F455792

General Info

Members Datasets Scaffolds Average Seq Length
502 324 486 191

Family's Representative Sequence

Representative Sequence 3300003763|Ga0055529_1013820|Ga0055529_10138202
Length 220
Sequence MALRHPSTTMSSSAEATLAGSTSGTIEAAVRPAVVLASASPRRLDLLRQIGLEPDRVDPPEIDESHARTELPRAYARRMAEEKLAVAAARHPGAVVIAADTVVACGRRILPKAETEQQARACLKLLNGRRHQVWGGIAVALADGRQISRLVETDVILKRLEPAEIDRYIASGEWHGKAGGYAIQGRAAAFIRSIAGSYSNVVGLSLSDLAAMLHGSGVVW

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
3 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
4 2643221640 Caulobacter sp. Root342 Isolate Unclassified
5 2643221642 Caulobacter sp. Root343 Isolate Unclassified
6 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
7 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
8 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
9 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
10 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
11 2849560528 Caulobacter zeae 410 Isolate Unclassified
12 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
13 2851153111 Caulobacter radicis 736 Isolate Unclassified
14 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
15 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
16 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
17 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
198 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
199 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
222 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
223 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
235 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
236 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
240 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
252 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
253 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
263 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
264 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
265 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
281 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
286 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
294 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
295 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
296 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
297 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
301 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
302 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
306 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
309 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
310 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
311 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
312 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
313 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
314 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
315 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
316 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
317 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
318 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
319 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
320 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
321 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
322 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
323 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
324 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.41
Metatranscriptomes 0.4
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.37
Nodule 0
Rhizoplane 2.39
Rhizosphere 83.27
Stem 0
Stem Tuber 0
Unclassified 5.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001634 3300001915 Bacteria 6243
2 JGI24740J21852_10008431 3300001979 Bacteria 4106
3 JGI24739J22299_10013084 3300001989 Bacteria 3035
4 JGI24737J22298_10001465 3300001990 Bacteria 8407
5 JGI24735J21928_10001446 3300002067 Bacteria 8392
6 rootH1_10103122 3300003316 Bacteria 1631
7 rootL2_10314575 3300003322 Bacteria 1128
8 Ga0055529_1013820 3300003763 Bacteria 1026
9 Ga0055536_1010582 3300003781 Bacteria 3639
10 Ga0055530_10004289 3300003791 Bacteria 7440
11 Ga0055530_10009753 3300003791 Bacteria 3640
12 Ga0055531_10004154 3300003794 Bacteria 8936
13 Ga0070658_10017623 3300005327 Bacteria 5713
14 Ga0070658_10104631 3300005327 Bacteria 2342
15 Ga0070658_10374550 3300005327 Bacteria 1221
16 Ga0070676_10301428 3300005328 Bacteria 1086
17 Ga0070683_100150262 3300005329 Bacteria 2208
18 Ga0070690_100162446 3300005330 Bacteria 1532
19 Ga0068869_100985720 3300005334 Bacteria 733
20 Ga0070680_100270310 3300005336 Bacteria 1439
21 Ga0070680_100292487 3300005336 Bacteria 1381
22 Ga0068868_100000020 3300005338 Bacteria 92590
23 Ga0070660_100000567 3300005339 Bacteria 24778
24 Ga0070660_100007313 3300005339 Bacteria 7695
