F455993

General Info

Members Datasets Scaffolds Average Seq Length
503 314 429 453

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1012186|Ga0079104_10121862
Length 494
Sequence MRGGEGFSAASAIGYNARLPGIFMTPNMQSQPLSRITKPAAATTISGAAPKVGFVSLGCPKALVDSEQILTQLRAEGYETAKSYDGADLVIVNTCGFIDAAVQESLDAIGEALAENGKVIVTGCLGAKKDAAGDDIIMKVHPKVLAVTGPHALAEVMDSVHFHLPKPHEPFIDLLPPQGIKLTPKHYAYLKISEGCNHRCSFCIIPSMRGDLVSRPIGELLLEAENLFKSGVKELLVISQDTSAYGVDVKFRTGFWNGRPIKTHMTQLMEALGELAKSHGAWVRMHYVYPYPHVDQVIPMMGEHVLPYLDIPMQHAHPDVLKRMKRPASGEKNLDRILAWRKMNPDLTIRSTFIAGFPGETEEEFQYLLDFLKEAQIDRLGCFAYSPVEGATANELANPVPEEVREERRGRVMLLQEEISKNRLKAKVGKTVRVLIDEVNRTGGVGRSAADAPEIDGVVYVKPPYEPHKKLVVGQFVDVRITTSDAHDLWGEAQ

