Bacteria 980
248 Ga0207658_11717949 3300025986 Unclassified 573
249 Ga0207677_10068630 3300026023 Bacteria 2489
250 Ga0207677_10092952 3300026023 Bacteria 2197
251 Ga0207677_10127847 3300026023 Bacteria 1924
252 Ga0207677_11830362 3300026023 Bacteria 564
253 Ga0207703_11657555 3300026035 Bacteria 615
254 Ga0207639_10892577 3300026041 Bacteria 831
255 Ga0207639_11482338 3300026041 Bacteria 637
256 Ga0207639_11670122 3300026041 Bacteria 597
257 Ga0207639_12191601 3300026041 Bacteria 514
258 Ga0207678_10027476 3300026067 Bacteria 4965
259 Ga0207678_10713093 3300026067 Bacteria 883
260 Ga0207641_10150516 3300026088 Bacteria 2107
261 Ga0207641_10415736 3300026088 Bacteria 1294
262 Ga0207641_10572938 3300026088 Bacteria 1103
263 Ga0207641_11537476 3300026088 Bacteria 667
264 Ga0207641_12622198 3300026088 Bacteria 502
265 Ga0207648_10000054 3300026089 Bacteria 106684
266 Ga0207648_10002115 3300026089 Bacteria 21634
267 Ga0207648_10022097 3300026089 Bacteria 5715
268 Ga0207648_10044550 3300026089 Bacteria 3892
269 Ga0207648_11351916 3300026089 Bacteria 669
270 Ga0207676_10037398 3300026095 Bacteria 3699
271 Ga0207676_11995864 3300026095 Bacteria 579
272 Ga0207676_12288173 3300026095 Bacteria 538
273 Ga0207674_10038221 3300026116 Bacteria 4986
274 Ga0207674_10413659 3300026116 Bacteria 1303
275 Ga0207674_11036411 3300026116 Bacteria 790
276 Ga0207683_10001511 3300026121 Bacteria 20952
277 Ga0207683_10468234 3300026121 Bacteria 1162
278 Ga0207683_10978335 3300026121 Bacteria 786
279 Ga0207683_10990148 3300026121 Unclassified 780
280 Ga0207698_10117479 3300026142 Bacteria 2244
281 Ga0207698_10249342 3300026142 Bacteria 1623
282 Ga0207698_10729403 3300026142 Bacteria 988
283 Ga0207698_12235732 3300026142 Bacteria 559
284 Ga0209371_1008999 3300027312 Bacteria 3229
285 Ga0207428_10986174 3300027907 Bacteria 592
286 Ga0268266_10078349 3300028379 Bacteria 2875
287 Ga0268266_10182767 3300028379 Bacteria 1910
288 Ga0268266_10466255 3300028379 Bacteria 1202
289 Ga0268264_10138146 3300028381 Bacteria 2170
290 Ga0307517_10113148 3300028786 Bacteria 2050
291 Ga0307517_10211229 3300028786 Bacteria 1195
292 Ga0307517_10281410 3300028786 Bacteria 948
293 Ga0307515_10000034 3300028794 Bacteria 344640
294 Ga0307515_10054269 3300028794 Bacteria 5888
295 Ga0307515_10328484 3300028794 Bacteria 1190
296 Ga0268256_1020270 3300030500 Bacteria 1796
297 Ga0316177_1066074 3300030731 Bacteria 913
298 Ga0316183_1051966 3300030742 Bacteria 1125
299 Ga0316182_1134875 3300030745 Bacteria 3527
300 Ga0307513_10037507 3300031456 Bacteria 5393
301 Ga0307513_10050483 3300031456 Bacteria 4496
302 Ga0307513_10119937 3300031456 Bacteria 2600
303 Ga0307509_10000698 3300031507 Bacteria 57430
304 Ga0307509_10304043 3300031507 Bacteria 1341
305 Ga0307509_10678113 3300031507 Bacteria 698
306 Ga0307408_100075382 3300031548 Bacteria 2506
307 Ga0307408_100219088 3300031548 Bacteria 1552
308 Ga0307408_100550769 3300031548 Unclassified 1018
309 Ga0307408_100587492 3300031548 Bacteria 988
310 Ga0307408_100678646 3300031548 Bacteria 924
311 Ga0307508_10134679 3300031616 Bacteria 2074
312 Ga0307514_10055311 3300031649 Bacteria 3051
313 Ga0307516_10574768 3300031730 Bacteria 781
314 Ga0307405_10041828 3300031731 Bacteria 2785