25 Ga0070660_100704604 3300005339 Bacteria 847
26 Ga0070687_100268287 3300005343 Bacteria 1069
27 Ga0070661_100000003 3300005344 Bacteria 254653
28 Ga0070661_100004250 3300005344 Bacteria 9878
29 Ga0070661_100069184 3300005344 Bacteria 2595
30 Ga0070661_100111798 3300005344 Bacteria 2040
31 Ga0070692_10000239 3300005345 Bacteria 15079
32 Ga0070668_100118592 3300005347 Bacteria 2113
33 Ga0070668_100385830 3300005347 Bacteria 1193
34 Ga0070669_100256703 3300005353 Bacteria 1393
35 Ga0070669_100257865 3300005353 Bacteria 1390
36 Ga0070669_100277633 3300005353 Bacteria 1341
37 Ga0070675_100013425 3300005354 Bacteria 6437
38 Ga0070675_100088998 3300005354 Bacteria 2584
39 Ga0070671_100256929 3300005355 Bacteria 1484
40 Ga0070673_100449758 3300005364 Bacteria 1159
41 Ga0070688_100081070 3300005365 Bacteria 2100
42 Ga0070659_100000017 3300005366 Bacteria 163966
43 Ga0070659_100012507 3300005366 Bacteria 6293
44 Ga0070659_101050401 3300005366 Bacteria 716
45 Ga0070667_100488585 3300005367 Bacteria 1128
46 Ga0070714_100018613 3300005435 Bacteria 5645
47 Ga0070714_100049547 3300005435 Bacteria 3575
48 Ga0070714_100163889 3300005435 Bacteria 2013
49 Ga0070713_100078371 3300005436 Bacteria 2812
50 Ga0070713_100281729 3300005436 Bacteria 1525
51 Ga0070713_101048341 3300005436 Bacteria 787
52 Ga0070710_10123373 3300005437 Bacteria 1571
53 Ga0070710_10127750 3300005437 Bacteria 1546
54 Ga0070711_100055689 3300005439 Bacteria 2733
55 Ga0070708_100385287 3300005445 Bacteria 1322
56 Ga0070663_100012402 3300005455 Bacteria 5391
57 Ga0070663_100212549 3300005455 Bacteria 1515
58 Ga0070678_100210785 3300005456 Bacteria 1610
59 Ga0070681_10014645 3300005458 Bacteria 7801
60 Ga0070699_100087578 3300005518 Bacteria 2718
61 Ga0070679_100049104 3300005530 Bacteria 4203
62 Ga0070684_100031471 3300005535 Bacteria 4517
63 Ga0068853_100008824 3300005539 Bacteria 8110
64 Ga0068853_100036479 3300005539 Bacteria 4182
65 Ga0068853_100683020 3300005539 Bacteria 979
66 Ga0070672_100149828 3300005543 Bacteria 1929
67 Ga0070696_100022243 3300005546 Bacteria 4307
68 Ga0070665_100124205 3300005548 Bacteria 2583
69 Ga0070665_100124502 3300005548 Bacteria 2580
70 Ga0070704_100437436 3300005549 Bacteria 1123
71 Ga0068855_100005356 3300005563 Bacteria 15649
72 Ga0068855_101273253 3300005563 Unclassified 762
73 Ga0068855_101473605 3300005563 Bacteria 699
74 Ga0070664_100000563 3300005564 Bacteria 28381
75 Ga0070664_100083231 3300005564 Bacteria 2760
76 Ga0070664_100226662 3300005564 Bacteria 1674
77 Ga0068857_100002279 3300005577 Bacteria 15601
78 Ga0068857_100230256 3300005577 Bacteria 1695
79 Ga0068857_100676244 3300005577 Bacteria 979
80 Ga0068856_100004757 3300005614 Bacteria 13477
81 Ga0068856_100048633 3300005614 Bacteria 4180
82 Ga0068856_100430051 3300005614 Bacteria 1340
83 Ga0068852_100003269 3300005616 Bacteria 11314
84 Ga0068852_100033251 3300005616 Bacteria 4279
85 Ga0068852_100083796 3300005616 Bacteria 2836
86 Ga0068864_100049637 3300005618 Bacteria 3610
87 Ga0068851_10011715 3300005834 Bacteria 4117
88 Ga0068870_10203854 3300005840 Bacteria 1201
89 Ga0068863_100362810 3300005841 Bacteria 1412
90 Ga0068858_100380184 3300005842 Bacteria 1355
91 Ga0068860_100328464 3300005843 Bacteria 1502
92 Ga0068862_100140226 3300005844 Bacteria 2145
93 Ga0081455_10139756 3300005937 Bacteria 1882
94 Ga0081455_10144006 3300005937 Bacteria 1846
95 Ga0081538_10032951 3300005981 Bacteria 3459
96 Ga0070717_10446966 3300006028 Bacteria 1165
97 Ga0075365_10131464 3300006038 Bacteria 1732
98 Ga0075364_10085153 3300006051 Bacteria 2093
99 Ga0070716_100136574 3300006173 Bacteria 1558
100 Ga0075362_10128066 3300006177 Bacteria 1206
101 Ga0075369_10046071 3300006186 Bacteria 1877
102 Ga0075370_10007752 3300006353 Bacteria 5483
103 Ga0075433_10183812 3300006852 Bacteria 1860
104 Ga0068865_100676478 3300006881 Bacteria 879
105 Ga0105251_10003145 3300009011 Bacteria 12252
106 Ga0105250_10108305 3300009092 Bacteria 1137
107 Ga0105240_10001484 3300009093 Bacteria 39913
108 Ga0105240_10238459 3300009093 Bacteria 2110
109 Ga0105240_10365567 3300009093 Bacteria 1633
110 Ga0111539_10028255 3300009094 Bacteria 6846
111 Ga0105245_10088434 3300009098 Bacteria 2845
112 Ga0114129_10204402 3300009147 Bacteria 2673
113 Ga0114129_10709329 3300009147 Bacteria 1292
114 Ga0105243_10677125 3300009148 Bacteria 1003
115 Ga0105241_10037937 3300009174 Bacteria 3632
116 Ga0105241_10064296 3300009174 Bacteria 2832
117 Ga0105241_10258466 3300009174 Bacteria 1479
118 Ga0105242_10180480 3300009176 Bacteria 1862
119 Ga0105242_10531227 3300009176 Bacteria 1124
120 Ga0105242_10990116 3300009176 Bacteria 848
121 Ga0105248_10065793 3300009177 Bacteria 4070
122 Ga0105248_11892277 3300009177 Bacteria 677
123 Ga0105237_10010720 3300009545 Bacteria 9724
124 Ga0105238_10007836 3300009551 Bacteria 10680