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
3 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
4 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
5 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
6 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
7 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
8 2547132512 Azospira oryzae 6a3 Isolate Unclassified
9 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
10 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
11 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
12 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
13 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
14 2643221638 Duganella sp. Root336D2 Isolate Unclassified
15 2643221645 Massilia sp. Root351 Isolate Unclassified
16 2643221664 Massilia sp. Root418 Isolate Unclassified
17 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
18 2738541280 Massilia sp. GV090 Isolate Unclassified
19 2738541297 Duganella sp. GV083 Isolate Unclassified
20 2738541300 Massilia sp. GV016 Isolate Unclassified
21 2738541357 Duganella sp. GV053 Isolate Unclassified
22 2738543003 Duganella sp. GV066 Isolate Unclassified
23 2738543018 Massilia sp. GV045 Isolate Unclassified
24 2738543026 Duganella sp. GV089 Isolate Unclassified
25 2738543029 Duganella sp. GV039 Isolate Unclassified
26 2738543030 Massilia sp. GV097 Isolate Unclassified
27 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
28 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
29 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
30 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
31 2818991436 Collimonas arenae 515 Isolate Unclassified
32 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
33 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
34 2821131069 Duganella sp. 1224 Isolate Unclassified
35 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
36 2842711865 Duganella sp. R-73148 Isolate Unclassified
37 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
38 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
39 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
40 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
41 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
42 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
43 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
44 2857553236 Duganella sp. R-74557 Isolate Unclassified
45 2857558681 Duganella sp. R-74565 Isolate Unclassified
46 2857564685 Duganella sp. R-74599 Isolate Unclassified
47 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
48 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
49 2876601092 Pantoea endophytica 596 Isolate Unclassified
50 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
51 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
52 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
53 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
54 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
55 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
56 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
57 2904424332 Duganella sp. 1411 Isolate Rhizosphere
58 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
59 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
60 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
61 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
62 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
63 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
64 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
65 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
66 2919476304 Duganella sp. 3397 Isolate Unclassified
67 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
68 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
69 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
70 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
71 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
72 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
73 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
74 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
75 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
76 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
77 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
78 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
79 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
80 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
81 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
82 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
83 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
84 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
85 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
86 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
87 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
88 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
89 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
90 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
91 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
92 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
93 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
94 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
95 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
96 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
97 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
98 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
99 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
100 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
101 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
102 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
103 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
104 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
105 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
106 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
107 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
108 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
109 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
110 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
115 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
116 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
117 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
127 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
130 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
131 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
140 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
142 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
143 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
144 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
146 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
147 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
148 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
154 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
156 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
174 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
176 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
183 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
184 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
187 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
190 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
194 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
199 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
206 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
207 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
208 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
209 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
210 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
211 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
212 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
213 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
216 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
217 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
222 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
223 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
224 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
234 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
235 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
236 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
240 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
241 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
244 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
245 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
246 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
251 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
252 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
253 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
256 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
257 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
260 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
261 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
262 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
263 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
264 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
265 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
266 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
269 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
270 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
271 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
272 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
273 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
274 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
275 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
276 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
277 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
278 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
290 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
293 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
294 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
302 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