315 Ga0307405_10453019 3300031731 Bacteria 1018
316 Ga0307413_10006417 3300031824 Bacteria 5367
317 Ga0307413_10793322 3300031824 Unclassified 795
318 Ga0307410_10120226 3300031852 Bacteria 1914
319 Ga0307410_10140542 3300031852 Bacteria 1786
320 Ga0307410_10203206 3300031852 Bacteria 1514
321 Ga0307406_10010103 3300031901 Bacteria 5317
322 Ga0307407_10718301 3300031903 Bacteria 754
323 Ga0307412_10011588 3300031911 Bacteria 5112
324 Ga0307412_10028681 3300031911 Bacteria 3485
325 Ga0307412_10121505 3300031911 Bacteria 1881
326 Ga0307412_10135992 3300031911 Bacteria 1793
327 Ga0307412_11175696 3300031911 Unclassified 686
328 Ga0307409_100038431 3300031995 Bacteria 3540
329 Ga0307409_100419972 3300031995 Bacteria 1283
330 Ga0307416_100298784 3300032002 Bacteria 1599
331 Ga0307414_10220364 3300032004 Bacteria 1557
332 Ga0307414_10651546 3300032004 Bacteria 949
333 Ga0307414_11408703 3300032004 Bacteria 648
334 Ga0307414_11909552 3300032004 Unclassified 554
335 Ga0307411_10037882 3300032005 Bacteria 3036
336 Ga0307411_10185876 3300032005 Bacteria 1582
337 Ga0307415_100097593 3300032126 Bacteria 2145
338 Ga0307507_10513741 3300033179 Bacteria 642
339 Ga0307510_10000426 3300033180 Bacteria 40466
340 Ga0307510_10051249 3300033180 Bacteria 4367
341 Ga0373931_0148386 3300035691 Bacteria 1365
342 Ga0373925_0038381 3300037068 Bacteria 3541
343 Ga0395905_0000914 3300037471 Bacteria 38163
344 Ga0395905_0030092 3300037471 Bacteria 5117
345 Ga0436361_0267348 3300039447 Bacteria 1513
346 Ga0439436_0015525 3300041404 Bacteria 2290
347 Ga0439439_0035051 3300041406 Bacteria 1288
348 Ga0439447_014070 3300041407 Bacteria 2252
349 Ga0439466_0003244 3300041411 Bacteria 6337
350 Ga0439465_0005171 3300041413 Bacteria 4186
351 Ga0439465_0060130 3300041413 Bacteria 1258
352 Ga0451789_0482962 3300041443 Bacteria 542
353 Ga0451791_1207047 3300041451 Bacteria 714
354 Ga0451791_1739669 3300041451 Bacteria 1497
355 Ga0451835_0210024 3300041492 Bacteria 652
356 Ga0451853_0015814 3300041512 Bacteria 1345
357 Ga0451853_1773097 3300041512 Bacteria 752
358 Ga0451853_2803228 3300041512 Bacteria 796
359 Ga0439431_0214371 3300041997 Bacteria 564
360 Ga0439433_0001455 3300041999 Bacteria 4894
361 Ga0439442_013792 3300042002 Bacteria 1659
362 Ga0439445_0000788 3300042004 Bacteria 6667
363 Ga0439432_010623 3300042006 Bacteria 3184
364 Ga0439432_024551 3300042006 Bacteria 1981
365 Ga0439449_0003246 3300042007 Bacteria 6338
366 Ga0439449_0016033 3300042007 Bacteria 2817
367 Ga0439452_008815 3300042010 Bacteria 3009
368 Ga0439457_026766 3300042014 Bacteria 1277
369 Ga0439462_0023616 3300042015 Bacteria 1612
370 Ga0450890_005709 3300042127 Bacteria 1599
371 Ga0439446_0003074 3300042156 Bacteria 4096
372 Ga0450908_093550 3300042184 Bacteria 546
373 Ga0439434_0006134 3300042435 Bacteria 3505
374 Ga0439459_0002279 3300042438 Bacteria 2943
375 Ga0439459_0062567 3300042438 Bacteria 844
376 Ga0453684_0469617 3300044712 Bacteria 1397
377 Ga0453684_1758281 3300044712 Bacteria 632
378 Ga0466960_0481298 3300044901 Bacteria 725
379 Ga0451576_0068807 3300045051 Bacteria 3684
380 Ga0451576_0118588 3300045051 Bacteria 2755
381 Ga0451576_0593126 3300045051 Bacteria 1164
382 Ga0495627_098870 3300046453 Bacteria 834
