F455941

General Info

Members Datasets Scaffolds Average Seq Length
502 296 996 171

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221648|2644272720
Length 196
Sequence EAARASAATQSGGEFLTFRLGAEEYGIDILKVQEIRSYEAPTRIANAPAFIKGVVNLRGVIVPIVDLRLKLGCDSNDYNSFTVVIVLNVRGRVVGAVVDSVSDVLELSRXSIKPAPEMASAVDTSFITGISSVNDRMLILMDIEELMASXPAPEMASAVDTSFITGISSVNDRMLILMDIEELMASSEMGLIDSTH

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
143 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
144 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
162 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
163 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
164 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
165 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
166 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
167 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
168 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
169 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
170 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
171 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
172 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
175 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
176 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
177 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
201 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
209 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
215 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
216 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
217 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
218 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
219 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
236 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
237 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
242 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
243 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
244 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
245 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
249 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
253 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
254 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
255 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
256 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
257 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
258 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
259 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
260 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
261 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
262 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
263 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
264 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
265 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
266 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
267 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
268 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
269 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
270 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
271 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
272 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
275 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
276 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
277 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
278 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
279 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
281 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
282 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
283 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
284 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
285 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
286 2643221570 Acidovorax sp. Root568 Isolate Unclassified
287 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
288 2643221596 Acidovorax sp. Root70 Isolate Unclassified
289 2643221609 Acidovorax sp. Root217 Isolate Unclassified
290 2643221611 Acidovorax sp. Root219 Isolate Unclassified
291 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
292 2643221652 Acidovorax sp. Root402 Isolate Unclassified
293 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
294 2738543012 Acidovorax sp. CF301 Isolate Unclassified
295 2816332133 Acidovorax radicis 2721A Isolate Unclassified
296 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.22
Metatranscriptomes 2.19
Isolates 3.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.7
Nodule 0
Rhizoplane 3.19
Rhizosphere 59.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10029836 3300001979 Bacteria 1785
2 JGI25156J39149_1032708 3300002705 Bacteria 765
3 JGI25150J39212_1024168 3300002774 Bacteria 896
4 JGI25150J39212_1025157 3300002774 Bacteria 871
5 JGI25153J46596_10010034 3300003215 Bacteria 4322