303 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
310 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
311 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
312 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
313 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
314 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.69
Metatranscriptomes 0.6
Isolates 14.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.88
Nodule 1.39
Rhizoplane 1.19
Rhizosphere 59.44
Stem 0
Stem Tuber 0.99
Unclassified 17.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000892 3300002705 Bacteria 14717
2 JGI25162J39368_1000015 3300002737 Bacteria 316381
3 JGI25154J39366_1000326 3300002738 Bacteria 27616
4 JGI25154J39366_1000411 3300002738 Bacteria 23133
5 JGI25154J39366_1000643 3300002738 Bacteria 16415
6 JGI25157J39369_1000382 3300002741 Bacteria 30479
7 JGI25152J39213_1000215 3300002773 Bacteria 39286
8 JGI25150J39212_1000217 3300002774 Bacteria 31369
9 JGI25150J39212_1005926 3300002774 Bacteria 2569
10 JGI25159J45721_1001651 3300002987 Bacteria 9072
11 JGI25159J45721_1002121 3300002987 Bacteria 7768
12 JGI25165J46597_1000001 3300003214 Bacteria 1111887
13 JGI25153J46596_10004709 3300003215 Bacteria 7283
14 JGI25161J50226_1001110 3300003374 Bacteria 9072
15 Ga0007417J51691_1018264 3300003544 Bacteria 1469
16 Ga0055538_1000001 3300003751 Bacteria 1111887
17 Ga0055538_1000016 3300003751 Bacteria 305460
18 Ga0055539_1000001 3300003752 Bacteria 1111887
19 Ga0055539_1000021 3300003752 Bacteria 305460
20 Ga0055533_1000003 3300003756 Bacteria 1111887
21 Ga0055533_1000029 3300003756 Bacteria 305460
22 Ga0055532_1000050 3300003758 Bacteria 169240
23 Ga0055525_1000003 3300003759 Bacteria 962094
24 Ga0055525_1000033 3300003759 Bacteria 305460
25 Ga0055529_1000128 3300003763 Bacteria 108143
26 Ga0055526_1000013 3300003771 Bacteria 233580
27 Ga0055526_1000019 3300003771 Bacteria 189698
28 Ga0055526_1002048 3300003771 Bacteria 13854
29 Ga0055526_1002060 3300003771 Bacteria 13811
30 Ga0055526_1024791 3300003771 Bacteria 1947
31 Ga0055537_1000417 3300003773 Bacteria 27822
32 Ga0055524_1000152 3300003775 Bacteria 82221
33 Ga0055534_1000045 3300003784 Bacteria 98659
34 Ga0055528_1000414 3300003790 Bacteria 34502
35 Ga0055530_10001777 3300003791 Bacteria 14988
36 Ga0055531_10020122 3300003794 Bacteria 2659
37 Ga0055541_1000001 3300003841 Bacteria 1111887
38 Ga0055541_1000045 3300003841 Bacteria 148620
39 Ga0058692_1005373 3300003856 Bacteria 3654
40 Ga0055543_1001517 3300004625 Bacteria 9110
41 Ga0065165_1000005 3300005262 Bacteria 370361
42 Ga0065165_1004234 3300005262 Bacteria 9110
43 Ga0065714_10066282 3300005288 Bacteria 7208
44 Ga0070682_100016365 3300005337 Bacteria 4311
45 Ga0068868_100100915 3300005338 Bacteria 2335
46 Ga0070661_100005485 3300005344 Bacteria 8747
47 Ga0070659_100015122 3300005366 Bacteria 5773
48 Ga0070705_100016350 3300005440 Bacteria 3854
49 Ga0068855_100004974 3300005563 Bacteria 16215
50 Ga0068857_100160514 3300005577 Bacteria 2040
51 Ga0068854_100003581 3300005578 Bacteria 9709
52 Ga0070717_10141670 3300006028 Bacteria 2074
53 Ga0075364_10015144 3300006051 Bacteria 4775
54 Ga0075366_10025791 3300006195 Bacteria 3437
55 Ga0068865_100034475 3300006881 Bacteria 3396
56 Ga0079104_1012186 3300006946 Bacteria 2721
57 Ga0099826_10000001 3300006948 Bacteria 1155201
58 Ga0105244_10002333 3300009036 Bacteria 14434
59 Ga0105250_10010117 3300009092 Bacteria 3938
60 Ga0105240_10003428 3300009093 Bacteria 24641
61 Ga0105240_10021627 3300009093 Bacteria 8555
62 Ga0105237_10002683 3300009545 Bacteria 21815
63 Ga0105238_10000469 3300009551 Bacteria 42413
64 Ga0105239_10201988 3300010375 Bacteria 2227
65 Ga0105246_10013303 3300011119 Bacteria 5157
66 Ga0105246_10142880 3300011119 Bacteria 1802
67 Ga0157373_10000468 3300013100 Bacteria 32134
68 Ga0157371_10000353 3300013102 Bacteria 58606
69 Ga0157371_10003483 3300013102 Bacteria 14237
70 Ga0182008_10001162 3300014497 Bacteria 18138
71 Ga0182008_10056179 3300014497 Bacteria 1946
72 Ga0182006_1000042 3300015261 Bacteria 202969
73 Ga0182006_1000052 3300015261 Bacteria 182886
74 Ga0182006_1005429 3300015261 Bacteria 6081
75 Ga0182006_1013848 3300015261 Bacteria 3488
76 Ga0182006_1021851 3300015261 Bacteria 2664
77 Ga0182005_1000002 3300015265 Bacteria 908499
78 Ga0182005_1000008 3300015265 Bacteria 471394
79 Ga0182005_1004259 3300015265 Bacteria 4663
80 Ga0163161_10086892 3300017792 Bacteria 2309
81 Ga0213872_10000019 3300021361 Bacteria 172803
82 Ga0213872_10000264 3300021361 Bacteria 45420
83 Ga0213872_10002218 3300021361 Bacteria 11622
84 Ga0209435_100029 3300025206 Bacteria 176358
85 Ga0209436_101380 3300025208 Bacteria 8576
86 Ga0209436_103410 3300025208 Bacteria 4242
87 Ga0209784_100004 3300025224 Bacteria 1378156
88 Ga0209784_100033 3300025224 Bacteria 305649
89 Ga0209566_100004 3300025225 Bacteria 1531866
90 Ga0209566_100037 3300025225 Bacteria 305649
91 Ga0209674_100006 3300025226 Bacteria 1531866
92 Ga0209674_100055 3300025226 Bacteria 305649
93 Ga0209672_103565 3300025228 Bacteria 3166
94 Ga0209147_100004 3300025229 Bacteria 1371850
95 Ga0209563_100009 3300025230 Bacteria 1378156
96 Ga0209563_100056 3300025230 Bacteria 305649
97 Ga0207427_100238 3300025231 Bacteria 44888
98 Ga0209437_100004 3300025233 Bacteria 1378156
99 Ga0209437_100053 3300025233 Bacteria 375580
100 Ga0209437_104064 3300025233 Bacteria 2594
101 Ga0209258_100720 3300025242 Bacteria 22119
102 Ga0207425_1000001 3300025245 Bacteria 2525432
103 Ga0207425_1000056 3300025245 Bacteria 151802
104 Ga0207425_1000178 3300025245 Bacteria 52247
105 Ga0209646_1000007 3300025246 Bacteria 670994
106 Ga0209646_1000073 3300025246 Bacteria 224301
107 Ga0209646_1000109 3300025246 Bacteria 158348
108 Ga0209026_1000467 3300025250 Bacteria 31163
109 Ga0209026_1004099 3300025250 Bacteria 4488
110 Ga0209026_1004249 3300025250 Bacteria 4344
111 Ga0209677_100005 3300025253 Bacteria 1378156
112 Ga0209677_100034 3300025253 Bacteria 305649
113 Ga0209759_1000064 3300025256 Bacteria 193120
114 Ga0209759_1000698 3300025256 Bacteria 30092
115 Ga0209129_1000003 3300025258 Bacteria 903689
116 Ga0209129_1006539 3300025258 Bacteria 3733
117 Ga0209233_1000005 3300025261 Bacteria 1531866
118 Ga0209565_1000003 3300025263 Bacteria 1099648
119 Ga0209565_1000900 3300025263 Bacteria 16075
120 Ga0209565_1001280 3300025263 Bacteria 11665
121 Ga0209565_1004563 3300025263 Bacteria 4186
122 Ga0209455_1000026 3300025272 Bacteria 653778
123 Ga0209673_1000003 3300025273 Bacteria 980859
124 Ga0209130_1000046 3300025284 Bacteria 236658
125 Ga0209130_1001741 3300025284 Bacteria 12990
126 Ga0209130_1011557 3300025284 Bacteria 2359
127 Ga0209675_1000003 3300025291 Bacteria 1003982
128 Ga0209675_1009239 3300025291 Bacteria 3501
129 Ga0209025_1002173 3300025294 Bacteria 21804
130 Ga0209025_1005843 3300025294 Bacteria 9850
131 Ga0209564_1000002 3300025295 Bacteria 1636803
132 Ga0209564_1000007 3300025295 Bacteria 1028582
133 Ga0209564_1000012 3300025295 Bacteria 792078
134 Ga0209564_1000272 3300025295 Bacteria 108384
135 Ga0209564_1005898 3300025295 Bacteria 6792
136 Ga0209758_1000041 3300025297 Bacteria 410328
137 Ga0209758_1000475 3300025297 Bacteria 66207
138 Ga0209050_1000011 3300025298 Bacteria 914037
139 Ga0209050_1000089 3300025298 Bacteria 256212
140 Ga0209050_1000470 3300025298 Bacteria 71502
141 Ga0209256_1000007 3300025299 Bacteria 1136599
142 Ga0209256_1000068 3300025299 Bacteria 246064
143 Ga0209256_1000112 3300025299 Bacteria 178432
144 Ga0209256_1001080 3300025299 Bacteria 31504
145 Ga0209256_1007418 3300025299 Bacteria 5412
146 Ga0207426_1001589 3300025302 Bacteria 18204
147 Ga0209257_1000003 3300025304 Bacteria 1702593
148 Ga0207696_1000867 3300025711 Bacteria 18953
149 Ga0207713_1011442 3300025735 Bacteria 4823
150 Ga0207695_10007561 3300025913 Bacteria 13776
151 Ga0207695_10009889 3300025913 Bacteria 11720
152 Ga0207695_10059896 3300025913 Bacteria 3945
153 Ga0207671_10003909 3300025914 Bacteria 14522
154 Ga0207649_10006511 3300025920 Bacteria 6345
155 Ga0207694_10001679 3300025924 Bacteria 18564
156 Ga0207700_10012311 3300025928 Bacteria 5509
157 Ga0207664_10010718 3300025929 Bacteria 6482
158 Ga0207664_10130017 3300025929 Bacteria 2119
159 Ga0207690_10006002 3300025932 Bacteria 7197
160 Ga0207690_10115650 3300025932 Bacteria 1939
161 Ga0207679_10004729 3300025945 Bacteria 8475
162 Ga0207679_10158834 3300025945 Bacteria 1849
163 Ga0207667_10000073 3300025949 Bacteria 174391
164 Ga0207667_10000076 3300025949 Bacteria 166704
165 Ga0207667_10000147 3300025949 Bacteria 106918
166 Ga0207667_10000166 3300025949 Bacteria 97376
167 Ga0207667_10010225 3300025949 Bacteria 10986
168 Ga0207667_10085215 3300025949 Bacteria 3271
169 Ga0207640_10033305 3300025981 Bacteria 3204
170 Ga0207677_10147134 3300026023 Bacteria 1812
171 Ga0209281_1007318 3300027111 Bacteria 2780
172 Ga0209371_1000695 3300027312 Bacteria 28605
173 Ga0209282_1000001 3300027666 Bacteria 2450367
174 Ga0265334_10000021 3300028573 Bacteria 132223
175 Ga0265338_10005703 3300028800 Bacteria 16106
176 Ga0314311_1258383 3300030733 Bacteria 1605
177 Ga0265316_10128999 3300031344 Bacteria 1906
178 Ga0307509_10000079 3300031507 Bacteria 135772
179 Ga0307509_10180080 3300031507 Bacteria 1980
180 Ga0307408_100000903 3300031548 Bacteria 23332
181 Ga0307408_100022032 3300031548 Bacteria 4322
182 Ga0265313_10000275 3300031595 Bacteria 56249
183 Ga0265313_10006074 3300031595 Bacteria 8709
184 Ga0316575_10000866 3300031665 Bacteria 9296
185 Ga0316579_10017553 3300031691 Bacteria 3138
186 Ga0316579_10063257 3300031691 Bacteria 1744
187 Ga0265314_10015022 3300031711 Bacteria 6164
188 Ga0316578_10017025 3300031728 Bacteria 3947
189 Ga0316577_10015402 3300031733 Bacteria 4207
190 Ga0307414_10010455 3300032004 Bacteria 5385
191 Ga0316585_10001860 3300032137 Bacteria 5636
192 Ga0316593_10000946 3300032168 Bacteria 5979
193 Ga0316593_10009601 3300032168 Bacteria 2741
194 Ga0373944_0016385 3300035089 Bacteria 2089
195 Ga0373946_0017883 3300035171 Bacteria 2715
196 Ga0316574_0012880 3300035398 Bacteria 4794
197 Ga0316574_0060472 3300035398 Bacteria 2378
198 Ga0316574_0086342 3300035398 Bacteria 1997
199 Ga0373924_0013437 3300035410 Bacteria 3077
200 Ga0373927_0000001 3300035695 Bacteria 1082160