383 Ga0495592_0000499 3300046454 Bacteria 28648
384 Ga0495638_0231819 3300046460 Bacteria 1027
385 Ga0495650_0020449 3300046471 Bacteria 3227
386 Ga0495605_0271607 3300046474 Bacteria 722
387 Ga0495583_0046253 3300046506 Bacteria 2008
388 Ga0495610_0162656 3300046512 Bacteria 942
389 Ga0495616_0171512 3300046513 Bacteria 970
390 Ga0495620_0118362 3300046515 Bacteria 1046
391 Ga0495620_0315785 3300046515 Bacteria 593
392 Ga0495631_0262365 3300046518 Bacteria 736
393 Ga0495632_0041517 3300046519 Bacteria 2311
394 Ga0495643_0067676 3300046522 Bacteria 1881
395 Ga0495643_0257362 3300046522 Bacteria 812
396 Ga0495643_0526827 3300046522 Bacteria 505
397 Ga0495648_0281881 3300046524 Bacteria 787
398 Ga0495663_0322261 3300046525 Archaea 559
399 Ga0495642_0360599 3300046528 Bacteria 639
400 Ga0495654_0278394 3300046530 Bacteria 689
401 Ga0495609_0209742 3300046538 Unclassified 812
402 Ga0495597_0000250 3300046542 Bacteria 49080
403 Ga0495597_0226881 3300046542 Bacteria 740
404 Ga0495597_0386876 3300046542 Unclassified 533
405 Ga0495668_0467761 3300046616 Bacteria 694
406 Ga0495611_0095240 3300046648 Bacteria 1378
407 Ga0495625_0023905 3300046660 Bacteria 4660
408 Ga0495625_0072666 3300046660 Bacteria 2412
409 Ga0495646_0049026 3300046680 Bacteria 2564
410 Ga0495671_0171970 3300046692 Bacteria 1053
411 Ga0495671_0561509 3300046692 Bacteria 543
412 Ga0495649_0017603 3300046694 Bacteria 4030
413 Ga0495660_0062059 3300046810 Bacteria 2004
414 Ga0495687_000850 3300047443 Bacteria 32575
415 Ga0495686_0114625 3300047472 Bacteria 1613
416 Ga0495686_0138428 3300047472 Bacteria 1438
417 Ga0495626_0076302 3300048091 Bacteria 1496
418 Ga0496102_0003119 3300048905 Bacteria 14062
419 Ga0496106_0640215 3300048909 Bacteria 850
420 Ga0496110_0065223 3300048913 Bacteria 3219
421 Ga0496110_0208804 3300048913 Bacteria 1775
422 Ga0496113_1571107 3300048916 Bacteria 507
423 Ga0496122_0000080 3300048925 Bacteria 212397
424 Ga0496123_0000631 3300048926 Bacteria 58934
425 Ga0496124_0052837 3300048927 Bacteria 3450
426 Ga0496124_0392331 3300048927 Bacteria 966
427 Ga0495682_0075702 3300049460 Bacteria 1211
428 Ga0501298_006064 3300049521 Bacteria 1964
429 Ga0501225_0180405 3300049705 Bacteria 660
430 Ga0501262_018356 3300049759 Bacteria 939
431 Ga0501265_024200 3300049762 Bacteria 839
432 Ga0501281_02980 3300049777 Bacteria 1217
433 nmdc:mga03683_111250_c1 3300050489 Bacteria 1211
434 nmdc:mga03683_29767_c1 3300050489 Bacteria 2180
435 nmdc:mga03683_42516_c1 3300050489 Bacteria 1870
436 nmdc:mga03683_93042_c1 3300050489 Bacteria 1317
437 nmdc:mga03n38_611983_c1 3300050490 Bacteria 621
438 nmdc:mga03n38_720618_c1 3300050490 Bacteria 576
439 nmdc:mga03n38_750947_c1 3300050490 Bacteria 565
440 nmdc:mga00v17_206875_c1 3300050491 Bacteria 1269
441 nmdc:mga0k408_131094_c1 3300050493 Bacteria 1488
442 nmdc:mga0k408_131814_c1 3300050493 Bacteria 1484
443 nmdc:mga0k408_20694_c1 3300050493 Bacteria 3690
444 nmdc:mga0k408_2131_c2 3300050493 Bacteria 1506
445 nmdc:mga0k408_22330_c1 3300050493 Bacteria 3563
446 nmdc:mga0k408_3038_c1 3300050493 Bacteria 8906
447 nmdc:mga0k408_332188_c1 3300050493 Bacteria 907
448 nmdc:mga0k408_346596_c1 3300050493 Bacteria 885