125 Ga0105238_10480091 3300009551 Bacteria 1242
126 Ga0105238_10869305 3300009551 Bacteria 919
127 Ga0105239_10063498 3300010375 Bacteria 4055
128 Ga0105239_10536770 3300010375 Bacteria 1331
129 Ga0105239_11832096 3300010375 Bacteria 703
130 Ga0157373_10030058 3300013100 Bacteria 3910
131 Ga0157373_10175019 3300013100 Bacteria 1510
132 Ga0157371_10109325 3300013102 Bacteria 1962
133 Ga0157370_10008878 3300013104 Bacteria 10804
134 Ga0157370_10263161 3300013104 Bacteria 1594
135 Ga0157370_10263948 3300013104 Bacteria 1591
136 Ga0157370_10467583 3300013104 Bacteria 1159
137 Ga0157369_10005068 3300013105 Bacteria 15414
138 Ga0157369_10037786 3300013105 Bacteria 5285
139 Ga0157374_10476176 3300013296 Bacteria 1251
140 Ga0157374_10668299 3300013296 Bacteria 1051
141 Ga0157378_10312610 3300013297 Bacteria 1524
142 Ga0157372_10005517 3300013307 Bacteria 13448
143 Ga0157372_12153002 3300013307 Bacteria 641
144 Ga0157375_10371145 3300013308 Bacteria 1597
145 Ga0163163_10062375 3300014325 Bacteria 3693
146 Ga0157380_10009778 3300014326 Bacteria 6884
147 Ga0182008_10056310 3300014497 Bacteria 1943
148 Ga0157379_11076381 3300014968 Bacteria 769
149 Ga0157376_10028710 3300014969 Bacteria 4425
150 Ga0163161_10228117 3300017792 Bacteria 1444
151 Ga0163161_10311554 3300017792 Bacteria 1242
152 Ga0163161_10414479 3300017792 Bacteria 1082
153 Ga0206354_10571180 3300020081 Bacteria 3548
154 Ga0206353_10114243 3300020082 Bacteria 2901
155 Ga0213872_10013257 3300021361 Bacteria 3865
156 Ga0213872_10028746 3300021361 Bacteria 2549
157 Ga0213875_10007362 3300021388 Bacteria 5688
158 Ga0209148_1001566 3300025254 Bacteria 10979
159 Ga0209455_1001154 3300025272 Bacteria 12757
160 Ga0209676_1000243 3300025292 Bacteria 117113
161 Ga0209676_1001364 3300025292 Bacteria 24001
162 Ga0209050_1000244 3300025298 Bacteria 117105
163 Ga0209050_1001551 3300025298 Bacteria 24060
164 Ga0209256_1015389 3300025299 Bacteria 2679
165 Ga0209051_1007439 3300025303 Bacteria 5982
166 Ga0209257_1000140 3300025304 Bacteria 201515
167 Ga0209257_1033032 3300025304 Bacteria 1632
168 Ga0207656_10013188 3300025321 Bacteria 3153
169 Ga0207713_1024953 3300025735 Bacteria 2771
170 Ga0207692_10091514 3300025898 Bacteria 1650
171 Ga0207692_10233576 3300025898 Bacteria 1095
172 Ga0207647_10009795 3300025904 Bacteria 6795
173 Ga0207699_10033715 3300025906 Bacteria 2896
174 Ga0207699_10234911 3300025906 Bacteria 1257
175 Ga0207645_10221544 3300025907 Bacteria 1247
176 Ga0207705_10069782 3300025909 Bacteria 2545
177 Ga0207705_10179691 3300025909 Bacteria 1596
178 Ga0207705_10191496 3300025909 Bacteria 1547
179 Ga0207654_10016559 3300025911 Bacteria 3841
180 Ga0207654_10072813 3300025911 Bacteria 2046
181 Ga0207707_10356000 3300025912 Bacteria 1261
182 Ga0207707_10443838 3300025912 Bacteria 1111
183 Ga0207695_10011192 3300025913 Bacteria 10884
184 Ga0207695_10064545 3300025913 Bacteria 3769
185 Ga0207671_10008001 3300025914 Bacteria 9055
186 Ga0207671_10410931 3300025914 Bacteria 1076
187 Ga0207693_10003277 3300025915 Bacteria 13862
188 Ga0207663_10017893 3300025916 Bacteria 3958
189 Ga0207657_10001546 3300025919 Bacteria 24651
190 Ga0207657_10011306 3300025919 Bacteria 8865
191 Ga0207657_10064057 3300025919 Bacteria 3140
192 Ga0207649_10000027 3300025920 Bacteria 161926
193 Ga0207649_10013560 3300025920 Bacteria 4551
194 Ga0207649_10022394 3300025920 Bacteria 3650
195 Ga0207649_10689543 3300025920 Unclassified 792
196 Ga0207652_10050287 3300025921 Bacteria 3571
197 Ga0207681_10109631 3300025923 Bacteria 2006
198 Ga0207681_11076794 3300025923 Bacteria 675
199 Ga0207694_10001424 3300025924 Bacteria 20507
200 Ga0207694_10189128 3300025924 Bacteria 1672
201 Ga0207650_10165711 3300025925 Bacteria 1753
202 Ga0207659_10003798 3300025926 Bacteria 9113
203 Ga0207687_10044674 3300025927 Bacteria 3059
204 Ga0207700_10171922 3300025928 Bacteria 1808
205 Ga0207664_10023189 3300025929 Bacteria 4647
206 Ga0207664_10058674 3300025929 Bacteria 3062
207 Ga0207664_10433876 3300025929 Bacteria 1171
208 Ga0207644_10174383 3300025931 Bacteria 1681
209 Ga0207690_10000035 3300025932 Bacteria 149201
210 Ga0207690_10057213 3300025932 Bacteria 2633
211 Ga0207690_10306496 3300025932 Bacteria 1244
212 Ga0207706_10010045 3300025933 Bacteria 8674
213 Ga0207706_11159884 3300025933 Bacteria 643
214 Ga0207686_10102679 3300025934 Bacteria 1912
215 Ga0207709_10242697 3300025935 Bacteria 1311
216 Ga0207691_10221866 3300025940 Bacteria 1639
217 Ga0207711_10276624 3300025941 Bacteria 1545
218 Ga0207689_10367284 3300025942 Bacteria 1197
219 Ga0207661_10087963 3300025944 Bacteria 2582
220 Ga0207661_10206700 3300025944 Bacteria 1729
221 Ga0207679_10008926 3300025945 Bacteria 6400
222 Ga0207679_10366122 3300025945 Bacteria 1260
223 Ga0207667_10005999 3300025949 Bacteria 14784
224 Ga0207667_10147441 3300025949 Bacteria 2422