6 JGI25153J46596_10034570 3300003215 Bacteria 1650
7 Ga0006777J48905_1136568 3300003308 Bacteria 728
8 rootH1_10006580 3300003316 Bacteria 1999
9 rootH1_10003606 3300003323 Bacteria 1759
10 rootH1_10127879 3300003323 Bacteria 1946
11 Ga0055539_1000264 3300003752 Bacteria 32501
12 Ga0055533_1000053 3300003756 Bacteria 199478
13 Ga0055525_1001618 3300003759 Bacteria 3543
14 Ga0055535_1000418 3300003761 Bacteria 40100
15 Ga0055529_1000431 3300003763 Bacteria 42425
16 Ga0055528_1053285 3300003790 Bacteria 803
17 Ga0055530_10034074 3300003791 Bacteria 1305
18 Ga0055540_1000080 3300003792 Bacteria 111063
19 Ga0055531_10005699 3300003794 Bacteria 7224
20 Ga0070658_10279612 3300005327 Bacteria 1420
21 Ga0070676_10000378 3300005328 Bacteria 20674
22 Ga0070676_10003760 3300005328 Bacteria 7957
23 Ga0070676_10559639 3300005328 Bacteria 820
24 Ga0070670_100014365 3300005331 Bacteria 6794
25 Ga0070670_100146401 3300005331 Bacteria 2044
26 Ga0068869_100014819 3300005334 Bacteria 5214
27 Ga0068869_100095509 3300005334 Bacteria 2243
28 Ga0070666_10140839 3300005335 Bacteria 1680
29 Ga0068868_100004021 3300005338 Bacteria 10266
30 Ga0068868_100008984 3300005338 Bacteria 7172
31 Ga0068868_100385585 3300005338 Bacteria 1206
32 Ga0070661_100002124 3300005344 Bacteria 13661
33 Ga0070661_100499854 3300005344 Bacteria 973
34 Ga0070669_100204341 3300005353 Bacteria 1556
35 Ga0070675_100002710 3300005354 Bacteria 13318
36 Ga0070675_100012400 3300005354 Bacteria 6679
37 Ga0070671_100159911 3300005355 Bacteria 1904
38 Ga0070671_100177947 3300005355 Bacteria 1800
39 Ga0070671_100198160 3300005355 Bacteria 1702
40 Ga0070673_100009227 3300005364 Bacteria 6616
41 Ga0070659_100215890 3300005366 Bacteria 1582
42 Ga0070667_100080937 3300005367 Bacteria 2779
43 Ga0070667_100110330 3300005367 Bacteria 2385
44 Ga0070667_100304005 3300005367 Bacteria 1437
45 Ga0070708_100056879 3300005445 Bacteria 3480
46 Ga0070663_100010121 3300005455 Bacteria 5868
47 Ga0070678_100655725 3300005456 Bacteria 942
48 Ga0070678_101010113 3300005456 Bacteria 765
49 Ga0070662_100071267 3300005457 Bacteria 2562
50 Ga0070662_100202291 3300005457 Bacteria 1577
51 Ga0070662_100286599 3300005457 Bacteria 1334
52 Ga0070662_100407644 3300005457 Bacteria 1123
53 Ga0068867_100007928 3300005459 Bacteria 7501
54 Ga0068867_100092603 3300005459 Bacteria 2296
55 Ga0068867_100554865 3300005459 Bacteria 996
56 Ga0070706_100135004 3300005467 Bacteria 2303
57 Ga0070707_100224226 3300005468 Bacteria 1830
58 Ga0070707_100676374 3300005468 Bacteria 995
59 Ga0070698_100070339 3300005471 Bacteria 3511
60 Ga0070699_100386745 3300005518 Bacteria 1264
61 Ga0068853_100172537 3300005539 Bacteria 1957
62 Ga0068853_100195391 3300005539 Bacteria 1840
63 Ga0070672_100010006 3300005543 Bacteria 6562
64 Ga0070672_100114174 3300005543 Bacteria 2205
65 Ga0068855_100258764 3300005563 Bacteria 1939
66 Ga0070664_100004314 3300005564 Bacteria 11432
67 Ga0070664_100042024 3300005564 Bacteria 3860
68 Ga0068857_100036748 3300005577 Bacteria 4339
69 Ga0068857_100142268 3300005577 Bacteria 2169
70 Ga0068852_100456760 3300005616 Bacteria 1265
71 Ga0068852_100527345 3300005616 Bacteria 1179
72 Ga0068852_100650961 3300005616 Bacteria 1061
73 Ga0068859_102046446 3300005617 Bacteria 632
74 Ga0068864_100355983 3300005618 Bacteria 1382
75 Ga0068861_101499646 3300005719 Bacteria 662
76 Ga0068870_10013175 3300005840 Bacteria 3881
77 Ga0068860_101151282 3300005843 Bacteria 796
78 Ga0075368_10143806 3300006042 Bacteria 995
79 Ga0075368_10237597 3300006042 Bacteria 777
80 Ga0075363_100034160 3300006048 Bacteria 2653
81 Ga0075363_100034216 3300006048 Bacteria 2651
82 Ga0075363_100079803 3300006048 Bacteria 1788
83 Ga0075362_10053467 3300006177 Bacteria 1812
84 Ga0075362_10085120 3300006177 Bacteria 1461
85 Ga0075362_10094177 3300006177 Bacteria 1393
86 Ga0075367_10021681 3300006178 Bacteria 3594
87 Ga0075367_10038345 3300006178 Bacteria 2789
88 Ga0075367_10051780 3300006178 Bacteria 2428
89 Ga0075367_10111976 3300006178 Bacteria 1676
90 Ga0075367_10178353 3300006178 Bacteria 1324
91 Ga0075367_10197847 3300006178 Bacteria 1255
92 Ga0075369_10021916 3300006186 Bacteria 2631
93 Ga0075369_10034294 3300006186 Bacteria 2153
94 Ga0075369_10196780 3300006186 Bacteria 930
95 Ga0075366_10021714 3300006195 Bacteria 3732
96 Ga0075366_10106987 3300006195 Bacteria 1682
97 Ga0075366_10170008 3300006195 Bacteria 1322
98 Ga0075366_10670020 3300006195 Bacteria 644
99 Ga0075370_10055960 3300006353 Bacteria 2241
100 Ga0075370_10177119 3300006353 Bacteria 1254
101 Ga0075370_10188146 3300006353 Bacteria 1216
102 Ga0075370_10214723 3300006353 Bacteria 1136
103 Ga0075370_10405211 3300006353 Bacteria 818
104 Ga0075370_10407462 3300006353 Bacteria 816
105 Ga0068871_100164044 3300006358 Bacteria 1901
106 Ga0075434_100384541 3300006871 Bacteria 1424
107 Ga0068865_100068753 3300006881 Bacteria 2505
108 Ga0068865_100927001 3300006881 Bacteria 759
109 Ga0097620_102046318 3300006931 Bacteria 632