449 nmdc:mga0k408_71031_c1 3300050493 Bacteria 2032
450 nmdc:mga0k408_95210_c1 3300050493 Bacteria 1752
451 nmdc:mga06z11_128314_c1 3300050494 Bacteria 1421
452 nmdc:mga06z11_2604_c1 3300050494 Bacteria 2842
453 nmdc:mga06z11_412303_c1 3300050494 Bacteria 814
454 nmdc:mga06z11_51976_c1 3300050494 Bacteria 2100
455 nmdc:mga04h51_292773_c1 3300050495 Unclassified 662
456 nmdc:mga07m45_100603_c1 3300050496 Bacteria 1660
457 nmdc:mga07m45_17452_c1 3300050496 Bacteria 3856
458 nmdc:mga07m45_24189_c1 3300050496 Bacteria 3326
459 nmdc:mga07m45_305969_c1 3300050496 Bacteria 924
460 nmdc:mga07m45_365_c1 3300050496 Bacteria 18493
461 nmdc:mga09592_1387047_c1 3300050508 Bacteria 575
462 nmdc:mga09592_86155_c1 3300050508 Unclassified 2680
463 nmdc:mga08y16_273137_c1 3300050511 Bacteria 1744
464 nmdc:mga08y16_510018_c1 3300050511 Bacteria 1221
465 nmdc:mga08y16_595283_c1 3300050511 Unclassified 1115
466 nmdc:mga0sz30_71830_c2 3300050516 Bacteria 880
467 Ga0500578_0115476 3300053086 Bacteria 1690
468 Ga0500578_0134476 3300053086 Bacteria 1549
469 Ga0500644_0001310 3300053088 Bacteria 6751
470 Ga0500646_0291916 3300053090 Bacteria 583
471 Ga0500651_0242296 3300053093 Bacteria 1051
472 Ga0500641_0313414 3300053096 Bacteria 641
473 Ga0500562_086333 3300053108 Bacteria 850
474 Ga0500572_174443 3300053111 Bacteria 704
475 Ga0500593_002462 3300053117 Bacteria 6797
476 Ga0500594_0002849 3300053118 Bacteria 3769
477 Ga0500614_005038 3300053123 Bacteria 2777
478 Ga0500618_090825 3300053125 Bacteria 686
479 Ga0500652_230599 3300053131 Bacteria 741
480 Ga0500655_101236 3300053133 Bacteria 604
481 Ga0500658_0012879 3300053134 Bacteria 3090
482 Ga0500559_0000097 3300053136 Bacteria 70124
483 Ga0500564_076566 3300053138 Bacteria 1504
484 Ga0500568_0067329 3300053139 Bacteria 1376
485 Ga0500604_0021600 3300053151 Bacteria 1821
486 Ga0500619_000326 3300053154 Bacteria 9275
487 Ga0500619_081727 3300053154 Bacteria 1085
488 Ga0500622_0006958 3300053156 Bacteria 6476
489 Ga0500622_0068638 3300053156 Bacteria 1796
490 Ga0500633_0250659 3300053160 Bacteria 658
491 Ga0500584_114010 3300053726 Bacteria 1086
492 Ga0500587_001802 3300053739 Bacteria 3048
493 2588292848 2588253510 Bacteria 6901809
494 2643932416 2643221585 Bacteria 5812563
495 2644163706 2643221628 Bacteria 5745828
496 2644305817 2643221654 Bacteria 5273570
497 2644313667 2643221656 Bacteria 5809961
498 2644339810 2643221660 Bacteria 4208257
499 2739054721 2738541337 Bacteria 6183410
500 2885194361 2885192300 Bacteria 5882526
501 2886853015 2886848708 Bacteria 5632523
502 2945915035 2945909444 Bacteria 7065066
503 2945989560 2945984333 Bacteria 7358892
504 Ga0157319_1000005
505 rootL2_10025863
506 rootL2_10061477
507 rootL2_10116229
508 rootH1_10097384
509 rootH1_10123845
510 Ga0055524_1001899
511 Ga0055524_1005470
512 Ga0055536_1063236
513 Ga0055534_1001223
514 Ga0055540_1089246
515 Ga0055531_10003649
516 Ga0055543_1008266
517 Ga0065165_1000766
518 Ga0065165_1036341
519 Ga0070658_10027589
520 Ga0070658_10045741
521 Ga0070676_10035853
522 Ga0070676_10490983
523 Ga0070690_100042529
524 Ga0070690_100765681
525 Ga0070670_100003414
526 Ga0070670_100196270
527 Ga0070677_10004050
528 Ga0068869_100035549
529 Ga0068869_100069618
530 Ga0068869_100375585