201 Ga0373927_0020022 3300035695 Bacteria 4387
202 Ga0373933_0093899 3300035724 Bacteria 1855
203 Ga0373937_0052208 3300036401 Bacteria 3748
204 Ga0316582_0007148 3300036647 Bacteria 5933
205 Ga0316582_0020677 3300036647 Bacteria 3875
206 Ga0316582_0023997 3300036647 Bacteria 3642
207 Ga0316584_0004910 3300036712 Bacteria 8898
208 Ga0316584_0011597 3300036712 Bacteria 6198
209 Ga0316584_0024664 3300036712 Bacteria 4404
210 Ga0395899_0001574 3300037312 Bacteria 19187
211 Ga0395899_0001610 3300037312 Bacteria 18879
212 Ga0395900_0043594 3300037418 Bacteria 4624
213 Ga0395900_0059334 3300037418 Bacteria 3938
214 Ga0395905_0002252 3300037471 Bacteria 21683
215 Ga0395905_0002305 3300037471 Bacteria 21378
216 Ga0395905_0020485 3300037471 Bacteria 6266
217 Ga0316581_0000832 3300037588 Bacteria 6458
218 Ga0316581_0022623 3300037588 Bacteria 1854
219 Ga0395901_0069482 3300038443 Bacteria 3668
220 Ga0395901_0107480 3300038443 Bacteria 2929
221 Ga0400490_15415 3300038726 Bacteria 9869
222 Ga0400490_15512 3300038726 Bacteria 21851
223 Ga0400490_42399 3300038726 Bacteria 3870
224 Ga0400490_43208 3300038726 Bacteria 40847
225 Ga0400488_62806 3300038741 Bacteria 6745
226 Ga0400486_15667 3300038742 Bacteria 16408
227 Ga0400483_196187 3300039062 Bacteria 25625
228 Ga0400483_225203 3300039062 Bacteria 6113
229 Ga0400489_22278 3300039093 Unclassified 4060
230 Ga0400489_57664 3300039093 Bacteria 35187
231 Ga0400489_74893 3300039093 Bacteria 1208
232 Ga0400487_21768 3300039110 Bacteria 3571
233 Ga0400487_43094 3300039110 Bacteria 17442
234 Ga0436361_0565150 3300039447 Bacteria 81523
235 Ga0436361_0589877 3300039447 Bacteria 17717
236 Ga0436361_0793274 3300039447 Bacteria 2623
237 Ga0439438_000001 3300041405 Bacteria 1263568
238 Ga0439432_003713 3300042006 Bacteria 5648
239 Ga0466972_0000005 3300044658 Bacteria 289640
240 Ga0466972_0008997 3300044658 Bacteria 5013
241 Ga0466977_0030594 3300044666 Bacteria 3437
242 Ga0453683_0022973 3300044673 Bacteria 3975
243 Ga0466965_0048283 3300044683 Bacteria 2109
244 Ga0453684_0010310 3300044712 Bacteria 16003
245 Ga0453684_0046690 3300044712 Bacteria 5756
246 Ga0453684_0053624 3300044712 Bacteria 5261
247 Ga0453684_0054976 3300044712 Bacteria 5179
248 Ga0453684_0061399 3300044712 Bacteria 4824
249 Ga0453684_0148447 3300044712 Bacteria 2789
250 Ga0453684_0173345 3300044712 Unclassified 2540
251 Ga0466959_0044872 3300045049 Bacteria 3256
252 Ga0451576_0001867 3300045051 Bacteria 34008
253 Ga0451576_0003867 3300045051 Bacteria 20079
254 Ga0451576_0019998 3300045051 Bacteria 7298
255 Ga0451576_0069565 3300045051 Bacteria 3663
256 Ga0451576_0262288 3300045051 Unclassified 1806
257 Ga0495617_000072 3300046452 Bacteria 80951
258 Ga0495627_000001 3300046453 Bacteria 1104709
259 Ga0495590_0000005 3300046457 Bacteria 384276
260 Ga0495591_000014 3300046458 Bacteria 254281
261 Ga0495638_0000349 3300046460 Bacteria 57958
262 Ga0495651_0010041 3300046462 Bacteria 7277
263 Ga0495653_0000040 3300046463 Bacteria 119794
264 Ga0495650_0000032 3300046471 Bacteria 425389
265 Ga0495650_0000044 3300046471 Bacteria 355139
266 Ga0495650_0000066 3300046471 Bacteria 272883
267 Ga0495650_0000490 3300046471 Bacteria 60177
268 Ga0495650_0000517 3300046471 Bacteria 57394
269 Ga0495580_0010521 3300046472 Bacteria 7202
270 Ga0495605_0000038 3300046474 Bacteria 197063
271 Ga0495639_0010588 3300046475 Bacteria 3971
272 Ga0495584_0000338 3300046491 Bacteria 32518
273 Ga0495584_0004194 3300046491 Bacteria 7777
274 Ga0495584_0035290 3300046491 Bacteria 2528
275 Ga0495585_0002199 3300046492 Bacteria 14166
276 Ga0495596_0002938 3300046500 Bacteria 8845
277 Ga0495596_0015658 3300046500 Bacteria 3169
278 Ga0495607_0002978 3300046501 Bacteria 13280
279 Ga0495607_0010211 3300046501 Bacteria 6316
280 Ga0495607_0042409 3300046501 Bacteria 2697
281 Ga0495583_0000100 3300046506 Bacteria 145745
282 Ga0495583_0000117 3300046506 Bacteria 135061
283 Ga0495583_0001088 3300046506 Bacteria 30090
284 Ga0495606_0000053 3300046507 Bacteria 200818
285 Ga0495606_0000087 3300046507 Bacteria 156407
286 Ga0495606_0000202 3300046507 Bacteria 103924
287 Ga0495606_0002790 3300046507 Bacteria 19512
288 Ga0495606_0003035 3300046507 Bacteria 18341
289 Ga0495606_0003994 3300046507 Bacteria 15071
290 Ga0495606_0076125 3300046507 Bacteria 2098
291 Ga0495608_0026925 3300046511 Bacteria 3916
292 Ga0495610_0000008 3300046512 Bacteria 622732
293 Ga0495610_0003853 3300046512 Bacteria 11404
294 Ga0495610_0017089 3300046512 Bacteria 4147
295 Ga0495616_0021191 3300046513 Bacteria 3523
296 Ga0495628_0003181 3300046516 Bacteria 14713
297 Ga0495630_0034675 3300046517 Bacteria 3769
298 Ga0495637_0001097 3300046520 Bacteria 16706
299 Ga0495643_0000195 3300046522 Bacteria 96110
300 Ga0495644_0001383 3300046523 Bacteria 9917
301 Ga0495644_0010790 3300046523 Bacteria 3520
302 Ga0495648_0000002 3300046524 Bacteria 593972
303 Ga0495648_0002469 3300046524 Bacteria 16985
304 Ga0495648_0003036 3300046524 Bacteria 15025
305 Ga0495648_0009628 3300046524 Bacteria 7454
306 Ga0495648_0026349 3300046524 Bacteria 3915
307 Ga0495666_0004702 3300046526 Bacteria 6904
308 Ga0495642_0001181 3300046528 Bacteria 11993
309 Ga0495642_0008038 3300046528 Bacteria 4035
310 Ga0495652_0021718 3300046529 Bacteria 5705
311 Ga0495654_0000002 3300046530 Bacteria 1021205
312 Ga0495654_0000049 3300046530 Bacteria 147151
313 Ga0495654_0000790 3300046530 Bacteria 24379
314 Ga0495586_0004296 3300046535 Bacteria 7613
315 Ga0495609_0000176 3300046538 Bacteria 64707
316 Ga0495609_0000177 3300046538 Bacteria 64469
317 Ga0495609_0003489 3300046538 Bacteria 8987
318 Ga0495609_0020021 3300046538 Bacteria 3092
319 Ga0495597_0000055 3300046542 Bacteria 95175
320 Ga0495645_0017184 3300046543 Bacteria 5182
321 Ga0495622_0000009 3300046557 Bacteria 224622
322 Ga0495622_0000586 3300046557 Bacteria 21427
323 Ga0495622_0039785 3300046557 Bacteria 2189
324 Ga0495633_0000024 3300046558 Bacteria 225077
325 Ga0495633_0002266 3300046558 Bacteria 13757
326 Ga0495633_0003312 3300046558 Bacteria 10827
327 Ga0495668_0000006 3300046616 Bacteria 553404
328 Ga0495668_0001072 3300046616 Bacteria 28855
329 Ga0495668_0002756 3300046616 Bacteria 14045
330 Ga0495668_0007812 3300046616 Bacteria 6777
331 Ga0495625_0000124 3300046660 Bacteria 120849
332 Ga0495625_0000779 3300046660 Bacteria 44278
333 Ga0495625_0002364 3300046660 Bacteria 20536
334 Ga0495625_0005633 3300046660 Bacteria 11356
335 Ga0495625_0025805 3300046660 Bacteria 4449
336 Ga0495659_0000001 3300046664 Bacteria 325846
337 Ga0495659_0000141 3300046664 Bacteria 31709
338 Ga0495661_0004752 3300046665 Bacteria 9748
339 Ga0495599_0007071 3300046678 Bacteria 6793
340 Ga0495623_0045749 3300046679 Bacteria 2779
341 Ga0495646_0009535 3300046680 Bacteria 6162
342 Ga0495647_0000474 3300046681 Bacteria 11658
343 Ga0495670_0030404 3300046691 Bacteria 2682
344 Ga0495671_0000002 3300046692 Bacteria 1136189
345 Ga0495671_0000445 3300046692 Bacteria 32757
346 Ga0495600_0004091 3300046809 Bacteria 8680
347 Ga0495660_0000038 3300046810 Bacteria 188167
348 Ga0495660_0000086 3300046810 Bacteria 100316
349 Ga0495660_0000489 3300046810 Bacteria 32927
350 Ga0495660_0006529 3300046810 Bacteria 6890
351 Ga0495604_0066630 3300047317 Bacteria 2738
352 Ga0495636_0000523 3300047318 Bacteria 14138
353 Ga0495636_0003256 3300047318 Bacteria 6291
354 Ga0495636_0032750 3300047318 Bacteria 2133
355 Ga0495672_0000004 3300047320 Bacteria 631810
356 Ga0495672_0000219 3300047320 Bacteria 81635
357 Ga0495672_0000605 3300047320 Bacteria 40392
358 Ga0495672_0026170 3300047320 Bacteria 3724
359 Ga0495672_0046541 3300047320 Bacteria 2586
360 Ga0495676_0162631 3300047321 Bacteria 1578
361 Ga0495683_0001736 3300047323 Bacteria 13785
362 Ga0495683_0002953 3300047323 Bacteria 10060
363 Ga0495683_0036740 3300047323 Bacteria 2485
364 Ga0495687_000191 3300047443 Bacteria 88251
365 Ga0495687_002010 3300047443 Bacteria 17245
366 Ga0495687_002207 3300047443 Bacteria 16097
367 Ga0495687_017349 3300047443 Bacteria 3594
368 Ga0495687_062516 3300047443 Bacteria 1527
369 Ga0495685_000033 3300047447 Bacteria 57157
370 Ga0495673_0000005 3300047469 Bacteria 943364
371 Ga0495673_0000067 3300047469 Bacteria 219908
372 Ga0495673_0000095 3300047469 Bacteria 183429
373 Ga0495673_0000199 3300047469 Bacteria 93637
374 Ga0495681_0026528 3300047470 Bacteria 3012
375 Ga0495686_0000231 3300047472 Bacteria 102239
376 Ga0495686_0000526 3300047472 Bacteria 55119
377 Ga0495686_0006302 3300047472 Bacteria 9116
378 Ga0495686_0014078 3300047472 Bacteria 5522
379 Ga0495686_0060960 3300047472 Bacteria 2344
380 Ga0495602_0037073 3300048088 Bacteria 4530
381 Ga0496101_0000076 3300048904 Bacteria 111590
382 Ga0496102_0000101 3300048905 Bacteria 123198
383 Ga0496102_0265116 3300048905 Bacteria 1619
384 Ga0496111_0153557 3300048914 Bacteria 1708
385 Ga0496116_0023508 3300048919 Bacteria 4587
386 Ga0496117_0000001 3300048920 Bacteria 2526244
387 Ga0496118_0000002 3300048921 Bacteria 1690764
388 Ga0496120_0000680 3300048923 Bacteria 49946
389 Ga0496121_0003561 3300048924 Bacteria 22036
390 Ga0496121_0014532 3300048924 Bacteria 8347
391 Ga0496122_0001831 3300048925 Bacteria 32402
392 Ga0496123_0002340 3300048926 Bacteria 23785
393 Ga0496123_0006319 3300048926 Bacteria 11512
394 Ga0496123_0006703 3300048926 Bacteria 11092
395 Ga0496125_0002187 3300048928 Bacteria 26101
396 Ga0496125_0009347 3300048928 Bacteria 10100
397 Ga0496126_0011924 3300048929 Bacteria 8938
398 Ga0496126_0023512 3300048929 Bacteria 5971
399 Ga0495678_000002 3300049459 Bacteria 999613
400 Ga0495678_000071 3300049459 Bacteria 128709
401 Ga0495678_000360 3300049459 Bacteria 46626
402 Ga0495682_0000015 3300049460 Bacteria 235048
403 Ga0495682_0000761 3300049460 Bacteria 20689
404 Ga0501032_0002852 3300049569 Bacteria 13440
405 Ga0501032_0022570 3300049569 Bacteria 4361
406 Ga0501034_0103272 3300049571 Bacteria 2844
407 Ga0501036_0003894 3300049572 Bacteria 11979
408 Ga0501038_0009406 3300049574 Bacteria 8968
409 Ga0501039_0126171 3300049575 Bacteria 2007
410 Ga0501043_0021184 3300049579 Bacteria 5096
411 Ga0501043_0031540 3300049579 Bacteria 4165
412 Ga0501046_0002556 3300049580 Bacteria 17026
413 Ga0501249_009907 3300049679 Bacteria 1985
414 Ga0501083_0059480 3300049744 Bacteria 2556
415 Ga0501269_000270 3300049766 Bacteria 14632