225 Ga0207667_10364687 3300025949 Bacteria 1473
226 Ga0207651_10232052 3300025960 Bacteria 1499
227 Ga0207651_10268145 3300025960 Bacteria 1405
228 Ga0207712_10101875 3300025961 Bacteria 2136
229 Ga0207640_10058917 3300025981 Bacteria 2532
230 Ga0207677_10000071 3300026023 Bacteria 84386
231 Ga0207703_10420607 3300026035 Bacteria 1243
232 Ga0207703_10669502 3300026035 Bacteria 985
233 Ga0207639_10001044 3300026041 Bacteria 18817
234 Ga0207639_10013130 3300026041 Bacteria 5787
235 Ga0207639_10020975 3300026041 Bacteria 4686
236 Ga0207639_10032204 3300026041 Bacteria 3858
237 Ga0207639_11259315 3300026041 Bacteria 694
238 Ga0207678_10008945 3300026067 Bacteria 8818
239 Ga0207678_10234638 3300026067 Bacteria 1571
240 Ga0207702_10003692 3300026078 Bacteria 13850
241 Ga0207702_10005099 3300026078 Bacteria 11548
242 Ga0207702_10014826 3300026078 Bacteria 6464
243 Ga0207702_11193767 3300026078 Bacteria 755
244 Ga0207641_10507707 3300026088 Bacteria 1171
245 Ga0207641_10881642 3300026088 Bacteria 888
246 Ga0207648_10995945 3300026089 Bacteria 785
247 Ga0207676_10125694 3300026095 Bacteria 2171
248 Ga0207674_10000053 3300026116 Bacteria 114437
249 Ga0207674_10349763 3300026116 Bacteria 1429
250 Ga0207674_10598668 3300026116 Bacteria 1065
251 Ga0207675_100014967 3300026118 Bacteria 7241
252 Ga0207683_10115146 3300026121 Bacteria 2410
253 Ga0207683_10883269 3300026121 Bacteria 830
254 Ga0207698_10000279 3300026142 Bacteria 31023
255 Ga0207698_10007275 3300026142 Bacteria 6936
256 Ga0207698_10074915 3300026142 Bacteria 2702
257 Ga0207698_10291383 3300026142 Bacteria 1515
258 Ga0207698_10595607 3300026142 Bacteria 1089
259 Ga0209813_10000240 3300027866 Bacteria 16302
260 Ga0207428_10000208 3300027907 Bacteria 81781
261 Ga0268266_10022326 3300028379 Bacteria 5394
262 Ga0268265_10110045 3300028380 Bacteria 2247
263 Ga0268265_10245555 3300028380 Bacteria 1582
264 Ga0268264_10290378 3300028381 Bacteria 1535
265 Ga0265318_10042759 3300028577 Bacteria 1719
266 Ga0307515_10045998 3300028794 Bacteria 6685
267 Ga0265338_10106774 3300028800 Bacteria 2266
268 Ga0265338_10372959 3300028800 Bacteria 1022
269 Ga0265331_10000641 3300031250 Bacteria 30240
270 Ga0307408_100165099 3300031548 Bacteria 1762
271 Ga0265313_10110726 3300031595 Bacteria 1208
272 Ga0265314_10384477 3300031711 Bacteria 763
273 Ga0307405_10928640 3300031731 Bacteria 738
274 Ga0307413_10029578 3300031824 Bacteria 3067
275 Ga0307412_10000991 3300031911 Bacteria 16260
276 Ga0307409_100006166 3300031995 Bacteria 7013
277 Ga0307409_101018679 3300031995 Bacteria 847
278 Ga0307416_100283338 3300032002 Bacteria 1635
279 Ga0307416_100795163 3300032002 Bacteria 1041
280 Ga0307416_101164776 3300032002 Bacteria 876
281 Ga0307414_10179156 3300032004 Bacteria 1703
282 Ga0307414_10374754 3300032004 Bacteria 1229
283 Ga0307414_10690160 3300032004 Bacteria 923
284 Ga0307411_10124102 3300032005 Bacteria 1874
285 Ga0307411_10344795 3300032005 Bacteria 1212
286 Ga0307415_100379456 3300032126 Bacteria 1200
287 Ga0307415_100383883 3300032126 Bacteria 1194
288 Ga0373934_0079843 3300035086 Bacteria 1314
289 Ga0373923_0007488 3300035111 Bacteria 3841
290 Ga0373923_0390765 3300035111 Bacteria 668
291 Ga0373936_0068954 3300035113 Bacteria 1455
292 Ga0373945_0200139 3300035116 Bacteria 829
293 Ga0373953_0100950 3300035117 Bacteria 1214
294 Ga0373953_0373036 3300035117 Bacteria 626
295 Ga0373954_0195921 3300035118 Bacteria 992
296 Ga0373956_0029317 3300035119 Bacteria 2399
297 Ga0373956_0088216 3300035119 Bacteria 1429
298 Ga0373943_0508143 3300035170 Bacteria 705
299 Ga0373924_0044729 3300035410 Bacteria 1820
300 Ga0373927_0406876 3300035695 Bacteria 898
301 Ga0373933_0032853 3300035724 Bacteria 3016
302 Ga0373933_0054875 3300035724 Bacteria 2389
303 Ga0373947_0072836 3300035725 Bacteria 2110
304 Ga0373937_0018996 3300036401 Bacteria 6148
305 Ga0373937_0033932 3300036401 Bacteria 4639
306 Ga0373925_0108098 3300037068 Bacteria 2146
307 Ga0373925_0127412 3300037068 Bacteria 1982
308 Ga0373925_0208535 3300037068 Bacteria 1556
309 Ga0395899_0014457 3300037312 Bacteria 6024
310 Ga0395900_0030524 3300037418 Bacteria 5534
311 Ga0395898_0040971 3300037466 Bacteria 4576
312 Ga0395905_0228053 3300037471 Bacteria 1742
313 Ga0436364_0351709 3300037853 Bacteria 21332
314 Ga0395901_0088078 3300038443 Bacteria 3246
315 Ga0395901_0230303 3300038443 Bacteria 1934
316 Ga0395901_1099174 3300038443 Bacteria 766
317 Ga0395901_1103104 3300038443 Bacteria 764
318 Ga0436365_1142461 3300039437 Bacteria 901
319 Ga0436360_0394921 3300039438 Bacteria 3170
320 Ga0436360_1166518 3300039438 Bacteria 1017
321 Ga0436361_0558812 3300039447 Bacteria 2364
322 Ga0436361_0796148 3300039447 Bacteria 3566
323 Ga0436361_0807596 3300039447 Bacteria 2716
324 Ga0436361_1115951 3300039447 Bacteria 8723
325 Ga0466963_0041585 3300044694 Bacteria 3015