110 Ga0105240_10262156 3300009093 Bacteria 1993
111 Ga0105245_10026597 3300009098 Bacteria 5094
112 Ga0105245_10159759 3300009098 Bacteria 2137
113 Ga0105245_10221062 3300009098 Bacteria 1827
114 Ga0105243_10023493 3300009148 Bacteria 4695
115 Ga0105242_11323160 3300009176 Bacteria 745
116 Ga0105237_10143228 3300009545 Bacteria 2385
117 Ga0105238_10351156 3300009551 Bacteria 1464
118 Ga0105249_10239670 3300009553 Bacteria 1792
119 Ga0105239_10166190 3300010375 Bacteria 2467
120 Ga0105239_10287121 3300010375 Bacteria 1853
121 Ga0105239_10907074 3300010375 Bacteria 1012
122 Ga0105246_10020214 3300011119 Bacteria 4269
123 Ga0105246_10023767 3300011119 Bacteria 3970
124 Ga0105246_10082628 3300011119 Bacteria 2293
125 Ga0105246_10608260 3300011119 Bacteria 945
126 Ga0157322_1009618 3300012490 Bacteria 764
127 Ga0157374_10033743 3300013296 Bacteria 4671
128 Ga0157378_10682171 3300013297 Bacteria 1045
129 Ga0157375_10045969 3300013308 Bacteria 4253
130 Ga0157375_10402929 3300013308 Bacteria 1535
131 Ga0157380_10095541 3300014326 Bacteria 2462
132 Ga0157380_11074792 3300014326 Bacteria 842
133 Ga0182005_1222491 3300015265 Bacteria 575
134 Ga0213872_10065579 3300021361 Bacteria 1639
135 Ga0209674_100039 3300025226 Bacteria 402292
136 Ga0209563_100080 3300025230 Bacteria 199504
137 Ga0209258_100072 3300025242 Bacteria 274355
138 Ga0209677_100130 3300025253 Bacteria 72879
139 Ga0209677_103773 3300025253 Bacteria 4714
140 Ga0209148_1016976 3300025254 Bacteria 1244
141 Ga0209759_1001150 3300025256 Bacteria 16834
142 Ga0209455_1000053 3300025272 Bacteria 365949
143 Ga0209673_1009832 3300025273 Bacteria 4096
144 Ga0209673_1023131 3300025273 Bacteria 2125
145 Ga0209675_1035457 3300025291 Bacteria 1137
146 Ga0209564_1000014 3300025295 Bacteria 621501
147 Ga0209050_1002321 3300025298 Bacteria 16737
148 Ga0209256_1022638 3300025299 Bacteria 1896
149 Ga0209051_1000035 3300025303 Bacteria 346999
150 Ga0209051_1029243 3300025303 Bacteria 2160
151 Ga0209257_1000346 3300025304 Bacteria 95662
152 Ga0209257_1028066 3300025304 Bacteria 1859
153 Ga0209257_1050456 3300025304 Bacteria 1178
154 Ga0207682_10228538 3300025893 Bacteria 862
155 Ga0207680_10037182 3300025903 Bacteria 2809
156 Ga0207645_10001114 3300025907 Bacteria 22215
157 Ga0207645_10033411 3300025907 Bacteria 3306
158 Ga0207645_10037765 3300025907 Bacteria 3099
159 Ga0207643_10162115 3300025908 Bacteria 1345
160 Ga0207643_10271660 3300025908 Bacteria 1049
161 Ga0207705_10389915 3300025909 Bacteria 1076
162 Ga0207684_10002973 3300025910 Bacteria 16792
163 Ga0207684_10256987 3300025910 Bacteria 1507
164 Ga0207695_10681379 3300025913 Bacteria 909
165 Ga0207671_10081986 3300025914 Bacteria 2420
166 Ga0207649_10001856 3300025920 Bacteria 12074
167 Ga0207646_10227406 3300025922 Bacteria 1685
168 Ga0207681_10252954 3300025923 Bacteria 1376
169 Ga0207694_10364752 3300025924 Bacteria 1197
170 Ga0207650_10148454 3300025925 Bacteria 1848
171 Ga0207650_10421994 3300025925 Bacteria 1107
172 Ga0207659_10008230 3300025926 Bacteria 6463
173 Ga0207659_10077727 3300025926 Bacteria 2444
174 Ga0207687_10090733 3300025927 Bacteria 2227
175 Ga0207687_10159103 3300025927 Bacteria 1731
176 Ga0207644_10125302 3300025931 Bacteria 1960
177 Ga0207644_10653077 3300025931 Bacteria 876
178 Ga0207690_10004109 3300025932 Bacteria 8597
179 Ga0207690_10113861 3300025932 Bacteria 1952
180 Ga0207706_10106217 3300025933 Bacteria 2470
181 Ga0207706_10285711 3300025933 Bacteria 1438
182 Ga0207709_10042070 3300025935 Bacteria 2746
183 Ga0207669_10033009 3300025937 Bacteria 2915
184 Ga0207669_10586655 3300025937 Bacteria 904
185 Ga0207704_10107305 3300025938 Bacteria 1878
186 Ga0207704_10118983 3300025938 Bacteria 1803
187 Ga0207691_10003141 3300025940 Bacteria 16144
188 Ga0207691_10065264 3300025940 Bacteria 3296
189 Ga0207689_10021076 3300025942 Bacteria 5478
190 Ga0207689_10027812 3300025942 Bacteria 4732
191 Ga0207679_10000254 3300025945 Bacteria 40785
192 Ga0207679_10162020 3300025945 Bacteria 1832
193 Ga0207667_10231197 3300025949 Bacteria 1893
194 Ga0207668_11176112 3300025972 Bacteria 689
195 Ga0207658_10046896 3300025986 Bacteria 3159
196 Ga0207658_10059861 3300025986 Bacteria 2839
197 Ga0207677_10030880 3300026023 Bacteria 3426
198 Ga0207677_10229847 3300026023 Bacteria 1493
199 Ga0207677_10633841 3300026023 Bacteria 942
200 Ga0207639_10169371 3300026041 Bacteria 1848
201 Ga0207678_10037577 3300026067 Bacteria 4211
202 Ga0207678_10186442 3300026067 Bacteria 1772
203 Ga0207678_10239081 3300026067 Bacteria 1555
204 Ga0207641_10615146 3300026088 Bacteria 1065
205 Ga0207648_10008558 3300026089 Bacteria 9898
206 Ga0207648_10056678 3300026089 Bacteria 3419
207 Ga0207648_10111666 3300026089 Bacteria 2400
208 Ga0207676_10611634 3300026095 Bacteria 1048
209 Ga0207674_10009995 3300026116 Bacteria 10799
210 Ga0207674_10017199 3300026116 Bacteria 7890
211 Ga0207674_10266820 3300026116 Bacteria 1659
212 Ga0207674_10510930 3300026116 Bacteria 1161
213 Ga0207675_100928713 3300026118 Bacteria 887