416 Ga0501035_0000158 3300049822 Bacteria 82890
417 Ga0501035_0017274 3300049822 Bacteria 6652
418 Ga0501035_0213283 3300049822 Bacteria 1651
419 Ga0501044_0000103 3300049823 Bacteria 103893
420 Ga0501044_0026380 3300049823 Bacteria 6149
421 nmdc:mga00v17_14443_c1 3300050491 Bacteria 4406
422 nmdc:mga0k408_6904_c1 3300050493 Bacteria 6058
423 Ga0495601_0008364 3300053077 Bacteria 6113
424 Ga0500618_000857 3300053125 Bacteria 16351
425 Ga0500618_002590 3300053125 Bacteria 6689
426 Ga0500618_008681 3300053125 Bacteria 2820
427 Ga0500621_000001 3300053126 Bacteria 1049698
428 Ga0500636_0002439 3300053177 Bacteria 10304
429 Ga0500625_009635 3300053729 Bacteria 4315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039093 Ga0400489_74893 Ga0400489_74893_120_1193 351
2 3300005440 Ga0070705_100016350 Ga0070705_1000163503 386
3 3300035089 Ga0373944_0016385 Ga0373944_0016385_395_1573 390
4 3300035171 Ga0373946_0017883 Ga0373946_0017883_1086_2264 390
5 3300035695 Ga0373927_0020022 Ga0373927_0020022_990_2168 390
6 3300046472 Ga0495580_0010521 Ga0495580_0010521_2709_3887 390
7 3300046475 Ga0495639_0010588 Ga0495639_0010588_269_1447 390
8 3300046526 Ga0495666_0004702 Ga0495666_0004702_2528_3706 390
9 3300046535 Ga0495586_0004296 Ga0495586_0004296_1180_2358 390
10 3300046681 Ga0495647_0000474 Ga0495647_0000474_7726_8904 390
11 3300044712 Ga0453684_0053624 Ga0453684_0053624_32_1300 393
12 3300044712 Ga0453684_0054976 Ga0453684_0054976_1578_2858 393
13 3300044712 Ga0453684_0148447 Ga0453684_0148447_1393_2673 393
14 3300045051 Ga0451576_0262288 Ga0451576_0262288_300_1580 393
15 3300039093 Ga0400489_22278 Ga0400489_22278_2155_3534 394
16 3300048914 Ga0496111_0153557 Ga0496111_0153557_11_1195 394
17 3300044712 Ga0453684_0061399 Ga0453684_0061399_3575_4807 410
18 3300045051 Ga0451576_0069565 Ga0451576_0069565_15_1247 410
19 3300044712 Ga0453684_0010310 Ga0453684_0010310_2010_3359 413
20 3300044712 Ga0453684_0173345 Ga0453684_0173345_626_2065 413
21 3300037312 Ga0395899_0001574 Ga0395899_0001574_9318_10670 421
22 3300031691 Ga0316579_10017553 Ga0316579_100175533 422
23 3300032168 Ga0316593_10009601 Ga0316593_100096013 422
24 3300037588 Ga0316581_0000832 Ga0316581_0000832_2053_3372 422
25 iso_pu_bacteria 2526164512 2526210629 425
26 3300044673 Ga0453683_0022973 Ga0453683_0022973_98_1432 428
27 3300006051 Ga0075364_10015144 Ga0075364_100151443 430
28 3300009092 Ga0105250_10010117 Ga0105250_100101174 430
29 3300011119 Ga0105246_10013303 Ga0105246_100133035 430
30 3300011119 Ga0105246_10142880 Ga0105246_101428801 430
31 3300013100 Ga0157373_10000468 Ga0157373_1000046826 430
32 3300013102 Ga0157371_10000353 Ga0157371_1000035352 430
33 3300025711 Ga0207696_1000867 Ga0207696_100086717 430
34 3300025735 Ga0207713_1011442 Ga0207713_10114424 430
35 3300048904 Ga0496101_0000076 Ga0496101_0000076_50828_52153 430
36 3300048919 Ga0496116_0023508 Ga0496116_0023508_2099_3424 430
37 3300048923 Ga0496120_0000680 Ga0496120_0000680_39960_41285 430
38 3300050491 nmdc:mga00v17_14443_c1 nmdc:mga00v17_14443_c1_331_1656 430
39 iso_pu_bacteria 2852103415 2852107554 430
40 3300049571 Ga0501034_0103272 Ga0501034_0103272_61_1356 431
41 iso_pu_bacteria 2537561728 2538424226 432
42 iso_pu_bacteria 2871272651 2871274204 432
43 iso_pu_bacteria 2871282230 2871285326 432
44 iso_pu_bacteria 2989392574 2989396127 432
45 3300035398 Ga0316574_0086342 Ga0316574_0086342_270_1589 433
46 3300036712 Ga0316584_0024664 Ga0316584_0024664_1743_3062 433
47 iso_pu_bacteria 2846033681 2846037782 433
48 iso_pu_bacteria 2846037992 2846040368 433
49 3300013102 Ga0157371_10003483 Ga0157371_100034839 434
50 3300036647 Ga0316582_0020677 Ga0316582_0020677_1304_2611 434
51 3300038726 Ga0400490_42399 Ga0400490_42399_1950_3278 434
52 3300046491 Ga0495584_0004194 Ga0495584_0004194_2115_3425 434
53 3300046507 Ga0495606_0002790 Ga0495606_0002790_3846_5156 434
54 3300046524 Ga0495648_0009628 Ga0495648_0009628_704_2014 434
55 3300046530 Ga0495654_0000790 Ga0495654_0000790_22955_24265 434
56 3300046810 Ga0495660_0000038 Ga0495660_0000038_76720_78030 434
57 3300047321 Ga0495676_0162631 Ga0495676_0162631_128_1438 434
58 3300047323 Ga0495683_0036740 Ga0495683_0036740_115_1425 434
59 3300047469 Ga0495673_0000095 Ga0495673_0000095_39650_40960 434
60 3300049459 Ga0495678_000360 Ga0495678_000360_19333_20643 434
61 3300049460 Ga0495682_0000015 Ga0495682_0000015_210082_211392 434
62 3300053126 Ga0500621_000001 Ga0500621_000001_660802_662112 434
63 iso_pu_bacteria 2511231025 2511378682 434
64 iso_pu_bacteria 2511231035 2511434226 434
65 iso_pu_bacteria 2855195626 2855196865 434
66 iso_pu_bacteria 2876601092 2876602177 434
67 iso_pu_bacteria 2900051742 2900052367 434
68 iso_pu_bacteria 2939602548 2939602731 434
69 iso_pu_bacteria 8016733728 8016736557 434
70 iso_pu_bacteria 8019499862 8019501795 434
71 3300038726 Ga0400490_15415 Ga0400490_15415_1578_2912 435
72 3300038726 Ga0400490_15512 Ga0400490_15512_4868_6202 435
73 3300038726 Ga0400490_43208 Ga0400490_43208_1236_2570 435
74 3300038741 Ga0400488_62806 Ga0400488_62806_2015_3349 435
75 3300038742 Ga0400486_15667 Ga0400486_15667_5272_6606 435
76 3300039062 Ga0400483_196187 Ga0400483_196187_3473_4807 435
77 3300039062 Ga0400483_225203 Ga0400483_225203_3119_4453 435
78 3300039093 Ga0400489_57664 Ga0400489_57664_23751_25085 435
79 3300039110 Ga0400487_21768 Ga0400487_21768_496_1830 435
80 3300039110 Ga0400487_43094 Ga0400487_43094_4582_5916 435
81 3300005288 Ga0065714_10066282 Ga0065714_100662823 436
82 3300031344 Ga0265316_10128999 Ga0265316_101289991 436
83 3300003856 Ga0058692_1005373 Ga0058692_10053731 437
84 3300005338 Ga0068868_100100915 Ga0068868_1001009152 437
85 3300010375 Ga0105239_10201988 Ga0105239_102019882 437
86 3300025932 Ga0207690_10115650 Ga0207690_101156502 437
87 3300025945 Ga0207679_10158834 Ga0207679_101588342 437
88 3300026023 Ga0207677_10147134 Ga0207677_101471342 437
89 3300027312 Ga0209371_1000695 Ga0209371_100069532 437
90 3300035398 Ga0316574_0012880 Ga0316574_0012880_1540_2868 437
91 3300035398 Ga0316574_0060472 Ga0316574_0060472_777_2099 437
92 3300036712 Ga0316584_0004910 Ga0316584_0004910_1347_2669 437
93 3300041405 Ga0439438_000001 Ga0439438_000001_250436_251764 437
94 3300042006 Ga0439432_003713 Ga0439432_003713_1860_3188 437
95 3300044712 Ga0453684_0046690 Ga0453684_0046690_1327_2664 437
96 3300046458 Ga0495591_000014 Ga0495591_000014_10960_12285 437
97 3300046471 Ga0495650_0000032 Ga0495650_0000032_29067_30392 437
98 3300046500 Ga0495596_0015658 Ga0495596_0015658_580_1911 437
99 3300046530 Ga0495654_0000049 Ga0495654_0000049_111141_112466 437
100 3300047320 Ga0495672_0000004 Ga0495672_0000004_2098_3423 437
101 iso_pu_bacteria 2891633521 2891634661 437
102 3300005344 Ga0070661_100005485 Ga0070661_1000054855 438
103 3300025920 Ga0207649_10006511 Ga0207649_100065113 438
104 3300025928 Ga0207700_10012311 Ga0207700_100123113 438
105 3300025929 Ga0207664_10010718 Ga0207664_100107186 438
106 3300025929 Ga0207664_10130017 Ga0207664_101300172 438
107 3300025945 Ga0207679_10004729 Ga0207679_100047295 438
108 3300028573 Ga0265334_10000021 Ga0265334_1000002197 438
109 3300028800 Ga0265338_10005703 Ga0265338_1000570311 438
110 3300031595 Ga0265313_10000275 Ga0265313_1000027551 438
111 3300031595 Ga0265313_10006074 Ga0265313_100060742 438
112 3300035695 Ga0373927_0000001 Ga0373927_0000001_125652_126989 438
113 3300006881 Ga0068865_100034475 Ga0068865_1000344753 439
114 3300031507 Ga0307509_10000079 Ga0307509_1000007955 439
115 3300031665 Ga0316575_10000866 Ga0316575_100008662 439
116 3300031728 Ga0316578_10017025 Ga0316578_100170253 439
117 3300031733 Ga0316577_10015402 Ga0316577_100154023 439
118 3300032137 Ga0316585_10001860 Ga0316585_100018605 439
119 3300035724 Ga0373933_0093899 Ga0373933_0093899_65_1405 439
120 3300036401 Ga0373937_0052208 Ga0373937_0052208_519_1859 439
121 3300036647 Ga0316582_0023997 Ga0316582_0023997_328_1653 439
122 3300036712 Ga0316584_0011597 Ga0316584_0011597_2420_3745 439
123 3300047318 Ga0495636_0032750 Ga0495636_0032750_162_1556 439
124 3300048929 Ga0496126_0023512 Ga0496126_0023512_4526_5869 439
125 iso_pu_bacteria 2706794495 2707101823 439
126 iso_pu_bacteria 2854601825 2854602433 439
127 iso_pu_bacteria 2919497567 2919499737 439
128 3300049569 Ga0501032_0002852 Ga0501032_0002852_1128_2465 440
129 3300049569 Ga0501032_0022570 Ga0501032_0022570_1954_3288 440
130 3300049572 Ga0501036_0003894 Ga0501036_0003894_1245_2582 440
131 3300049574 Ga0501038_0009406 Ga0501038_0009406_7576_8913 440
132 3300049575 Ga0501039_0126171 Ga0501039_0126171_66_1403 440
133 3300049579 Ga0501043_0021184 Ga0501043_0021184_1512_2849 440
134 3300049579 Ga0501043_0031540 Ga0501043_0031540_1339_2676 440
135 3300049580 Ga0501046_0002556 Ga0501046_0002556_12191_13528 440
136 3300049822 Ga0501035_0000158 Ga0501035_0000158_77367_78704 440
137 3300049822 Ga0501035_0017274 Ga0501035_0017274_1139_2476 440
138 3300049822 Ga0501035_0213283 Ga0501035_0213283_265_1599 440
139 3300049823 Ga0501044_0000103 Ga0501044_0000103_85538_86875 440
140 3300049823 Ga0501044_0026380 Ga0501044_0026380_4178_5515 440
141 iso_pu_bacteria 2547132512 2548849080 440
142 3300005366 Ga0070659_100015122 Ga0070659_1000151225 441
143 3300025932 Ga0207690_10006002 Ga0207690_100060023 441
144 3300031691 Ga0316579_10063257 Ga0316579_100632571 441
145 3300032168 Ga0316593_10000946 Ga0316593_100009463 441
146 3300036647 Ga0316582_0007148 Ga0316582_0007148_3534_4886 441
147 3300037588 Ga0316581_0022623 Ga0316581_0022623_480_1832 441
148 3300045051 Ga0451576_0003867 Ga0451576_0003867_18075_19436 441
149 3300045051 Ga0451576_0019998 Ga0451576_0019998_5326_6663 441
150 3300049744 Ga0501083_0059480 Ga0501083_0059480_31_1383 441
151 3300053177 Ga0500636_0002439 Ga0500636_0002439_6558_7904 441
152 3300035410 Ga0373924_0013437 Ga0373924_0013437_1669_3018 442
153 3300037418 Ga0395900_0059334 Ga0395900_0059334_518_1870 442
154 3300053729 Ga0500625_009635 Ga0500625_009635_1691_3043 442
155 3300006195 Ga0075366_10025791 Ga0075366_100257912 443
156 3300025294 Ga0209025_1002173 Ga0209025_10021732 443
157 3300046457 Ga0495590_0000005 Ga0495590_0000005_106958_108289 443
158 3300046460 Ga0495638_0000349 Ga0495638_0000349_9637_10968 443
159 3300046506 Ga0495583_0000100 Ga0495583_0000100_128556_129887 443