326 Ga0466971_0160381 3300044719 Bacteria 1053
327 Ga0466957_0016054 3300044842 Bacteria 4377
328 Ga0466958_0002177 3300045836 Bacteria 9770
329 Ga0466967_0021905 3300045976 Bacteria 5201
330 Ga0495617_001529 3300046452 Bacteria 10042
331 Ga0495627_000225 3300046453 Bacteria 60005
332 Ga0495627_000324 3300046453 Bacteria 46576
333 Ga0495590_0006148 3300046457 Bacteria 4703
334 Ga0495638_0000012 3300046460 Bacteria 435577
335 Ga0495651_0016247 3300046462 Bacteria 5765
336 Ga0495650_0003357 3300046471 Bacteria 11747
337 Ga0495605_0238071 3300046474 Bacteria 782
338 Ga0495662_0278388 3300046476 Bacteria 824
339 Ga0495664_0024256 3300046477 Bacteria 3524
340 Ga0495584_0062213 3300046491 Bacteria 1876
341 Ga0495583_0001198 3300046506 Bacteria 27870
342 Ga0495608_0030067 3300046511 Bacteria 3680
343 Ga0495608_0095061 3300046511 Bacteria 1925
344 Ga0495610_0000085 3300046512 Bacteria 112390
345 Ga0495610_0001911 3300046512 Bacteria 17969
346 Ga0495610_0084972 3300046512 Bacteria 1445
347 Ga0495631_0006778 3300046518 Bacteria 5880
348 Ga0495631_0144026 3300046518 Bacteria 1023
349 Ga0495632_0000013 3300046519 Bacteria 247879
350 Ga0495632_0000612 3300046519 Bacteria 32954
351 Ga0495637_0000100 3300046520 Bacteria 65373
352 Ga0495637_0004041 3300046520 Bacteria 7662
353 Ga0495637_0059996 3300046520 Bacteria 1564
354 Ga0495643_0000010 3300046522 Bacteria 341431
355 Ga0495643_0219444 3300046522 Bacteria 903
356 Ga0495648_0000038 3300046524 Bacteria 191612
357 Ga0495648_0000933 3300046524 Bacteria 30373
358 Ga0495648_0013969 3300046524 Bacteria 5908
359 Ga0495663_0000004 3300046525 Bacteria 355166
360 Ga0495642_0051532 3300046528 Bacteria 1693
361 Ga0495642_0136290 3300046528 Bacteria 1058
362 Ga0495652_0116448 3300046529 Bacteria 2140
363 Ga0495652_0438879 3300046529 Bacteria 916
364 Ga0495640_0103298 3300046533 Bacteria 1869
365 Ga0495587_0021169 3300046536 Bacteria 4010
366 Ga0495597_0014687 3300046542 Bacteria 3725
367 Ga0495597_0030655 3300046542 Bacteria 2450
368 Ga0495645_0036582 3300046543 Bacteria 3578
369 Ga0495633_0000092 3300046558 Bacteria 121446
370 Ga0495633_0001757 3300046558 Bacteria 16080
371 Ga0495633_0005139 3300046558 Bacteria 8110
372 Ga0495633_0024664 3300046558 Bacteria 2969
373 Ga0495667_0035038 3300046559 Bacteria 3356
374 Ga0495667_0060267 3300046559 Bacteria 2489
375 Ga0495668_0031091 3300046616 Bacteria 3009
376 Ga0495635_0089065 3300046663 Bacteria 2111
377 Ga0495657_0070715 3300046675 Bacteria 2280
378 Ga0495599_0006314 3300046678 Bacteria 7144
379 Ga0495623_0345806 3300046679 Bacteria 811
380 Ga0495669_0000042 3300046684 Bacteria 87033
381 Ga0495669_0321320 3300046684 Bacteria 747
382 Ga0495613_0002574 3300046689 Bacteria 13649
383 Ga0495670_0118029 3300046691 Bacteria 1377
384 Ga0495671_0000014 3300046692 Bacteria 341431
385 Ga0495671_0000034 3300046692 Bacteria 195385
386 Ga0495671_0044633 3300046692 Bacteria 2221
387 Ga0495600_0209641 3300046809 Bacteria 1249
388 Ga0495604_0095896 3300047317 Bacteria 2190
389 Ga0495604_0496010 3300047317 Bacteria 793
390 Ga0495674_0153881 3300047319 Bacteria 1927
391 Ga0495674_0677042 3300047319 Bacteria 811
392 Ga0495672_0019590 3300047320 Bacteria 4460
393 Ga0495680_0239145 3300047322 Bacteria 1290
394 Ga0495680_0467800 3300047322 Bacteria 860
395 Ga0495675_0009072 3300047444 Bacteria 6181
396 Ga0495675_0298456 3300047444 Bacteria 957
397 Ga0495677_0152105 3300047445 Bacteria 891
398 Ga0495673_0000013 3300047469 Bacteria 612902
399 Ga0495673_0008628 3300047469 Bacteria 5707
400 Ga0495681_0000013 3300047470 Bacteria 189155
401 Ga0495681_0000725 3300047470 Bacteria 25287
402 Ga0495684_0104179 3300047471 Bacteria 2144
403 Ga0495686_0003559 3300047472 Bacteria 13392
404 Ga0495686_0043333 3300047472 Bacteria 2853
405 Ga0495686_0084335 3300047472 Bacteria 1936
406 Ga0495602_0044589 3300048088 Bacteria 4021
407 Ga0495602_0337395 3300048088 Bacteria 1091
408 Ga0496103_0264954 3300048906 Bacteria 1105
409 Ga0496106_0336944 3300048909 Bacteria 1211
410 Ga0496107_0051128 3300048910 Bacteria 2980
411 Ga0496108_0003651 3300048911 Bacteria 12345
412 Ga0496108_0121547 3300048911 Bacteria 2240
413 Ga0496109_0038403 3300048912 Bacteria 4329
414 Ga0496110_0063103 3300048913 Bacteria 3273
415 Ga0496110_0237350 3300048913 Bacteria 1659
416 Ga0496112_0506307 3300048915 Bacteria 1143
417 Ga0496112_0748361 3300048915 Bacteria 904
418 Ga0496113_0211684 3300048916 Bacteria 1543
419 Ga0496115_0136960 3300048918 Bacteria 2019
420 Ga0496116_0171870 3300048919 Bacteria 1173
421 Ga0496121_0002040 3300048924 Bacteria 31978
422 Ga0496122_0009972 3300048925 Bacteria 9892
423 Ga0496123_0007161 3300048926 Bacteria 10587
424 Ga0496124_0019330 3300048927 Bacteria 6343
425 Ga0496124_0025313 3300048927 Bacteria 5377
426 Ga0496124_0072512 3300048927 Bacteria 2852
427 Ga0496125_0004828 3300048928 Bacteria 15318