531 Ga0068869_100929572
532 Ga0070666_10244673
533 Ga0068868_100024526
534 Ga0068868_100166995
535 Ga0068868_100517704
536 Ga0068868_101753813
537 Ga0070689_100925738
538 Ga0070668_101416548
539 Ga0070669_100011004
540 Ga0070669_100015462
541 Ga0070669_100139434
542 Ga0070675_100004350
543 Ga0070675_101759879
544 Ga0070675_101873005
545 Ga0070671_100023470
546 Ga0070674_100025499
547 Ga0070674_100056518
548 Ga0070674_100556799
549 Ga0070673_100029029
550 Ga0070673_100030662
551 Ga0070673_100258613
552 Ga0070673_101186928
553 Ga0070688_100054849
554 Ga0070659_100312639
555 Ga0070667_100007833
556 Ga0070667_100030991
557 Ga0070667_100281248
558 Ga0070667_100635505
559 Ga0070667_100981402
560 Ga0070667_101103813
561 Ga0070667_101360040
562 Ga0070694_100012300
563 Ga0070708_100375870
564 Ga0070663_100487810
565 Ga0070663_100545367
566 Ga0070678_100062594
567 Ga0070678_100249382
568 Ga0068867_100009501
569 Ga0068867_100081919
570 Ga0068867_100339248
571 Ga0070685_10774816
572 Ga0070706_100015853
573 Ga0070698_102210236
574 Ga0070699_100161539
575 Ga0068853_100534969
576 Ga0068853_102058082
577 Ga0070672_100280979
578 Ga0070672_101067563
579 Ga0070686_100387400
580 Ga0070695_100056118
581 Ga0070665_100617021
582 Ga0068855_100295258
583 Ga0068855_100373932
584 Ga0068855_100694222
585 Ga0068855_100698766
586 Ga0068855_101756886
587 Ga0070664_100311290
588 Ga0070664_100553105
589 Ga0070664_100806634
590 Ga0068857_100066640
591 Ga0068854_100976738
592 Ga0068852_100022166
593 Ga0068852_100550760
594 Ga0068859_100438095
595 Ga0068864_100042869
596 Ga0068864_100077065
597 Ga0068866_10500051
598 Ga0068851_10792820
599 Ga0068870_10807346
600 Ga0068863_100081713
601 Ga0068863_101853791
602 Ga0068860_100145313
603 Ga0068860_100531308
604 Ga0068860_102241349
605 Ga0068862_101197829
606 Ga0075368_10223649
607 Ga0075368_10423803
608 Ga0075363_100048564
609 Ga0075363_100814255
610 Ga0075364_10129658
611 Ga0075362_10012094
612 Ga0075362_10060539
613 Ga0075362_10106014
614 Ga0075362_10133695
615 Ga0075362_10186319
616 Ga0075367_10041758
617 Ga0075367_10056206
618 Ga0075367_10064345
619 Ga0075369_10005802
620 Ga0075366_10002582
621 Ga0075366_10006447
622 Ga0075366_10008772
623 Ga0075366_10010788
624 Ga0075366_10014601
625 Ga0075366_10059058
626 Ga0075366_10114967
627 Ga0075366_10204926
628 Ga0075366_10323681
629 Ga0075366_10779479
630 Ga0097621_100011871
631 Ga0075370_10017140
632 Ga0075370_10024046
633 Ga0075370_10028638
634 Ga0075370_10098102
635 Ga0075370_10170640
636 Ga0075428_101064909
637 Ga0075430_101713508
638 Ga0075429_100075242
639 Ga0075429_100826422
640 Ga0075429_101201061
641 Ga0068865_100739504
642 Ga0097620_100438102
643 Ga0105244_10234219
644 Ga0105240_10098295
645 Ga0105240_12400279
646 Ga0111539_10120247
647 Ga0111539_10121836
648 Ga0111539_10463118
649 Ga0105245_10099594
650 Ga0105245_10106715
651 Ga0105245_10241511
652 Ga0105245_11148120
653 Ga0105243_10000489
654 Ga0105243_10056202
655 Ga0105243_10057050
656 Ga0105243_10284988
657 Ga0105243_11490850
658 Ga0105241_10824779
659 Ga0105242_10585602
660 Ga0105242_12743467
661 Ga0105248_11292786
662 Ga0105237_10031125
663 Ga0105237_10506490
664 Ga0105239_10023383
665 Ga0157370_10358596
666 Ga0157374_10080174