160 3300046522 Ga0495643_0000195 Ga0495643_0000195_90586_91917 443
161 3300046524 Ga0495648_0000002 Ga0495648_0000002_297964_299295 443
162 3300046524 Ga0495648_0026349 Ga0495648_0026349_1098_2429 443
163 3300046528 Ga0495642_0001181 Ga0495642_0001181_6557_7888 443
164 3300046538 Ga0495609_0003489 Ga0495609_0003489_5316_6647 443
165 3300046557 Ga0495622_0000586 Ga0495622_0000586_9626_10957 443
166 3300046558 Ga0495633_0002266 Ga0495633_0002266_8002_9333 443
167 3300046660 Ga0495625_0000124 Ga0495625_0000124_19615_20946 443
168 3300047320 Ga0495672_0000605 Ga0495672_0000605_36822_38153 443
169 3300047443 Ga0495687_002010 Ga0495687_002010_4566_5897 443
170 3300047443 Ga0495687_002207 Ga0495687_002207_10192_11523 443
171 3300047469 Ga0495673_0000199 Ga0495673_0000199_9391_10722 443
172 3300049459 Ga0495678_000071 Ga0495678_000071_15280_16611 443
173 3300050493 nmdc:mga0k408_6904_c1 nmdc:mga0k408_6904_c1_1847_3229 443
174 3300045051 Ga0451576_0001867 Ga0451576_0001867_16047_17414 445
175 3300006028 Ga0070717_10141670 Ga0070717_101416702 446
176 3300044683 Ga0466965_0048283 Ga0466965_0048283_415_1779 446
177 3300003751 Ga0055538_1000016 Ga0055538_100001670 447
178 3300003752 Ga0055539_1000021 Ga0055539_100002170 447
179 3300003756 Ga0055533_1000029 Ga0055533_100002970 447
180 3300003759 Ga0055525_1000033 Ga0055525_100003370 447
181 3300003841 Ga0055541_1000045 Ga0055541_100004562 447
182 3300005578 Ga0068854_100003581 Ga0068854_1000035814 447
183 3300009545 Ga0105237_10002683 Ga0105237_1000268311 447
184 3300009551 Ga0105238_10000469 Ga0105238_1000046910 447
185 3300015261 Ga0182006_1005429 Ga0182006_10054297 447
186 3300021361 Ga0213872_10002218 Ga0213872_100022182 447
187 3300025224 Ga0209784_100033 Ga0209784_10003370 447
188 3300025225 Ga0209566_100037 Ga0209566_10003770 447
189 3300025226 Ga0209674_100055 Ga0209674_10005570 447
190 3300025230 Ga0209563_100056 Ga0209563_10005670 447
191 3300025253 Ga0209677_100034 Ga0209677_10003470 447
192 3300025913 Ga0207695_10009889 Ga0207695_100098894 447
193 3300025914 Ga0207671_10003909 Ga0207671_100039092 447
194 3300025924 Ga0207694_10001679 Ga0207694_1000167918 447
195 3300025949 Ga0207667_10010225 Ga0207667_1001022512 447
196 3300025981 Ga0207640_10033305 Ga0207640_100333054 447
197 iso_pu_bacteria 2600255292 2601668035 447
198 iso_pu_bacteria 2643221603 2644030724 448
199 3300002738 JGI25154J39366_1000643 JGI25154J39366_10006435 449
200 3300005337 Ga0070682_100016365 Ga0070682_1000163652 449
201 3300025246 Ga0209646_1000007 Ga0209646_1000007108 449
202 3300038443 Ga0395901_0069482 Ga0395901_0069482_1513_2865 449
203 3300045049 Ga0466959_0044872 Ga0466959_0044872_1369_2721 449
204 3300046501 Ga0495607_0002978 Ga0495607_0002978_6240_7601 449
205 3300046507 Ga0495606_0003035 Ga0495606_0003035_7541_8902 449
206 iso_pu_bacteria 2904434214 2904437573 449
207 3300039447 Ga0436361_0793274 Ga0436361_0793274_133_1515 451
208 3300037471 Ga0395905_0002252 Ga0395905_0002252_7586_8950 452
209 3300037471 Ga0395905_0002305 Ga0395905_0002305_1250_2608 452
210 3300037471 Ga0395905_0020485 Ga0395905_0020485_3218_4606 452
211 3300038443 Ga0395901_0107480 Ga0395901_0107480_470_1858 452
212 3300044658 Ga0466972_0000005 Ga0466972_0000005_126564_127979 452
213 3300044658 Ga0466972_0008997 Ga0466972_0008997_321_1694 452
214 3300046528 Ga0495642_0008038 Ga0495642_0008038_302_1666 452
215 3300047443 Ga0495687_062516 Ga0495687_062516_36_1400 452
216 3300048905 Ga0496102_0265116 Ga0496102_0265116_19_1494 452
217 iso_pu_bacteria 2818991445 2819593475 452
218 3300002987 JGI25159J45721_1002121 JGI25159J45721_10021219 453
219 3300005262 Ga0065165_1000005 Ga0065165_1000005115 453
220 3300005563 Ga0068855_100004974 Ga0068855_1000049742 453
221 3300005577 Ga0068857_100160514 Ga0068857_1001605142 453
222 3300025284 Ga0209130_1000046 Ga0209130_100004637 453
223 3300025949 Ga0207667_10000073 Ga0207667_10000073158 453
224 3300025949 Ga0207667_10000076 Ga0207667_10000076152 453
225 3300025949 Ga0207667_10000147 Ga0207667_1000014791 453
226 3300025949 Ga0207667_10000166 Ga0207667_1000016614 453
227 3300039447 Ga0436361_0589877 Ga0436361_0589877_4038_5510 453
228 3300044666 Ga0466977_0030594 Ga0466977_0030594_1577_2944 453
229 3300046616 Ga0495668_0000006 Ga0495668_0000006_81505_82893 453
230 3300047472 Ga0495686_0000526 Ga0495686_0000526_43201_44589 453
231 iso_pu_bacteria 2818991436 2819540849 453
232 3300002773 JGI25152J39213_1000215 JGI25152J39213_100021529 454
233 3300002774 JGI25150J39212_1000217 JGI25150J39212_10002172 454
234 3300002774 JGI25150J39212_1005926 JGI25150J39212_10059262 454
235 3300002987 JGI25159J45721_1001651 JGI25159J45721_100165110 454
236 3300003215 JGI25153J46596_10004709 JGI25153J46596_100047096 454
237 3300003374 JGI25161J50226_1001110 JGI25161J50226_100111010 454
238 3300003763 Ga0055529_1000128 Ga0055529_100012861 454
239 3300003771 Ga0055526_1000013 Ga0055526_1000013202 454
240 3300003771 Ga0055526_1000019 Ga0055526_100001987 454
241 3300003771 Ga0055526_1002048 Ga0055526_10020488 454
242 3300003771 Ga0055526_1002060 Ga0055526_10020607 454
243 3300003771 Ga0055526_1024791 Ga0055526_10247912 454
244 3300003773 Ga0055537_1000417 Ga0055537_10004175 454
245 3300003784 Ga0055534_1000045 Ga0055534_100004546 454
246 3300003790 Ga0055528_1000414 Ga0055528_100041423 454
247 3300003791 Ga0055530_10001777 Ga0055530_100017778 454
248 3300003794 Ga0055531_10020122 Ga0055531_100201221 454
249 3300004625 Ga0055543_1001517 Ga0055543_100151710 454
250 3300005262 Ga0065165_1004234 Ga0065165_100423410 454
251 3300006946 Ga0079104_1012186 Ga0079104_10121862 454
252 3300009036 Ga0105244_10002333 Ga0105244_100023339 454
253 3300015261 Ga0182006_1000042 Ga0182006_1000042164 454
254 3300015265 Ga0182005_1000008 Ga0182005_1000008147 454
255 3300025208 Ga0209436_101380 Ga0209436_1013809 454
256 3300025208 Ga0209436_103410 Ga0209436_1034103 454
257 3300025233 Ga0209437_104064 Ga0209437_1040642 454
258 3300025245 Ga0207425_1000001 Ga0207425_1000001321 454
259 3300025245 Ga0207425_1000056 Ga0207425_1000056113 454
260 3300025245 Ga0207425_1000178 Ga0207425_10001786 454
261 3300025258 Ga0209129_1000003 Ga0209129_1000003321 454
262 3300025258 Ga0209129_1006539 Ga0209129_10065392 454
263 3300025263 Ga0209565_1000003 Ga0209565_1000003472 454
264 3300025263 Ga0209565_1000900 Ga0209565_100090012 454
265 3300025263 Ga0209565_1001280 Ga0209565_10012801 454
266 3300025263 Ga0209565_1004563 Ga0209565_10045633 454
267 3300025272 Ga0209455_1000026 Ga0209455_1000026312 454
268 3300025273 Ga0209673_1000003 Ga0209673_1000003358 454
269 3300025284 Ga0209130_1001741 Ga0209130_10017416 454
270 3300025284 Ga0209130_1011557 Ga0209130_10115571 454
271 3300025291 Ga0209675_1000003 Ga0209675_1000003566 454
272 3300025291 Ga0209675_1009239 Ga0209675_10092392 454
273 3300025294 Ga0209025_1005843 Ga0209025_10058435 454
274 3300025295 Ga0209564_1000002 Ga0209564_1000002808 454
275 3300025295 Ga0209564_1000007 Ga0209564_1000007141 454
276 3300025295 Ga0209564_1000012 Ga0209564_1000012374 454
277 3300025295 Ga0209564_1000272 Ga0209564_10002729 454
278 3300025295 Ga0209564_1005898 Ga0209564_10058986 454
279 3300025297 Ga0209758_1000041 Ga0209758_1000041269 454
280 3300025297 Ga0209758_1000475 Ga0209758_100047518 454
281 3300025298 Ga0209050_1000011 Ga0209050_100001191 454
282 3300025298 Ga0209050_1000089 Ga0209050_1000089205 454
283 3300025298 Ga0209050_1000470 Ga0209050_100047063 454
284 3300025299 Ga0209256_1000068 Ga0209256_1000068198 454
285 3300025299 Ga0209256_1000112 Ga0209256_100011213 454
286 3300025299 Ga0209256_1001080 Ga0209256_10010809 454
287 3300025299 Ga0209256_1007418 Ga0209256_10074181 454
288 3300025302 Ga0207426_1001589 Ga0207426_10015893 454
289 3300025304 Ga0209257_1000003 Ga0209257_1000003863 454
290 3300027111 Ga0209281_1007318 Ga0209281_10073181 454
291 3300030733 Ga0314311_1258383 Ga0314311_12583831 454
292 3300031548 Ga0307408_100000903 Ga0307408_1000009031 454
293 3300031548 Ga0307408_100022032 Ga0307408_1000220324 454
294 3300046452 Ga0495617_000072 Ga0495617_000072_65104_66495 454
295 3300046453 Ga0495627_000001 Ga0495627_000001_766845_768248 454
296 3300046463 Ga0495653_0000040 Ga0495653_0000040_108416_109807 454
297 3300046471 Ga0495650_0000066 Ga0495650_0000066_40065_41456 454
298 3300046471 Ga0495650_0000490 Ga0495650_0000490_12375_13766 454
299 3300046471 Ga0495650_0000517 Ga0495650_0000517_13326_14717 454
300 3300046474 Ga0495605_0000038 Ga0495605_0000038_93838_95229 454
301 3300046491 Ga0495584_0035290 Ga0495584_0035290_712_2103 454
302 3300046492 Ga0495585_0002199 Ga0495585_0002199_9872_11263 454
303 3300046501 Ga0495607_0010211 Ga0495607_0010211_3036_4427 454
304 3300046507 Ga0495606_0000053 Ga0495606_0000053_102784_104175 454
305 3300046507 Ga0495606_0000202 Ga0495606_0000202_14214_15605 454
306 3300046507 Ga0495606_0076125 Ga0495606_0076125_653_2047 454
307 3300046511 Ga0495608_0026925 Ga0495608_0026925_62_1453 454
308 3300046512 Ga0495610_0000008 Ga0495610_0000008_425188_426579 454
309 3300046512 Ga0495610_0003853 Ga0495610_0003853_1941_3332 454
310 3300046513 Ga0495616_0021191 Ga0495616_0021191_380_1771 454
311 3300046520 Ga0495637_0001097 Ga0495637_0001097_11695_13086 454
312 3300046523 Ga0495644_0010790 Ga0495644_0010790_1361_2764 454
313 3300046524 Ga0495648_0002469 Ga0495648_0002469_11854_13245 454
314 3300046524 Ga0495648_0003036 Ga0495648_0003036_4209_5600 454
315 3300046530 Ga0495654_0000002 Ga0495654_0000002_888304_889695 454
316 3300046538 Ga0495609_0000176 Ga0495609_0000176_38299_39702 454
317 3300046538 Ga0495609_0000177 Ga0495609_0000177_53301_54692 454
318 3300046542 Ga0495597_0000055 Ga0495597_0000055_78928_80319 454
319 3300046558 Ga0495633_0000024 Ga0495633_0000024_12344_13756 454
320 3300046558 Ga0495633_0003312 Ga0495633_0003312_7453_8844 454
321 3300046616 Ga0495668_0001072 Ga0495668_0001072_3636_5027 454
322 3300046616 Ga0495668_0002756 Ga0495668_0002756_12106_13497 454
323 3300046616 Ga0495668_0007812 Ga0495668_0007812_3683_5074 454
324 3300046660 Ga0495625_0000779 Ga0495625_0000779_31042_32433 454
325 3300046660 Ga0495625_0002364 Ga0495625_0002364_4605_5996 454
326 3300046665 Ga0495661_0004752 Ga0495661_0004752_6452_7843 454
327 3300046679 Ga0495623_0045749 Ga0495623_0045749_717_2108 454