428 Ga0496125_0036346 3300048928 Bacteria 4303
429 Ga0496125_0127786 3300048928 Bacteria 1797
430 Ga0496126_0033919 3300048929 Bacteria 4800
431 Ga0496126_0518415 3300048929 Bacteria 950
432 Ga0495678_001026 3300049459 Bacteria 23707
433 Ga0501300_004933 3300049523 Bacteria 1971
434 Ga0501034_0019739 3300049571 Bacteria 6889
435 Ga0501034_0132793 3300049571 Bacteria 2472
436 Ga0501034_0311610 3300049571 Bacteria 1508
437 Ga0501034_0783681 3300049571 Bacteria 847
438 Ga0501047_0013788 3300049581 Bacteria 7677
439 Ga0501047_0502873 3300049581 Bacteria 1039
440 Ga0501068_0076306 3300049584 Bacteria 2051
441 Ga0501069_0002191 3300049585 Bacteria 9832
442 Ga0501070_0035483 3300049586 Bacteria 4167
443 Ga0501073_0072199 3300049589 Bacteria 2404
444 Ga0501073_0087779 3300049589 Bacteria 2163
445 Ga0501223_000008 3300049663 Bacteria 117828
446 Ga0501246_000753 3300049676 Bacteria 2383
447 Ga0501225_0000046 3300049705 Bacteria 41537
448 Ga0501225_0019747 3300049705 Bacteria 1863
449 Ga0501229_001868 3300049706 Bacteria 2464
450 Ga0501272_001438 3300049769 Bacteria 2256
451 Ga0501044_0118917 3300049823 Bacteria 2645
452 Ga0501044_0456979 3300049823 Bacteria 1183
453 nmdc:mga00v17_95361_c1 3300050491 Bacteria 1873
454 nmdc:mga0yw44_355408_c1 3300050492 Unclassified 987
455 nmdc:mga0k408_35954_c1 3300050493 Bacteria 2841
456 nmdc:mga07m45_487304_c1 3300050496 Bacteria 714
457 nmdc:mga05p37_1438459_c1 3300050507 Bacteria 691
458 nmdc:mga08y16_35_c1 3300050511 Bacteria 157578
459 Ga0495601_0012838 3300053077 Bacteria 5028
460 Ga0495612_0005462 3300053078 Bacteria 5254
461 Ga0495612_0186223 3300053078 Bacteria 913
462 Ga0495619_0123849 3300053085 Bacteria 1773
463 Ga0495619_0135182 3300053085 Bacteria 1696
464 Ga0500578_0000004 3300053086 Bacteria 260037
465 Ga0500643_000078 3300053087 Bacteria 104681
466 Ga0500643_019285 3300053087 Bacteria 2248
467 Ga0500643_031319 3300053087 Bacteria 1623
468 Ga0500644_0010227 3300053088 Bacteria 2533
469 Ga0500641_0031597 3300053096 Bacteria 2089
470 Ga0500562_001202 3300053108 Bacteria 6371
471 Ga0500562_002291 3300053108 Bacteria 4796
472 Ga0500594_0000109 3300053118 Bacteria 24096
473 Ga0500608_000030 3300053122 Bacteria 66677
474 Ga0500559_0003848 3300053136 Bacteria 7262
475 Ga0500568_0001380 3300053139 Bacteria 15752
476 Ga0500604_0000001 3300053151 Bacteria 174619
477 Ga0500616_0000070 3300053153 Bacteria 232610
478 Ga0500622_0001704 3300053156 Bacteria 17055
479 Ga0500622_0057238 3300053156 Bacteria 1994
480 Ga0500587_024849 3300053739 Bacteria 796
481 Ga0590071_010336 3300059421 Bacteria 2187
482 Ga0590075_037595 3300059424 Bacteria 1234
483 Ga0501082_0018071 3300060353 Bacteria 6071
484 Ga0501082_0419661 3300060353 Bacteria 1168
485 Ga0466962_0142505 3300061719 Bacteria 1161
486 Ga0466962_0378169 3300061719 Bacteria 707

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035116 Ga0373945_0200139 Ga0373945_0200139_159_734 159
2 3300035725 Ga0373947_0072836 Ga0373947_0072836_198_773 159
3 3300037068 Ga0373925_0208535 Ga0373925_0208535_388_963 159
4 3300046533 Ga0495640_0103298 Ga0495640_0103298_284_859 159
5 3300047319 Ga0495674_0677042 Ga0495674_0677042_151_726 159
6 3300032005 Ga0307411_10344795 Ga0307411_103447953 162
7 3300035170 Ga0373943_0508143 Ga0373943_0508143_118_693 163
8 3300039438 Ga0436360_1166518 Ga0436360_1166518_133_624 163
9 3300021388 Ga0213875_10007362 Ga0213875_100073622 168
10 3300037853 Ga0436364_0351709 Ga0436364_0351709_4423_4929 168
11 3300013307 Ga0157372_12153002 Ga0157372_121530021 173
12 3300035086 Ga0373934_0079843 Ga0373934_0079843_64_585 173
13 3300035111 Ga0373923_0390765 Ga0373923_0390765_13_534 173
14 3300035117 Ga0373953_0373036 Ga0373953_0373036_90_611 173
15 3300035119 Ga0373956_0088216 Ga0373956_0088216_690_1211 173
16 3300035724 Ga0373933_0054875 Ga0373933_0054875_509_1030 173
17 3300036401 Ga0373937_0033932 Ga0373937_0033932_1356_1877 173
18 3300046477 Ga0495664_0024256 Ga0495664_0024256_207_728 173
19 3300046511 Ga0495608_0030067 Ga0495608_0030067_71_592 173
20 3300046529 Ga0495652_0438879 Ga0495652_0438879_38_559 173
21 3300046536 Ga0495587_0021169 Ga0495587_0021169_1812_2333 173
22 3300046543 Ga0495645_0036582 Ga0495645_0036582_1549_2070 173
23 3300046559 Ga0495667_0060267 Ga0495667_0060267_432_953 173
24 3300046663 Ga0495635_0089065 Ga0495635_0089065_1411_1932 173
25 3300046675 Ga0495657_0070715 Ga0495657_0070715_370_891 173
26 3300046678 Ga0495599_0006314 Ga0495599_0006314_4290_4811 173
27 3300046679 Ga0495623_0345806 Ga0495623_0345806_77_598 173
28 3300046809 Ga0495600_0209641 Ga0495600_0209641_671_1192 173
29 3300047319 Ga0495674_0153881 Ga0495674_0153881_38_559 173
30 3300047322 Ga0495680_0239145 Ga0495680_0239145_649_1170 173
31 3300047444 Ga0495675_0009072 Ga0495675_0009072_2920_3441 173