214 Ga0207683_10367426 3300026121 Bacteria 1321
215 Ga0207698_10456239 3300026142 Bacteria 1235
216 Ga0207698_10589865 3300026142 Bacteria 1094
217 Ga0207698_11017997 3300026142 Bacteria 839
218 Ga0209973_1042044 3300027252 Bacteria 672
219 Ga0209984_1012228 3300027424 Bacteria 1118
220 Ga0209995_1038438 3300027471 Bacteria 806
221 Ga0209982_1025400 3300027552 Bacteria 921
222 Ga0209971_1003584 3300027682 Bacteria 3673
223 Ga0209998_10023216 3300027717 Bacteria 1340
224 Ga0209813_10067809 3300027866 Bacteria 1154
225 Ga0209813_10134086 3300027866 Bacteria 874
226 Ga0209813_10208468 3300027866 Bacteria 727
227 Ga0209813_10223972 3300027866 Bacteria 705
228 Ga0209974_10000798 3300027876 Bacteria 10761
229 Ga0209974_10059280 3300027876 Bacteria 1294
230 Ga0268266_10430531 3300028379 Bacteria 1252
231 Ga0268264_10063287 3300028381 Bacteria 3109
232 Ga0265334_10089494 3300028573 Bacteria 1125
233 Ga0265336_10000014 3300028666 Bacteria 241247
234 Ga0307517_10001591 3300028786 Bacteria 37812
235 Ga0307517_10129642 3300028786 Bacteria 1822
236 Ga0307517_10138754 3300028786 Bacteria 1716
237 Ga0307517_10361100 3300028786 Bacteria 784
238 Ga0307515_10000030 3300028794 Bacteria 364482
239 Ga0307515_10000232 3300028794 Bacteria 137778
240 Ga0307515_10010735 3300028794 Bacteria 17494
241 Ga0307515_10011997 3300028794 Bacteria 16364
242 Ga0307515_10029263 3300028794 Bacteria 9320
243 Ga0307515_10190511 3300028794 Bacteria 1962
244 Ga0307515_10256141 3300028794 Bacteria 1494
245 Ga0265324_10002886 3300029957 Bacteria 8443
246 Ga0307511_10062371 3300030521 Bacteria 2830
247 Ga0307512_10186241 3300030522 Bacteria 1155
248 Ga0307512_10301212 3300030522 Bacteria 746
249 Ga0307513_10021343 3300031456 Bacteria 7647
250 Ga0307513_10086072 3300031456 Bacteria 3224
251 Ga0307513_10116418 3300031456 Bacteria 2652
252 Ga0307513_10307283 3300031456 Bacteria 1349
253 Ga0307513_10377032 3300031456 Bacteria 1159
254 Ga0307513_10417951 3300031456 Bacteria 1071
255 Ga0307509_10062124 3300031507 Bacteria 3940
256 Ga0307408_100000096 3300031548 Bacteria 97068
257 Ga0307408_100000274 3300031548 Bacteria 51724
258 Ga0307408_100393514 3300031548 Bacteria 1188
259 Ga0307508_10010139 3300031616 Bacteria 8625
260 Ga0307508_10014137 3300031616 Bacteria 7283
261 Ga0307508_10155545 3300031616 Bacteria 1890
262 Ga0307508_10295523 3300031616 Bacteria 1213
263 Ga0307514_10017566 3300031649 Bacteria 5882
264 Ga0307514_10034928 3300031649 Bacteria 4005
265 Ga0307514_10068434 3300031649 Bacteria 2676
266 Ga0307516_10002371 3300031730 Bacteria 25253
267 Ga0307516_10048399 3300031730 Bacteria 4183
268 Ga0307516_10052113 3300031730 Bacteria 4008
269 Ga0307516_10058407 3300031730 Bacteria 3755
270 Ga0307516_10212887 3300031730 Bacteria 1646
271 Ga0307406_10000285 3300031901 Bacteria 29634
272 Ga0307406_10000669 3300031901 Bacteria 19388
273 Ga0307507_10064390 3300033179 Bacteria 3384
274 Ga0307507_10084566 3300033179 Bacteria 2764
275 Ga0307507_10441570 3300033179 Bacteria 722
276 Ga0307510_10002010 3300033180 Bacteria 22941
277 Ga0373948_0146551 3300034817 Bacteria 587
278 Ga0373923_0390971 3300035111 Bacteria 668
279 Ga0373931_0058430 3300035691 Bacteria 2071
280 Ga0373937_0955989 3300036401 Bacteria 805
281 Ga0395900_0000355 3300037418 Bacteria 66598
282 Ga0395905_0009834 3300037471 Bacteria 9322
283 Ga0395905_0099172 3300037471 Bacteria 2736
284 Ga0395905_0117971 3300037471 Bacteria 2494
285 Ga0395905_0143686 3300037471 Bacteria 2245
286 Ga0436361_0246290 3300039447 Bacteria 5134
287 Ga0436361_0446923 3300039447 Bacteria 4011
288 Ga0451787_611721 3300041441 Bacteria 935
289 Ga0451789_0930105 3300041443 Bacteria 884
290 Ga0451789_1015101 3300041443 Bacteria 909
291 Ga0451791_0603808 3300041451 Bacteria 1220
292 Ga0451791_1408766 3300041451 Bacteria 666
293 Ga0451793_0236477 3300041452 Bacteria 1598
294 Ga0451793_0796079 3300041452 Bacteria 1119
295 Ga0451795_1550623 3300041456 Bacteria 2915
296 Ga0451798_0294272 3300041458 Bacteria 1046
297 Ga0451804_0147376 3300041463 Bacteria 1169
298 Ga0451807_0698218 3300041486 Bacteria 1289
299 Ga0451833_0566945 3300041491 Bacteria 1549
300 Ga0451839_1129181 3300041496 Bacteria 955
301 Ga0451843_0158826 3300041509 Bacteria 1379
302 Ga0451855_0264997 3300041511 Bacteria 1070
303 Ga0451853_0955568 3300041512 Bacteria 2327
304 Ga0439462_0008298 3300042015 Bacteria 2615
305 Ga0450919_000053 3300042121 Bacteria 10268
306 Ga0450923_008919 3300042125 Bacteria 1741
307 Ga0450918_008216 3300042531 Bacteria 1836
308 Ga0451577_0180188 3300042876 Bacteria 1905
309 Ga0451577_0249832 3300042876 Bacteria 1605
310 Ga0451577_0272707 3300042876 Bacteria 1532
311 Ga0451577_0372751 3300042876 Bacteria 1295
312 Ga0466969_0000028 3300044656 Bacteria 92394
313 Ga0466969_0025988 3300044656 Bacteria 3005
314 Ga0466969_0051314 3300044656 Bacteria 2030
315 Ga0466972_0005554 3300044658 Bacteria 6316
316 Ga0466965_0000486 3300044683 Bacteria 14114
317 Ga0466965_0010206 3300044683 Bacteria 4374