667 Ga0157374_10729287
668 Ga0157378_10143330
669 Ga0157378_13078130
670 Ga0163162_11084433
671 Ga0157375_10033812
672 Ga0157375_10522856
673 Ga0157375_10903992
674 Ga0157375_10922627
675 Ga0163163_11496004
676 Ga0157380_10179506
677 Ga0157380_10307606
678 Ga0157380_10590906
679 Ga0157380_12087817
680 Ga0157380_12226390
681 Ga0157377_10000077
682 Ga0157377_10272007
683 Ga0157379_10966939
684 Ga0157379_11890658
685 Ga0157376_10990471
686 Ga0157376_12255690
687 Ga0163161_10001219
688 Ga0163161_10065527
689 Ga0213872_10128527
690 Ga0209677_105193
691 Ga0209455_1028811
692 Ga0209758_1073813
693 Ga0209256_1000309
694 Ga0209256_1023220
695 Ga0209051_1007273
696 Ga0209257_1002326
697 Ga0209257_1032325
698 Ga0207697_10004565
699 Ga0207656_10045511
700 Ga0207656_10504775
701 Ga0207682_10011208
702 Ga0207642_11006220
703 Ga0207688_10213383
704 Ga0207680_10348443
705 Ga0207645_10003162
706 Ga0207645_10232502
707 Ga0207643_10171044
708 Ga0207705_10144208
709 Ga0207705_10175571
710 Ga0207705_10181296
711 Ga0207684_10002367
712 Ga0207695_10079037
713 Ga0207695_11598150
714 Ga0207671_10015278
715 Ga0207657_10150628
716 Ga0207681_10002834
717 Ga0207681_10131484
718 Ga0207681_10134710
719 Ga0207650_10003691
720 Ga0207650_10182601
721 Ga0207659_10002681
722 Ga0207659_10378475
723 Ga0207687_10101679
724 Ga0207687_10487454
725 Ga0207644_10023056
726 Ga0207690_10415328
727 Ga0207686_10264082
728 Ga0207709_10002810
729 Ga0207709_10184216
730 Ga0207709_10215309
731 Ga0207709_10393470
732 Ga0207670_10294568
733 Ga0207669_10297446
734 Ga0207669_10445882
735 Ga0207704_10648529
736 Ga0207691_10008269
737 Ga0207691_10620987
738 Ga0207689_10047091
739 Ga0207689_10112300
740 Ga0207689_10248767
741 Ga0207679_10076374
742 Ga0207679_10236988
743 Ga0207679_10754633
744 Ga0207667_10363874
745 Ga0207651_10048180
746 Ga0207651_10221793
747 Ga0207668_10632106
748 Ga0207658_10035310
749 Ga0207658_10036529
750 Ga0207658_10611311
751 Ga0207658_11717949
752 Ga0207677_10068630
753 Ga0207677_10092952
754 Ga0207677_10127847
755 Ga0207677_11830362
756 Ga0207703_11657555
757 Ga0207639_10892577
758 Ga0207639_11482338
759 Ga0207639_11670122
760 Ga0207639_12191601
761 Ga0207678_10027476
762 Ga0207678_10713093
763 Ga0207641_10150516
764 Ga0207641_10415736
765 Ga0207641_10572938
766 Ga0207641_11537476
767 Ga0207641_12622198
768 Ga0207648_10000054
769 Ga0207648_10002115
770 Ga0207648_10022097
771 Ga0207648_10044550
772 Ga0207648_11351916
773 Ga0207676_10037398
774 Ga0207676_11995864
775 Ga0207676_12288173
776 Ga0207674_10038221
777 Ga0207674_10413659
778 Ga0207674_11036411
779 Ga0207683_10001511
780 Ga0207683_10468234
781 Ga0207683_10978335
782 Ga0207683_10990148
783 Ga0207698_10117479
784 Ga0207698_10249342
785 Ga0207698_10729403
786 Ga0207698_12235732
787 Ga0209371_1008999
788 Ga0207428_10986174
789 Ga0268266_10078349
790 Ga0268266_10182767
791 Ga0268266_10466255
792 Ga0268264_10138146
793 Ga0307517_10113148
794 Ga0307517_10211229
795 Ga0307517_10281410
796 Ga0307515_10000034
797 Ga0307515_10054269
798 Ga0307515_10328484
799 Ga0268256_1020270
800 Ga0316177_1066074
801 Ga0316183_1051966
802 Ga0316182_1134875
803 Ga0307513_10037507
804 Ga0307513_10050483
805 Ga0307513_10119937
806 Ga0307509_10000698