32 3300047471 Ga0495684_0104179 Ga0495684_0104179_1503_2024 173
33 3300048088 Ga0495602_0044589 Ga0495602_0044589_1783_2304 173
34 3300049571 Ga0501034_0132793 Ga0501034_0132793_751_1368 173
35 3300053077 Ga0495601_0012838 Ga0495601_0012838_3495_4016 173
36 3300053078 Ga0495612_0005462 Ga0495612_0005462_4066_4587 173
37 3300053085 Ga0495619_0123849 Ga0495619_0123849_998_1519 173
38 3300005329 Ga0070683_100150262 Ga0070683_1001502622 174
39 3300005563 Ga0068855_101273253 Ga0068855_1012732532 174
40 3300025944 Ga0207661_10206700 Ga0207661_102067002 174
41 3300032004 Ga0307414_10179156 Ga0307414_101791562 176
42 3300038443 Ga0395901_1103104 Ga0395901_1103104_82_672 177
43 3300005981 Ga0081538_10032951 Ga0081538_100329514 178
44 3300026078 Ga0207702_11193767 Ga0207702_111937672 178
45 3300049585 Ga0501069_0002191 Ga0501069_0002191_5720_6286 178
46 3300049586 Ga0501070_0035483 Ga0501070_0035483_627_1193 178
47 3300060353 Ga0501082_0419661 Ga0501082_0419661_559_1125 178
48 3300025933 Ga0207706_11159884 Ga0207706_111598841 180
49 3300049584 Ga0501068_0076306 Ga0501068_0076306_419_1075 180
50 3300006038 Ga0075365_10131464 Ga0075365_101314643 181
51 3300006051 Ga0075364_10085153 Ga0075364_100851533 181
52 3300009551 Ga0105238_10869305 Ga0105238_108693052 181
53 3300050491 nmdc:mga00v17_95361_c1 nmdc:mga00v17_95361_c1_190_771 181
54 3300050492 nmdc:mga0yw44_355408_c1 nmdc:mga0yw44_355408_c1_333_914 181
55 3300005338 Ga0068868_100000020 Ga0068868_10000002044 182
56 3300005339 Ga0070660_100000567 Ga0070660_10000056710 182
57 3300005366 Ga0070659_100000017 Ga0070659_100000017101 182
58 3300009098 Ga0105245_10088434 Ga0105245_100884345 182
59 3300025919 Ga0207657_10001546 Ga0207657_1000154610 182
60 3300025927 Ga0207687_10044674 Ga0207687_100446745 182
61 3300025932 Ga0207690_10000035 Ga0207690_10000035105 182
62 3300026023 Ga0207677_10000071 Ga0207677_1000007116 182
63 3300005328 Ga0070676_10301428 Ga0070676_103014282 184
64 3300005330 Ga0070690_100162446 Ga0070690_1001624462 184
65 3300005336 Ga0070680_100292487 Ga0070680_1002924872 184
66 3300005339 Ga0070660_100704604 Ga0070660_1007046041 184
67 3300005344 Ga0070661_100111798 Ga0070661_1001117982 184
68 3300005353 Ga0070669_100277633 Ga0070669_1002776332 184
69 3300005354 Ga0070675_100088998 Ga0070675_1000889984 184
70 3300005365 Ga0070688_100081070 Ga0070688_1000810703 184
71 3300005366 Ga0070659_101050401 Ga0070659_1010504012 184
72 3300005456 Ga0070678_100210785 Ga0070678_1002107852 184
73 3300005535 Ga0070684_100031471 Ga0070684_1000314715 184
74 3300005539 Ga0068853_100683020 Ga0068853_1006830202 184
75 3300005563 Ga0068855_101473605 Ga0068855_1014736052 184
76 3300005577 Ga0068857_100230256 Ga0068857_1002302561 184
77 3300005614 Ga0068856_100048633 Ga0068856_1000486336 184
78 3300005616 Ga0068852_100033251 Ga0068852_1000332516 184
79 3300005840 Ga0068870_10203854 Ga0068870_102038542 184
80 3300006881 Ga0068865_100676478 Ga0068865_1006764782 184
81 3300009148 Ga0105243_10677125 Ga0105243_106771252 184
82 3300009176 Ga0105242_10990116 Ga0105242_109901161 184
83 3300009177 Ga0105248_11892277 Ga0105248_118922771 184
84 3300010375 Ga0105239_10063498 Ga0105239_100634984 184
85 3300013102 Ga0157371_10109325 Ga0157371_101093254 184
86 3300013104 Ga0157370_10263948 Ga0157370_102639483 184
87 3300013105 Ga0157369_10037786 Ga0157369_100377866 184
88 3300013308 Ga0157375_10371145 Ga0157375_103711452 184
89 3300014969 Ga0157376_10028710 Ga0157376_100287104 184
90 3300017792 Ga0163161_10311554 Ga0163161_103115542 184
91 3300025907 Ga0207645_10221544 Ga0207645_102215442 184
92 3300025923 Ga0207681_10109631 Ga0207681_101096313 184
93 3300025924 Ga0207694_10189128 Ga0207694_101891282 184
94 3300025931 Ga0207644_10174383 Ga0207644_101743832 184
95 3300025935 Ga0207709_10242697 Ga0207709_102426972 184
96 3300025940 Ga0207691_10221866 Ga0207691_102218662 184
97 3300025949 Ga0207667_10147441 Ga0207667_101474415 184
98 3300025949 Ga0207667_10364687 Ga0207667_103646872 184
99 3300025960 Ga0207651_10268145 Ga0207651_102681452 184
100 3300026035 Ga0207703_10669502 Ga0207703_106695022 184
101 3300026041 Ga0207639_11259315 Ga0207639_112593151 184
102 3300026078 Ga0207702_10003692 Ga0207702_1000369218 184
103 3300026116 Ga0207674_10349763 Ga0207674_103497633 184
104 3300026121 Ga0207683_10115146 Ga0207683_101151463 184
105 3300026142 Ga0207698_10074915 Ga0207698_100749152 184
106 3300028800 Ga0265338_10106774 Ga0265338_101067741 184
107 3300035695 Ga0373927_0406876 Ga0373927_0406876_194_748 184
108 3300037068 Ga0373925_0127412 Ga0373925_0127412_504_1058 184
109 3300037312 Ga0395899_0014457 Ga0395899_0014457_1650_2204 184
110 3300037418 Ga0395900_0030524 Ga0395900_0030524_1452_2006 184
111 3300037466 Ga0395898_0040971 Ga0395898_0040971_1263_1817 184
112 3300037471 Ga0395905_0228053 Ga0395905_0228053_93_647 184