318 Ga0466966_0002639 3300044684 Bacteria 11740
319 Ga0466966_0033518 3300044684 Bacteria 3325
320 Ga0466961_0004039 3300044693 Bacteria 9196
321 Ga0466961_0175976 3300044693 Bacteria 1329
322 Ga0466963_0634170 3300044694 Bacteria 754
323 Ga0466964_0024633 3300044706 Bacteria 2345
324 Ga0466964_0026690 3300044706 Bacteria 2262
325 Ga0453684_0218310 3300044712 Bacteria 2210
326 Ga0466971_0012528 3300044719 Bacteria 3718
327 Ga0466971_0160114 3300044719 Bacteria 1053
328 Ga0466970_0009077 3300044765 Bacteria 5017
329 Ga0466970_0019016 3300044765 Bacteria 3559
330 Ga0466970_0040100 3300044765 Bacteria 2486
331 Ga0466957_0001863 3300044842 Bacteria 11149
332 Ga0466957_0066637 3300044842 Bacteria 2220
333 Ga0466959_0010874 3300045049 Bacteria 6523
334 Ga0466959_0047217 3300045049 Bacteria 3167
335 Ga0466959_0101295 3300045049 Bacteria 2061
336 Ga0466958_0017076 3300045836 Bacteria 4189
337 Ga0466958_0048251 3300045836 Bacteria 2572
338 Ga0466967_0764449 3300045976 Bacteria 958
339 Ga0466967_0925237 3300045976 Bacteria 867
340 Ga0495590_0001167 3300046457 Bacteria 11515
341 Ga0495590_0022666 3300046457 Bacteria 2220
342 Ga0495590_0124094 3300046457 Bacteria 926
343 Ga0495638_0314090 3300046460 Bacteria 840
344 Ga0495650_0018863 3300046471 Bacteria 3416
345 Ga0495605_0365091 3300046474 Bacteria 604
346 Ga0495639_0009882 3300046475 Bacteria 4097
347 Ga0495583_0000350 3300046506 Bacteria 72716
348 Ga0495583_0062508 3300046506 Bacteria 1658
349 Ga0495606_0004217 3300046507 Bacteria 14547
350 Ga0495610_0052171 3300046512 Bacteria 1986
351 Ga0495631_0095493 3300046518 Bacteria 1280
352 Ga0495632_0004253 3300046519 Bacteria 9780
353 Ga0495632_0023893 3300046519 Bacteria 3257
354 Ga0495632_0033213 3300046519 Bacteria 2651
355 Ga0495643_0018195 3300046522 Bacteria 4090
356 Ga0495643_0126649 3300046522 Bacteria 1285
357 Ga0495643_0282440 3300046522 Bacteria 763
358 Ga0495648_0206897 3300046524 Bacteria 978
359 Ga0495648_0302379 3300046524 Bacteria 749
360 Ga0495666_0036931 3300046526 Bacteria 2378
361 Ga0495642_0182433 3300046528 Bacteria 914
362 Ga0495652_0401252 3300046529 Bacteria 971
363 Ga0495597_0012435 3300046542 Bacteria 4107
364 Ga0495597_0037442 3300046542 Bacteria 2178
365 Ga0495633_0311458 3300046558 Bacteria 715
366 Ga0495668_0049571 3300046616 Bacteria 2329
367 Ga0495668_0074138 3300046616 Bacteria 1869
368 Ga0495668_0116809 3300046616 Bacteria 1459
369 Ga0495668_0400625 3300046616 Bacteria 754
370 Ga0495611_0056402 3300046648 Bacteria 1779
371 Ga0495611_0377666 3300046648 Bacteria 649
372 Ga0495625_0002284 3300046660 Bacteria 21038
373 Ga0495625_0005026 3300046660 Bacteria 12271
374 Ga0495625_0121969 3300046660 Bacteria 1773
375 Ga0495625_0123397 3300046660 Bacteria 1760
376 Ga0495669_0076531 3300046684 Bacteria 1532
377 Ga0495671_0139349 3300046692 Bacteria 1182
378 Ga0495649_0004041 3300046694 Bacteria 9660
379 Ga0495649_0016534 3300046694 Bacteria 4180
380 Ga0495660_0108245 3300046810 Bacteria 1421
381 Ga0495683_0100030 3300047323 Bacteria 1395
382 Ga0495687_000914 3300047443 Bacteria 30754
383 Ga0495687_001014 3300047443 Bacteria 28020
384 Ga0495687_003096 3300047443 Bacteria 12448
385 Ga0495679_158815 3300047446 Bacteria 605
386 Ga0495686_0001681 3300047472 Bacteria 22995
387 Ga0495686_0170616 3300047472 Bacteria 1265
388 Ga0495686_0176424 3300047472 Bacteria 1240
389 Ga0495626_0088987 3300048091 Bacteria 1360
390 Ga0495626_0142598 3300048091 Bacteria 1015
391 Ga0495626_0332140 3300048091 Bacteria 596
392 Ga0496102_0004306 3300048905 Bacteria 12033
393 Ga0496106_0647816 3300048909 Bacteria 844
394 Ga0496113_0373614 3300048916 Bacteria 1144
395 Ga0496114_0004709 3300048917 Bacteria 10616
396 Ga0496115_0302964 3300048918 Bacteria 1309
397 Ga0496121_0007977 3300048924 Bacteria 12643
398 Ga0496121_0179958 3300048924 Bacteria 1527
399 Ga0496124_0001253 3300048927 Bacteria 38792
400 Ga0496125_0169282 3300048928 Bacteria 1471
401 Ga0501306_012102 3300049127 Bacteria 1108
402 Ga0501306_033618 3300049127 Bacteria 772
403 Ga0501308_023436 3300049128 Bacteria 787
404 Ga0501309_011943 3300049129 Bacteria 1138
405 Ga0501305_022459 3300049161 Bacteria 939
406 Ga0501307_018847 3300049162 Bacteria 881
407 Ga0495678_098339 3300049459 Bacteria 1018
408 Ga0495682_0088908 3300049460 Bacteria 1110
409 Ga0495682_0253596 3300049460 Bacteria 622
410 Ga0501312_038364 3300049528 Bacteria 775
411 Ga0501322_013051 3300049538 Bacteria 667
412 Ga0501323_004124 3300049539 Bacteria 1520
413 Ga0501325_023943 3300049541 Bacteria 662
414 Ga0501219_008291 3300049703 Bacteria 759
415 Ga0501265_019021 3300049762 Bacteria 913
416 Ga0501265_028412 3300049762 Bacteria 794
417 Ga0501226_018234 3300049853 Bacteria 773
418 nmdc:mga03683_177286_c1 3300050489 Bacteria 971
419 nmdc:mga03683_413962_c1 3300050489 Bacteria 645
420 nmdc:mga03n38_732406_c1 3300050490 Bacteria 572
421 nmdc:mga0yw44_366142_c1 3300050492 Bacteria 972
422 nmdc:mga0k408_10903_c1 3300050493 Bacteria 4930
423 nmdc:mga0k408_146149_c1 3300050493 Bacteria 1408