807 Ga0307509_10304043
808 Ga0307509_10678113
809 Ga0307408_100075382
810 Ga0307408_100219088
811 Ga0307408_100550769
812 Ga0307408_100587492
813 Ga0307408_100678646
814 Ga0307508_10134679
815 Ga0307514_10055311
816 Ga0307516_10574768
817 Ga0307405_10041828
818 Ga0307405_10453019
819 Ga0307413_10006417
820 Ga0307413_10793322
821 Ga0307410_10120226
822 Ga0307410_10140542
823 Ga0307410_10203206
824 Ga0307406_10010103
825 Ga0307407_10718301
826 Ga0307412_10011588
827 Ga0307412_10028681
828 Ga0307412_10121505
829 Ga0307412_10135992
830 Ga0307412_11175696
831 Ga0307409_100038431
832 Ga0307409_100419972
833 Ga0307416_100298784
834 Ga0307414_10220364
835 Ga0307414_10651546
836 Ga0307414_11408703
837 Ga0307414_11909552
838 Ga0307411_10037882
839 Ga0307411_10185876
840 Ga0307415_100097593
841 Ga0307507_10513741
842 Ga0307510_10000426
843 Ga0307510_10051249
844 Ga0373931_0148386
845 Ga0373925_0038381
846 Ga0395905_0000914
847 Ga0395905_0030092
848 Ga0436361_0267348
849 Ga0439436_0015525
850 Ga0439439_0035051
851 Ga0439447_014070
852 Ga0439466_0003244
853 Ga0439465_0005171
854 Ga0439465_0060130
855 Ga0451789_0482962
856 Ga0451791_1207047
857 Ga0451791_1739669
858 Ga0451835_0210024
859 Ga0451853_0015814
860 Ga0451853_1773097
861 Ga0451853_2803228
862 Ga0439431_0214371
863 Ga0439433_0001455
864 Ga0439442_013792
865 Ga0439445_0000788
866 Ga0439432_010623
867 Ga0439432_024551
868 Ga0439449_0003246
869 Ga0439449_0016033
870 Ga0439452_008815
871 Ga0439457_026766
872 Ga0439462_0023616
873 Ga0450890_005709
874 Ga0439446_0003074
875 Ga0450908_093550
876 Ga0439434_0006134
877 Ga0439459_0002279
878 Ga0439459_0062567
879 Ga0453684_0469617
880 Ga0453684_1758281
881 Ga0466960_0481298
882 Ga0451576_0068807
883 Ga0451576_0118588
884 Ga0451576_0593126
885 Ga0495627_098870
886 Ga0495592_0000499
887 Ga0495638_0231819
888 Ga0495650_0020449
889 Ga0495605_0271607
890 Ga0495583_0046253
891 Ga0495610_0162656
892 Ga0495616_0171512
893 Ga0495620_0118362
894 Ga0495620_0315785
895 Ga0495631_0262365
896 Ga0495632_0041517
897 Ga0495643_0067676
898 Ga0495643_0257362
899 Ga0495643_0526827
900 Ga0495648_0281881
901 Ga0495663_0322261
902 Ga0495642_0360599
903 Ga0495654_0278394
904 Ga0495609_0209742
905 Ga0495597_0000250
906 Ga0495597_0226881
907 Ga0495597_0386876
908 Ga0495668_0467761
909 Ga0495611_0095240
910 Ga0495625_0023905
911 Ga0495625_0072666
912 Ga0495646_0049026
913 Ga0495671_0171970
914 Ga0495671_0561509
915 Ga0495649_0017603
916 Ga0495660_0062059
917 Ga0495687_000850
918 Ga0495686_0114625
919 Ga0495686_0138428
920 Ga0495626_0076302
921 Ga0496102_0003119
922 Ga0496106_0640215
923 Ga0496110_0065223
924 Ga0496110_0208804
925 Ga0496113_1571107
926 Ga0496122_0000080
927 Ga0496123_0000631
928 Ga0496124_0052837
929 Ga0496124_0392331
930 Ga0495682_0075702
931 Ga0501298_006064
932 Ga0501225_0180405
933 Ga0501262_018356
934 Ga0501265_024200
935 Ga0501281_02980
936 nmdc:mga03683_111250_c1
937 nmdc:mga03683_29767_c1
938 nmdc:mga03683_42516_c1
939 nmdc:mga03683_93042_c1
940 nmdc:mga03n38_611983_c1
941 nmdc:mga03n38_720618_c1
942 nmdc:mga03n38_750947_c1
943 nmdc:mga00v17_206875_c1
944 nmdc:mga0k408_131094_c1
945 nmdc:mga0k408_131814_c1
946 nmdc:mga0k408_20694_c1
947 nmdc:mga0k408_2131_c2