328 3300046692 Ga0495671_0000002 Ga0495671_0000002_944319_945710 454
329 3300046810 Ga0495660_0000086 Ga0495660_0000086_89268_90671 454
330 3300046810 Ga0495660_0000489 Ga0495660_0000489_18651_20045 454
331 3300046810 Ga0495660_0006529 Ga0495660_0006529_5429_6832 454
332 3300047323 Ga0495683_0001736 Ga0495683_0001736_3450_4841 454
333 3300047443 Ga0495687_017349 Ga0495687_017349_1360_2751 454
334 3300047469 Ga0495673_0000005 Ga0495673_0000005_786410_787801 454
335 3300047469 Ga0495673_0000067 Ga0495673_0000067_130411_131802 454
336 3300047470 Ga0495681_0026528 Ga0495681_0026528_1177_2568 454
337 3300047472 Ga0495686_0014078 Ga0495686_0014078_4005_5396 454
338 3300047472 Ga0495686_0060960 Ga0495686_0060960_555_1949 454
339 3300048926 Ga0496123_0006319 Ga0496123_0006319_1779_3170 454
340 3300048929 Ga0496126_0011924 Ga0496126_0011924_1168_2559 454
341 3300049459 Ga0495678_000002 Ga0495678_000002_672235_673638 454
342 3300053125 Ga0500618_000857 Ga0500618_000857_13794_15185 454
343 iso_pu_bacteria 2511231003 2511248064 454
344 iso_pu_bacteria 2511231026 2511384882 454
345 iso_pu_bacteria 2521172590 2521558876 454
346 iso_pu_bacteria 2548876994 2550693307 454
347 iso_pu_bacteria 2551306416 2553003672 454
348 iso_pu_bacteria 2643221554 2643792271 454
349 iso_pu_bacteria 2643221638 2644212238 454
350 iso_pu_bacteria 2643221645 2644251090 454
351 iso_pu_bacteria 2643221664 2644354735 454
352 iso_pu_bacteria 2738541280 2738739806 454
353 iso_pu_bacteria 2738541297 2738828034 454
354 iso_pu_bacteria 2738541300 2738842324 454
355 iso_pu_bacteria 2738541357 2739151830 454
356 iso_pu_bacteria 2738543003 2739194149 454
357 iso_pu_bacteria 2738543018 2739274025 454
358 iso_pu_bacteria 2738543026 2739320226 454
359 iso_pu_bacteria 2738543029 2739338866 454
360 iso_pu_bacteria 2738543030 2739343069 454
361 iso_pu_bacteria 2765235838 2765570034 454
362 iso_pu_bacteria 2808606386 2808981677 454
363 iso_pu_bacteria 2808606415 2809131307 454
364 iso_pu_bacteria 2808606419 2809150929 454
365 iso_pu_bacteria 2818991449 2819615403 454
366 iso_pu_bacteria 2821131069 2821132687 454
367 iso_pu_bacteria 2839094727 2839097026 454
368 iso_pu_bacteria 2842711865 2842716445 454
369 iso_pu_bacteria 2852618963 2852622793 454
370 iso_pu_bacteria 2857547612 2857549923 454
371 iso_pu_bacteria 2857553236 2857557373 454
372 iso_pu_bacteria 2857558681 2857560053 454
373 iso_pu_bacteria 2857564685 2857566756 454
374 iso_pu_bacteria 2884811622 2884814812 454
375 iso_pu_bacteria 2884836552 2884840007 454
376 iso_pu_bacteria 2884852848 2884857225 454
377 iso_pu_bacteria 2885080285 2885081202 454
378 iso_pu_bacteria 2896154374 2896157812 454
379 iso_pu_bacteria 2904439833 2904444694 454
380 iso_pu_bacteria 2904530477 2904534658 454
381 iso_pu_bacteria 2904584206 2904584545 454
382 iso_pu_bacteria 2904589729 2904591012 454
383 iso_pu_bacteria 2904601388 2904605365 454
384 iso_pu_bacteria 2919046199 2919047464 454
385 iso_pu_bacteria 2919079590 2919080950 454
386 iso_pu_bacteria 2919476304 2919478017 454
387 iso_pu_bacteria 2928130867 2928132557 454
388 iso_pu_bacteria 2932410948 2932411740 454
389 iso_pu_bacteria 2932416698 2932418693 454
390 3300003544 Ga0007417J51691_1018264 Ga0007417J51691_10182641 455
391 3300003775 Ga0055524_1000152 Ga0055524_100015212 455
392 3300006948 Ga0099826_10000001 Ga0099826_10000001159 455
393 3300014497 Ga0182008_10001162 Ga0182008_1000116210 455
394 3300015261 Ga0182006_1000052 Ga0182006_1000052144 455
395 3300015265 Ga0182005_1000002 Ga0182005_1000002145 455
396 3300017792 Ga0163161_10086892 Ga0163161_100868922 455
397 3300021361 Ga0213872_10000019 Ga0213872_1000001971 455
398 3300021361 Ga0213872_10000264 Ga0213872_1000026414 455
399 3300025250 Ga0209026_1004099 Ga0209026_10040994 455
400 3300025299 Ga0209256_1000007 Ga0209256_1000007984 455
401 3300027666 Ga0209282_1000001 Ga0209282_10000011298 455
402 3300032004 Ga0307414_10010455 Ga0307414_100104552 455
403 3300039447 Ga0436361_0565150 Ga0436361_0565150_67045_68442 455
404 3300046462 Ga0495651_0010041 Ga0495651_0010041_5301_6695 455
405 3300046491 Ga0495584_0000338 Ga0495584_0000338_2883_4280 455
406 3300046506 Ga0495583_0001088 Ga0495583_0001088_27191_28588 455
407 3300046512 Ga0495610_0017089 Ga0495610_0017089_244_1653 455
408 3300046516 Ga0495628_0003181 Ga0495628_0003181_13098_14492 455
409 3300046523 Ga0495644_0001383 Ga0495644_0001383_5727_7124 455
410 3300046538 Ga0495609_0020021 Ga0495609_0020021_195_1592 455
411 3300046557 Ga0495622_0000009 Ga0495622_0000009_11431_12819 455
412 3300046660 Ga0495625_0025805 Ga0495625_0025805_1432_2829 455
413 3300046664 Ga0495659_0000001 Ga0495659_0000001_43398_44795 455
414 3300046664 Ga0495659_0000141 Ga0495659_0000141_16696_18093 455
415 3300046691 Ga0495670_0030404 Ga0495670_0030404_352_1749 455
416 3300046692 Ga0495671_0000445 Ga0495671_0000445_16789_18186 455
417 3300047318 Ga0495636_0000523 Ga0495636_0000523_9230_10627 455
418 3300047320 Ga0495672_0000219 Ga0495672_0000219_49854_51251 455
419 3300047320 Ga0495672_0026170 Ga0495672_0026170_2074_3471 455
420 3300047320 Ga0495672_0046541 Ga0495672_0046541_716_2113 455
421 3300047323 Ga0495683_0002953 Ga0495683_0002953_26_1423 455
422 3300047443 Ga0495687_000191 Ga0495687_000191_32037_33434 455
423 3300047447 Ga0495685_000033 Ga0495685_000033_20588_21985 455
424 3300048088 Ga0495602_0037073 Ga0495602_0037073_2727_4121 455
425 3300048920 Ga0496117_0000001 Ga0496117_0000001_1026622_1028034 455
426 3300048921 Ga0496118_0000002 Ga0496118_0000002_1026622_1028034 455
427 3300048924 Ga0496121_0003561 Ga0496121_0003561_4685_6097 455
428 3300048926 Ga0496123_0006703 Ga0496123_0006703_423_1835 455
429 3300049460 Ga0495682_0000761 Ga0495682_0000761_17792_19189 455
430 3300049679 Ga0501249_009907 Ga0501249_009907_249_1658 455
431 3300049766 Ga0501269_000270 Ga0501269_000270_11224_12633 455
432 3300053125 Ga0500618_008681 Ga0500618_008681_461_1837 455
433 iso_pu_bacteria 2904424332 2904426756 455
434 3300031507 Ga0307509_10180080 Ga0307509_101800802 456
435 3300031711 Ga0265314_10015022 Ga0265314_100150222 456
436 3300046471 Ga0495650_0000044 Ga0495650_0000044_96890_98293 456
437 3300046501 Ga0495607_0042409 Ga0495607_0042409_1266_2675 456
438 3300046507 Ga0495606_0000087 Ga0495606_0000087_114497_115945 456
439 3300046507 Ga0495606_0003994 Ga0495606_0003994_2707_4110 456
440 3300046557 Ga0495622_0039785 Ga0495622_0039785_165_1574 456
441 3300046678 Ga0495599_0007071 Ga0495599_0007071_4248_5651 456
442 3300046809 Ga0495600_0004091 Ga0495600_0004091_2160_3563 456
443 3300047317 Ga0495604_0066630 Ga0495604_0066630_1128_2531 456
444 3300047318 Ga0495636_0003256 Ga0495636_0003256_2251_3660 456
445 3300047472 Ga0495686_0000231 Ga0495686_0000231_25754_27160 456
446 3300047472 Ga0495686_0006302 Ga0495686_0006302_1866_3284 456
447 3300053077 Ga0495601_0008364 Ga0495601_0008364_2936_4339 456
448 3300002737 JGI25162J39368_1000015 JGI25162J39368_1000015133 457
449 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001812 457
450 3300003751 Ga0055538_1000001 Ga0055538_1000001221 457
451 3300003752 Ga0055539_1000001 Ga0055539_1000001221 457
452 3300003756 Ga0055533_1000003 Ga0055533_1000003812 457
453 3300003759 Ga0055525_1000003 Ga0055525_1000003812 457
454 3300003841 Ga0055541_1000001 Ga0055541_1000001812 457
455 3300014497 Ga0182008_10056179 Ga0182008_100561792 457
456 3300015261 Ga0182006_1013848 Ga0182006_10138483 457
457 3300015265 Ga0182005_1004259 Ga0182005_10042592 457
458 3300025224 Ga0209784_100004 Ga0209784_100004806 457
459 3300025225 Ga0209566_100004 Ga0209566_100004963 457
460 3300025226 Ga0209674_100006 Ga0209674_100006963 457
461 3300025228 Ga0209672_103565 Ga0209672_1035653 457
462 3300025230 Ga0209563_100009 Ga0209563_100009806 457
463 3300025231 Ga0207427_100238 Ga0207427_10023845 457
464 3300025233 Ga0209437_100004 Ga0209437_100004806 457
465 3300025253 Ga0209677_100005 Ga0209677_100005806 457
466 3300025261 Ga0209233_1000005 Ga0209233_1000005963 457
467 3300037312 Ga0395899_0001610 Ga0395899_0001610_10114_11529 457
468 3300037418 Ga0395900_0043594 Ga0395900_0043594_810_2225 457
469 3300046500 Ga0495596_0002938 Ga0495596_0002938_6062_7480 457
470 3300046506 Ga0495583_0000117 Ga0495583_0000117_15884_17296 457
471 3300046517 Ga0495630_0034675 Ga0495630_0034675_2284_3738 457
472 3300046529 Ga0495652_0021718 Ga0495652_0021718_232_1614 457
473 3300046543 Ga0495645_0017184 Ga0495645_0017184_2577_3959 457
474 3300046680 Ga0495646_0009535 Ga0495646_0009535_1647_3029 457
475 3300048928 Ga0496125_0009347 Ga0496125_0009347_8372_9808 457
476 3300053125 Ga0500618_002590 Ga0500618_002590_490_1866 457
477 3300002705 JGI25156J39149_1000892 JGI25156J39149_10008924 458
478 3300002738 JGI25154J39366_1000326 JGI25154J39366_100032610 458
479 3300002738 JGI25154J39366_1000411 JGI25154J39366_10004114 458
480 3300002741 JGI25157J39369_1000382 JGI25157J39369_100038224 458
481 3300003758 Ga0055532_1000050 Ga0055532_100005024 458
482 3300009093 Ga0105240_10003428 Ga0105240_1000342824 458
483 3300009093 Ga0105240_10021627 Ga0105240_100216278 458
484 3300015261 Ga0182006_1021851 Ga0182006_10218513 458
485 3300025206 Ga0209435_100029 Ga0209435_100029152 458
486 3300025229 Ga0209147_100004 Ga0209147_100004543 458
487 3300025233 Ga0209437_100053 Ga0209437_10005327 458
488 3300025242 Ga0209258_100720 Ga0209258_10072024 458
489 3300025246 Ga0209646_1000073 Ga0209646_1000073185 458
490 3300025246 Ga0209646_1000109 Ga0209646_100010990 458
491 3300025250 Ga0209026_1000467 Ga0209026_100046725 458
492 3300025250 Ga0209026_1004249 Ga0209026_10042494 458
493 3300025256 Ga0209759_1000064 Ga0209759_1000064174 458
494 3300025256 Ga0209759_1000698 Ga0209759_100069822 458
495 3300025913 Ga0207695_10007561 Ga0207695_100075616 458
496 3300025913 Ga0207695_10059896 Ga0207695_100598961 458
497 3300025949 Ga0207667_10085215 Ga0207667_100852153 458
498 3300046660 Ga0495625_0005633 Ga0495625_0005633_4939_6315 458
499 3300048905 Ga0496102_0000101 Ga0496102_0000101_47184_48605 458
500 3300048924 Ga0496121_0014532 Ga0496121_0014532_4015_5391 458
501 3300048925 Ga0496122_0001831 Ga0496122_0001831_12165_13541 458
502 3300048926 Ga0496123_0002340 Ga0496123_0002340_18862_20238 458
503 3300048928 Ga0496125_0002187 Ga0496125_0002187_18876_20252 458