424 nmdc:mga0k408_16163_c1 3300050493 Bacteria 4137
425 nmdc:mga0k408_166716_c1 3300050493 Bacteria 1313
426 nmdc:mga0k408_200457_c1 3300050493 Bacteria 1191
427 nmdc:mga0k408_390889_c1 3300050493 Bacteria 828
428 nmdc:mga0k408_58659_c1 3300050493 Bacteria 2236
429 nmdc:mga0k408_8029_c1 3300050493 Bacteria 5658
430 nmdc:mga0k408_93804_c1 3300050493 Bacteria 1765
431 nmdc:mga06z11_18637_c1 3300050494 Bacteria 3175
432 nmdc:mga06z11_501180_c1 3300050494 Bacteria 736
433 nmdc:mga04h51_149268_c1 3300050495 Bacteria 892
434 nmdc:mga07m45_10917_c1 3300050496 Bacteria 4758
435 nmdc:mga07m45_282506_c1 3300050496 Bacteria 965
436 nmdc:mga07m45_299849_c1 3300050496 Bacteria 935
437 nmdc:mga07m45_46695_c1 3300050496 Bacteria 2433
438 nmdc:mga07m45_51501_c1 3300050496 Bacteria 2322
439 nmdc:mga07m45_75673_c1 3300050496 Bacteria 1919
440 nmdc:mga07m45_85327_c1 3300050496 Bacteria 1806
441 nmdc:mga05p37_245353_c1 3300050507 Bacteria 2150
442 nmdc:mga0sz30_123023_c1 3300050516 Bacteria 1141
443 nmdc:mga0sz30_79434_c1 3300050516 Bacteria 1419
444 Ga0500635_0000074 3300053080 Bacteria 64642
445 Ga0500635_0182100 3300053080 Bacteria 812
446 Ga0500578_0000006 3300053086 Bacteria 234598
447 Ga0500578_0246375 3300053086 Bacteria 1078
448 Ga0500578_0342416 3300053086 Bacteria 876
449 Ga0500644_0068189 3300053088 Bacteria 1274
450 Ga0500581_181502 3300053089 Bacteria 955
451 Ga0500651_0143051 3300053093 Bacteria 1440
452 Ga0500651_0357706 3300053093 Bacteria 827
453 Ga0500566_0376025 3300053094 Bacteria 643
454 Ga0500641_0025443 3300053096 Bacteria 2290
455 Ga0500557_127513 3300053105 Bacteria 843
456 Ga0500562_022876 3300053108 Bacteria 1629
457 Ga0500569_062221 3300053109 Bacteria 1155
458 Ga0500572_243645 3300053111 Bacteria 586
459 Ga0500623_166953 3300053127 Bacteria 875
460 Ga0500642_0027177 3300053130 Bacteria 2345
461 Ga0500652_199966 3300053131 Bacteria 811
462 Ga0500658_0007130 3300053134 Bacteria 4133
463 Ga0500658_0085412 3300053134 Bacteria 1357
464 Ga0500559_0240366 3300053136 Bacteria 853
465 Ga0500568_0027450 3300053139 Bacteria 2380
466 Ga0500577_0066833 3300053142 Bacteria 1399
467 Ga0500577_0207659 3300053142 Bacteria 846
468 Ga0500577_0338355 3300053142 Bacteria 658
469 Ga0500589_117672 3300053147 Bacteria 1130
470 Ga0500604_0020504 3300053151 Bacteria 1861
471 Ga0500616_0061676 3300053153 Bacteria 1940
472 Ga0500619_000646 3300053154 Bacteria 5931
473 Ga0500622_0000221 3300053156 Bacteria 59833
474 Ga0500622_0101326 3300053156 Bacteria 1417
475 Ga0500624_075081 3300053157 Bacteria 666
476 Ga0500636_0015790 3300053177 Bacteria 4450
477 Ga0500570_071853 3300053724 Bacteria 1610
478 Ga0500661_014642 3300055283 Bacteria 1411
479 Ga0466962_0010921 3300061719 Bacteria 4366
480 Ga0466962_0022669 3300061719 Bacteria 3018
481 2644272720 2643221648 Bacteria 6521465
482 2587730809 2585428057 Bacteria 6737412
483 2587730812 2585428057 Bacteria 6737412
484 2587737175 2585428058 Bacteria 6853932
485 2587756138 2585428062 Bacteria 6842168
486 2588294624 2588253510 Bacteria 6901809
487 2588294627 2588253510 Bacteria 6901809
488 2643868541 2643221570 Bacteria 5103772
489 2643966917 2643221592 Bacteria 6608788
490 2643994641 2643221596 Bacteria 5006805
491 2644061699 2643221609 Bacteria 6756331
492 2644075230 2643221611 Bacteria 6820941
493 2644248498 2643221644 Bacteria 6865017
494 2644295493 2643221652 Bacteria 5140275
495 2644302791 2643221654 Bacteria 5273570
496 2739243395 2738543012 Bacteria 7115078
497 2816473974 2816332133 Bacteria 7249298
498 2990715579 2990710928 Bacteria 5002431
499 JGI24740J21852_10029836
500 JGI25156J39149_1032708
501 JGI25150J39212_1024168
502 JGI25150J39212_1025157
503 JGI25153J46596_10010034
504 JGI25153J46596_10034570
505 Ga0006777J48905_1136568
506 rootH1_10006580
507 rootH1_10003606
508 rootH1_10127879
509 Ga0055539_1000264
510 Ga0055533_1000053
511 Ga0055525_1001618
512 Ga0055535_1000418
513 Ga0055529_1000431
514 Ga0055528_1053285
515 Ga0055530_10034074
516 Ga0055540_1000080
517 Ga0055531_10005699
518 Ga0070658_10279612
519 Ga0070676_10000378
520 Ga0070676_10003760
521 Ga0070676_10559639
522 Ga0070670_100014365
523 Ga0070670_100146401
524 Ga0068869_100014819
525 Ga0068869_100095509
526 Ga0070666_10140839
527 Ga0068868_100004021
528 Ga0068868_100008984
529 Ga0068868_100385585
530 Ga0070661_100002124
531 Ga0070661_100499854
532 Ga0070669_100204341
533 Ga0070675_100002710
534 Ga0070675_100012400
535 Ga0070671_100159911
536 Ga0070671_100177947
537 Ga0070671_100198160
538 Ga0070673_100009227
539 Ga0070659_100215890
540 Ga0070667_100080937
541 Ga0070667_100110330
542 Ga0070667_100304005
543 Ga0070708_100056879
544 Ga0070663_100010121
545 Ga0070678_100655725
546 Ga0070678_101010113
547 Ga0070662_100071267
548 Ga0070662_100202291
549 Ga0070662_100286599
550 Ga0070662_100407644
551 Ga0068867_100007928
552 Ga0068867_100092603
553 Ga0068867_100554865
554 Ga0070706_100135004
555 Ga0070707_100224226
556 Ga0070707_100676374
557 Ga0070698_100070339
558 Ga0070699_100386745