948 nmdc:mga0k408_22330_c1
949 nmdc:mga0k408_3038_c1
950 nmdc:mga0k408_332188_c1
951 nmdc:mga0k408_346596_c1
952 nmdc:mga0k408_71031_c1
953 nmdc:mga0k408_95210_c1
954 nmdc:mga06z11_128314_c1
955 nmdc:mga06z11_2604_c1
956 nmdc:mga06z11_412303_c1
957 nmdc:mga06z11_51976_c1
958 nmdc:mga04h51_292773_c1
959 nmdc:mga07m45_100603_c1
960 nmdc:mga07m45_17452_c1
961 nmdc:mga07m45_24189_c1
962 nmdc:mga07m45_305969_c1
963 nmdc:mga07m45_365_c1
964 nmdc:mga09592_1387047_c1
965 nmdc:mga09592_86155_c1
966 nmdc:mga08y16_273137_c1
967 nmdc:mga08y16_510018_c1
968 nmdc:mga08y16_595283_c1
969 nmdc:mga0sz30_71830_c2
970 Ga0500578_0115476
971 Ga0500578_0134476
972 Ga0500644_0001310
973 Ga0500646_0291916
974 Ga0500651_0242296
975 Ga0500641_0313414
976 Ga0500562_086333
977 Ga0500572_174443
978 Ga0500593_002462
979 Ga0500594_0002849
980 Ga0500614_005038
981 Ga0500618_090825
982 Ga0500652_230599
983 Ga0500655_101236
984 Ga0500658_0012879
985 Ga0500559_0000097
986 Ga0500564_076566
987 Ga0500568_0067329
988 Ga0500604_0021600
989 Ga0500619_000326
990 Ga0500619_081727
991 Ga0500622_0006958
992 Ga0500622_0068638
993 Ga0500633_0250659
994 Ga0500584_114010
995 Ga0500587_001802
996 2588292848
997 2643932416
998 2644163706
999 2644305817
1000 2644313667
1001 2644339810
1002 2739054721
1003 2885194361
1004 2886853015
1005 2945915035
1006 2945989560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05437

AzlD

Branched-chain amino acid transport protein (AzlD)

20

118

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v76-assembly1.cif.gz_AO e. coli 70s-fmetval-trnaval-trnafmet complex in intermediate post-translocation state (post2a) 0.3608 47 104
6f7s-assembly1.cif.gz_C crystal structure of human ars2 residues 147-270 + 408-763 with deletion of loop b 0.3008 43 106
4v76-assembly1.cif.gz_AO e. coli 70s-fmetval-trnaval-trnafmet complex in intermediate post-translocation state (post2a) 0.2885 47 104
8hl3-assembly1.cif.gz_S15P cryo-em structures and translocation mechanism of crenarchaeota ribosome 0.2842 27 99
1ybz-assembly1.cif.gz_A conserved hypothetical protein from pyrococcus furiosus pfu-1581948-001 0.2247 15 100
ID Description Score Start End Superfamily
af_F1R807_26_101_1.20.1160.20 Mainly Alpha;Up-down Bundle;Paired amphipathic helix 2 (pah2 repeat); 0.5355 48 100 1.20.1160.20
af_F1R807_26_101_1.20.1160.20 Mainly Alpha;Up-down Bundle;Paired amphipathic helix 2 (pah2 repeat); 0.3593 48 100 1.20.1160.20
af_A0A1D6FE20_16_201_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.3579 37 100 1.20.144.10
5h37F00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Flavivirus envelope glycoprotein M-like 0.3544 27 102 1.10.8.970
6co8B00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Flavivirus envelope glycoprotein M-like 0.2921 54 102 1.10.8.970
ID Description Score Start End GO Terms
AF-A0A7G9XSN0-F1-model_v4 AzlD domain-containing protein 0.7688 5 109 GO:0016020
AF-A0A0M0I3S4-F1-model_v4 Branched-chain amino acid ABC transporter 0.766 6 105 GO:0016020
AF-A0A1V1RGB4-F1-model_v4 Predicted membrane protein 0.7612 12 101 GO:0016020
AF-A0A1Y0I889-F1-model_v4 Branched-chain amino acid transport 0.7597 14 105 GO:0016020
AF-A0A832LR25-F1-model_v4 AzlD domain-containing protein 0.7547 14 109

Map