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18693

TRAM_2

TRAM domain

428

493

0.95

PF04055

Radical_SAM

Radical SAM superfamily

190

372

0.94

PF00919

UPF0004

Uncharacterized protein family UPF0004

51

149

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qgq-assembly4.cif.gz_D crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9452 150 458
2qgq-assembly1.cif.gz_A crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9401 150 458
2qgq-assembly4.cif.gz_D crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9316 150 458
2qgq-assembly1.cif.gz_A crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9235 150 458
8b47-assembly1.cif.gz_B-2 crystal structure of nad kinase 1 from listeria monocytogenes in complex with a cyclic di-adenosine derivative 0.7244 14 85
ID Description Score Start End Superfamily
af_P0AEI4_138_379_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.9762 147 392 3.80.30.20
af_P0AEI4_138_379_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.9723 147 392 3.80.30.20
4jc0B03 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.965 272 384 3.30.750.200
af_P0AEI4_9_125_3.40.50.12160 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylthiotransferase, N-terminal domain 0.9512 15 134 3.40.50.12160
2qgqA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9419 393 458 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A5C7SML8-F1-model_v4 Radical SAM protein 0.9714 260 458 GO:0005829
GO:0035599
GO:0046872
GO:0051539
AF-A0A529X549-F1-model_v4 deleted 0.9703 206 394
AF-A0A527ZP11-F1-model_v4 Radical SAM protein 0.9696 233 458 GO:0005829
GO:0035599
GO:0046872
GO:0051539
AF-A0A357Z0K4-F1-model_v4 30S ribosomal protein S12 methylthiotransferase RimO 0.9663 309 458 GO:0005829
GO:0005840
GO:0035599
GO:0046872
GO:0051539
AF-A0A527ZP11-F1-model_v4 Radical SAM protein 0.9652 233 458 GO:0005829
GO:0035599
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
86.21 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map