559 Ga0068853_100172537
560 Ga0068853_100195391
561 Ga0070672_100010006
562 Ga0070672_100114174
563 Ga0068855_100258764
564 Ga0070664_100004314
565 Ga0070664_100042024
566 Ga0068857_100036748
567 Ga0068857_100142268
568 Ga0068852_100456760
569 Ga0068852_100527345
570 Ga0068852_100650961
571 Ga0068859_102046446
572 Ga0068864_100355983
573 Ga0068861_101499646
574 Ga0068870_10013175
575 Ga0068860_101151282
576 Ga0075368_10143806
577 Ga0075368_10237597
578 Ga0075363_100034160
579 Ga0075363_100034216
580 Ga0075363_100079803
581 Ga0075362_10053467
582 Ga0075362_10085120
583 Ga0075362_10094177
584 Ga0075367_10021681
585 Ga0075367_10038345
586 Ga0075367_10051780
587 Ga0075367_10111976
588 Ga0075367_10178353
589 Ga0075367_10197847
590 Ga0075369_10021916
591 Ga0075369_10034294
592 Ga0075369_10196780
593 Ga0075366_10021714
594 Ga0075366_10106987
595 Ga0075366_10170008
596 Ga0075366_10670020
597 Ga0075370_10055960
598 Ga0075370_10177119
599 Ga0075370_10188146
600 Ga0075370_10214723
601 Ga0075370_10405211
602 Ga0075370_10407462
603 Ga0068871_100164044
604 Ga0075434_100384541
605 Ga0068865_100068753
606 Ga0068865_100927001
607 Ga0097620_102046318
608 Ga0105240_10262156
609 Ga0105245_10026597
610 Ga0105245_10159759
611 Ga0105245_10221062
612 Ga0105243_10023493
613 Ga0105242_11323160
614 Ga0105237_10143228
615 Ga0105238_10351156
616 Ga0105249_10239670
617 Ga0105239_10166190
618 Ga0105239_10287121
619 Ga0105239_10907074
620 Ga0105246_10020214
621 Ga0105246_10023767
622 Ga0105246_10082628
623 Ga0105246_10608260
624 Ga0157322_1009618
625 Ga0157374_10033743
626 Ga0157378_10682171
627 Ga0157375_10045969
628 Ga0157375_10402929
629 Ga0157380_10095541
630 Ga0157380_11074792
631 Ga0182005_1222491
632 Ga0213872_10065579
633 Ga0209674_100039
634 Ga0209563_100080
635 Ga0209258_100072
636 Ga0209677_100130
637 Ga0209677_103773
638 Ga0209148_1016976
639 Ga0209759_1001150
640 Ga0209455_1000053
641 Ga0209673_1009832
642 Ga0209673_1023131
643 Ga0209675_1035457
644 Ga0209564_1000014
645 Ga0209050_1002321
646 Ga0209256_1022638
647 Ga0209051_1000035
648 Ga0209051_1029243
649 Ga0209257_1000346
650 Ga0209257_1028066
651 Ga0209257_1050456
652 Ga0207682_10228538
653 Ga0207680_10037182
654 Ga0207645_10001114
655 Ga0207645_10033411
656 Ga0207645_10037765
657 Ga0207643_10162115
658 Ga0207643_10271660
659 Ga0207705_10389915
660 Ga0207684_10002973
661 Ga0207684_10256987
662 Ga0207695_10681379
663 Ga0207671_10081986
664 Ga0207649_10001856
665 Ga0207646_10227406
666 Ga0207681_10252954
667 Ga0207694_10364752
668 Ga0207650_10148454
669 Ga0207650_10421994
670 Ga0207659_10008230
671 Ga0207659_10077727
672 Ga0207687_10090733
673 Ga0207687_10159103
674 Ga0207644_10125302
675 Ga0207644_10653077
676 Ga0207690_10004109
677 Ga0207690_10113861
678 Ga0207706_10106217
679 Ga0207706_10285711
680 Ga0207709_10042070
681 Ga0207669_10033009
682 Ga0207669_10586655
683 Ga0207704_10107305
684 Ga0207704_10118983
685 Ga0207691_10003141
686 Ga0207691_10065264
687 Ga0207689_10021076
688 Ga0207689_10027812
689 Ga0207679_10000254
690 Ga0207679_10162020
691 Ga0207667_10231197
692 Ga0207668_11176112
693 Ga0207658_10046896
694 Ga0207658_10059861
695 Ga0207677_10030880
696 Ga0207677_10229847
697 Ga0207677_10633841
698 Ga0207639_10169371
699 Ga0207678_10037577
700 Ga0207678_10186442
701 Ga0207678_10239081
702 Ga0207641_10615146
703 Ga0207648_10008558
704 Ga0207648_10056678
705 Ga0207648_10111666
706 Ga0207676_10611634
707 Ga0207674_10009995
708 Ga0207674_10017199
709 Ga0207674_10266820
710 Ga0207674_10510930
711 Ga0207675_100928713
712 Ga0207683_10367426
713 Ga0207698_10456239
714 Ga0207698_10589865
715 Ga0207698_11017997
716 Ga0209973_1042044
717 Ga0209984_1012228
718 Ga0209995_1038438
719 Ga0209982_1025400
720 Ga0209971_1003584
721 Ga0209998_10023216
722 Ga0209813_10067809
723 Ga0209813_10134086
724 Ga0209813_10208468
725 Ga0209813_10223972
726 Ga0209974_10000798
727 Ga0209974_10059280
728 Ga0268266_10430531
729 Ga0268264_10063287
730 Ga0265334_10089494
731 Ga0265336_10000014
732 Ga0307517_10001591
733 Ga0307517_10129642
734 Ga0307517_10138754
735 Ga0307517_10361100
736 Ga0307515_10000030
737 Ga0307515_10000232
738 Ga0307515_10010735
739 Ga0307515_10011997
740 Ga0307515_10029263
741 Ga0307515_10190511
742 Ga0307515_10256141
743 Ga0265324_10002886
744 Ga0307511_10062371
745 Ga0307512_10186241
746 Ga0307512_10301212
747 Ga0307513_10021343
748 Ga0307513_10086072
749 Ga0307513_10116418
750 Ga0307513_10307283
751 Ga0307513_10377032
752 Ga0307513_10417951
753 Ga0307509_10062124
754 Ga0307408_100000096
755 Ga0307408_100000274
756 Ga0307408_100393514
757 Ga0307508_10010139
758 Ga0307508_10014137
759 Ga0307508_10155545
760 Ga0307508_10295523
761 Ga0307514_10017566
762 Ga0307514_10034928
763 Ga0307514_10068434
764 Ga0307516_10002371
765 Ga0307516_10048399
766 Ga0307516_10052113
767 Ga0307516_10058407
768 Ga0307516_10212887
769 Ga0307406_10000285
770 Ga0307406_10000669
771 Ga0307507_10064390
772 Ga0307507_10084566
773 Ga0307507_10441570
774 Ga0307510_10002010
775 Ga0373948_0146551
776 Ga0373923_0390971
777 Ga0373931_0058430
778 Ga0373937_0955989
779 Ga0395900_0000355
780 Ga0395905_0009834
781 Ga0395905_0099172
782 Ga0395905_0117971
783 Ga0395905_0143686
784 Ga0436361_0246290
785 Ga0436361_0446923
786 Ga0451787_611721
787 Ga0451789_0930105
788 Ga0451789_1015101
789 Ga0451791_0603808
790 Ga0451791_1408766
791 Ga0451793_0236477
792 Ga0451793_0796079
793 Ga0451795_1550623
794 Ga0451798_0294272
795 Ga0451804_0147376
796 Ga0451807_0698218
797 Ga0451833_0566945
798 Ga0451839_1129181
799 Ga0451843_0158826
800 Ga0451855_0264997
801 Ga0451853_0955568
802 Ga0439462_0008298
803 Ga0450919_000053
804 Ga0450923_008919
805 Ga0450918_008216
806 Ga0451577_0180188
807 Ga0451577_0249832
808 Ga0451577_0272707
809 Ga0451577_0372751
810 Ga0466969_0000028
811 Ga0466969_0025988
812 Ga0466969_0051314
813 Ga0466972_0005554
814 Ga0466965_0000486
815 Ga0466965_0010206
816 Ga0466966_0002639
817 Ga0466966_0033518
818 Ga0466961_0004039
819 Ga0466961_0175976
820 Ga0466963_0634170
821 Ga0466964_0024633
822 Ga0466964_0026690
823 Ga0453684_0218310
824 Ga0466971_0012528
825 Ga0466971_0160114
826 Ga0466970_0009077
827 Ga0466970_0019016
828 Ga0466970_0040100
829 Ga0466957_0001863
830 Ga0466957_0066637
831 Ga0466959_0010874
832 Ga0466959_0047217
833 Ga0466959_0101295
834 Ga0466958_0017076
835 Ga0466958_0048251
836 Ga0466967_0764449
837 Ga0466967_0925237
838 Ga0495590_0001167
839 Ga0495590_0022666
840 Ga0495590_0124094
841 Ga0495638_0314090
842 Ga0495650_0018863
843 Ga0495605_0365091
844 Ga0495639_0009882
845 Ga0495583_0000350
846 Ga0495583_0062508
847 Ga0495606_0004217
848 Ga0495610_0052171
849 Ga0495631_0095493
850 Ga0495632_0004253
851 Ga0495632_0023893
852 Ga0495632_0033213
853 Ga0495643_0018195
854 Ga0495643_0126649
855 Ga0495643_0282440
856 Ga0495648_0206897
857 Ga0495648_0302379
858 Ga0495666_0036931
859 Ga0495642_0182433
860 Ga0495652_0401252
861 Ga0495597_0012435
862 Ga0495597_0037442
863 Ga0495633_0311458
864 Ga0495668_0049571
865 Ga0495668_0074138
866 Ga0495668_0116809
867 Ga0495668_0400625
868 Ga0495611_0056402
869 Ga0495611_0377666
870 Ga0495625_0002284
871 Ga0495625_0005026
872 Ga0495625_0121969
873 Ga0495625_0123397
874 Ga0495669_0076531
875 Ga0495671_0139349
876 Ga0495649_0004041
877 Ga0495649_0016534
878 Ga0495660_0108245
879 Ga0495683_0100030
880 Ga0495687_000914
881 Ga0495687_001014
882 Ga0495687_003096
883 Ga0495679_158815
884 Ga0495686_0001681
885 Ga0495686_0170616
886 Ga0495686_0176424
887 Ga0495626_0088987
888 Ga0495626_0142598
889 Ga0495626_0332140
890 Ga0496102_0004306
891 Ga0496106_0647816
892 Ga0496113_0373614
893 Ga0496114_0004709
894 Ga0496115_0302964
895 Ga0496121_0007977
896 Ga0496121_0179958
897 Ga0496124_0001253
898 Ga0496125_0169282
899 Ga0501306_012102
900 Ga0501306_033618
901 Ga0501308_023436
902 Ga0501309_011943
903 Ga0501305_022459
904 Ga0501307_018847
905 Ga0495678_098339
906 Ga0495682_0088908
907 Ga0495682_0253596
908 Ga0501312_038364
909 Ga0501322_013051
910 Ga0501323_004124
911 Ga0501325_023943
912 Ga0501219_008291
913 Ga0501265_019021
914 Ga0501265_028412
915 Ga0501226_018234
916 nmdc:mga03683_177286_c1
917 nmdc:mga03683_413962_c1
918 nmdc:mga03n38_732406_c1
919 nmdc:mga0yw44_366142_c1
920 nmdc:mga0k408_10903_c1
921 nmdc:mga0k408_146149_c1
922 nmdc:mga0k408_16163_c1
923 nmdc:mga0k408_166716_c1
924 nmdc:mga0k408_200457_c1
925 nmdc:mga0k408_390889_c1
926 nmdc:mga0k408_58659_c1
927 nmdc:mga0k408_8029_c1
928 nmdc:mga0k408_93804_c1
929 nmdc:mga06z11_18637_c1
930 nmdc:mga06z11_501180_c1
931 nmdc:mga04h51_149268_c1
932 nmdc:mga07m45_10917_c1
933 nmdc:mga07m45_282506_c1
934 nmdc:mga07m45_299849_c1
935 nmdc:mga07m45_46695_c1
936 nmdc:mga07m45_51501_c1
937 nmdc:mga07m45_75673_c1
938 nmdc:mga07m45_85327_c1
939 nmdc:mga05p37_245353_c1
940 nmdc:mga0sz30_123023_c1
941 nmdc:mga0sz30_79434_c1
942 Ga0500635_0000074
943 Ga0500635_0182100
944 Ga0500578_0000006
945 Ga0500578_0246375
946 Ga0500578_0342416
947 Ga0500644_0068189
948 Ga0500581_181502
949 Ga0500651_0143051
950 Ga0500651_0357706
951 Ga0500566_0376025
952 Ga0500641_0025443
953 Ga0500557_127513
954 Ga0500562_022876
955 Ga0500569_062221
956 Ga0500572_243645
957 Ga0500623_166953
958 Ga0500642_0027177
959 Ga0500652_199966
960 Ga0500658_0007130
961 Ga0500658_0085412
962 Ga0500559_0240366
963 Ga0500568_0027450
964 Ga0500577_0066833
965 Ga0500577_0207659
966 Ga0500577_0338355
967 Ga0500589_117672
968 Ga0500604_0020504
969 Ga0500616_0061676
970 Ga0500619_000646
971 Ga0500622_0000221
972 Ga0500622_0101326
973 Ga0500624_075081
974 Ga0500636_0015790
975 Ga0500570_071853
976 Ga0500661_014642
977 Ga0466962_0010921
978 Ga0466962_0022669
979 2644272720
980 2587730809
981 2587730812
982 2587737175
983 2587756138
984 2588294624
985 2588294627
986 2643868541
987 2643966917
988 2643994641
989 2644061699
990 2644075230
991 2644248498
992 2644295493
993 2644302791
994 2739243395
995 2816473974
996 2990715579

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01584

CheW

CheW-like domain

14

151

0.96

Map