113 3300038443 Ga0395901_0088078 Ga0395901_0088078_861_1415 184
114 3300038443 Ga0395901_0230303 Ga0395901_0230303_646_1200 184
115 3300044694 Ga0466963_0041585 Ga0466963_0041585_1706_2260 184
116 3300044842 Ga0466957_0016054 Ga0466957_0016054_523_1077 184
117 3300045976 Ga0466967_0021905 Ga0466967_0021905_3664_4218 184
118 3300046691 Ga0495670_0118029 Ga0495670_0118029_632_1204 184
119 3300047317 Ga0495604_0496010 Ga0495604_0496010_112_666 184
120 3300048915 Ga0496112_0748361 Ga0496112_0748361_202_756 184
121 3300049523 Ga0501300_004933 Ga0501300_004933_1347_1949 184
122 3300049571 Ga0501034_0019739 Ga0501034_0019739_3396_3950 184
123 3300049706 Ga0501229_001868 Ga0501229_001868_746_1348 184
124 3300049769 Ga0501272_001438 Ga0501272_001438_689_1291 184
125 3300053087 Ga0500643_000078 Ga0500643_000078_19142_19714 184
126 3300061719 Ga0466962_0142505 Ga0466962_0142505_591_1145 184
127 3300009176 Ga0105242_10531227 Ga0105242_105312272 185
128 3300013297 Ga0157378_10312610 Ga0157378_103126102 185
129 3300025254 Ga0209148_1001566 Ga0209148_100156614 185
130 3300025272 Ga0209455_1001154 Ga0209455_10011547 185
131 3300025923 Ga0207681_11076794 Ga0207681_110767941 185
132 3300026142 Ga0207698_10291383 Ga0207698_102913832 185
133 3300049589 Ga0501073_0087779 Ga0501073_0087779_971_1576 185
134 3300050507 nmdc:mga05p37_1438459_c1 nmdc:mga05p37_1438459_c1_108_665 185
135 3300003322 rootL2_10314575 rootL2_103145752 186
136 3300005343 Ga0070687_100268287 Ga0070687_1002682872 186
137 3300005539 Ga0068853_100036479 Ga0068853_1000364794 186
138 3300005549 Ga0070704_100437436 Ga0070704_1004374362 186
139 3300005842 Ga0068858_100380184 Ga0068858_1003801842 186
140 3300005843 Ga0068860_100328464 Ga0068860_1003284642 186
141 3300005844 Ga0068862_100140226 Ga0068862_1001402262 186
142 3300005937 Ga0081455_10139756 Ga0081455_101397564 186
143 3300006177 Ga0075362_10128066 Ga0075362_101280663 186
144 3300009174 Ga0105241_10258466 Ga0105241_102584661 186
145 3300009176 Ga0105242_10180480 Ga0105242_101804802 186
146 3300014968 Ga0157379_11076381 Ga0157379_110763811 186
147 3300025934 Ga0207686_10102679 Ga0207686_101026792 186
148 3300025942 Ga0207689_10367284 Ga0207689_103672842 186
149 3300026035 Ga0207703_10420607 Ga0207703_104206071 186
150 3300026041 Ga0207639_10013130 Ga0207639_100131305 186
151 3300026116 Ga0207674_10598668 Ga0207674_105986682 186
152 3300028380 Ga0268265_10110045 Ga0268265_101100452 186
153 3300028381 Ga0268264_10290378 Ga0268264_102903782 186
154 3300048918 Ga0496115_0136960 Ga0496115_0136960_644_1204 186
155 iso_pu_bacteria 2512564014 2512645070 186
156 iso_pu_bacteria 2775507255 2778125790 186
157 iso_pu_bacteria 2919709256 2919711239 186
158 3300003763 Ga0055529_1013820 Ga0055529_10138202 187
159 3300005327 Ga0070658_10017623 Ga0070658_100176237 187
160 3300005327 Ga0070658_10104631 Ga0070658_101046314 187
161 3300005339 Ga0070660_100007313 Ga0070660_1000073135 187
162 3300005344 Ga0070661_100004250 Ga0070661_1000042505 187
163 3300005366 Ga0070659_100012507 Ga0070659_1000125076 187
164 3300005435 Ga0070714_100018613 Ga0070714_1000186135 187
165 3300005436 Ga0070713_101048341 Ga0070713_1010483411 187
166 3300005455 Ga0070663_100212549 Ga0070663_1002125492 187
167 3300005458 Ga0070681_10014645 Ga0070681_100146452 187
168 3300005530 Ga0070679_100049104 Ga0070679_1000491046 187
169 3300005539 Ga0068853_100008824 Ga0068853_1000088246 187
170 3300005563 Ga0068855_100005356 Ga0068855_10000535610 187
171 3300005564 Ga0070664_100000563 Ga0070664_10000056318 187
172 3300005577 Ga0068857_100002279 Ga0068857_1000022794 187
173 3300005614 Ga0068856_100004757 Ga0068856_1000047579 187
174 3300005616 Ga0068852_100003269 Ga0068852_1000032692 187
175 3300005834 Ga0068851_10011715 Ga0068851_100117155 187
176 3300005937 Ga0081455_10144006 Ga0081455_101440062 187
177 3300009093 Ga0105240_10001484 Ga0105240_1000148432 187
178 3300009174 Ga0105241_10064296 Ga0105241_100642964 187
179 3300009551 Ga0105238_10007836 Ga0105238_1000783610 187
180 3300013100 Ga0157373_10030058 Ga0157373_100300582 187
181 3300013104 Ga0157370_10263161 Ga0157370_102631611 187
182 3300013105 Ga0157369_10005068 Ga0157369_1000506811 187
183 3300013307 Ga0157372_10005517 Ga0157372_1000551710 187
184 3300014497 Ga0182008_10056310 Ga0182008_100563101 187
185 3300025321 Ga0207656_10013188 Ga0207656_100131885 187
186 3300025909 Ga0207705_10069782 Ga0207705_100697821 187
187 3300025911 Ga0207654_10072813 Ga0207654_100728133 187
188 3300025912 Ga0207707_10356000 Ga0207707_103560002 187
189 3300025913 Ga0207695_10011192 Ga0207695_100111924 187
190 3300025919 Ga0207657_10011306 Ga0207657_1001130610 187
191 3300025920 Ga0207649_10013560 Ga0207649_100135605 187
192 3300025921 Ga0207652_10050287 Ga0207652_100502873 187
193 3300025924 Ga0207694_10001424 Ga0207694_1000142421 187
194 3300025929 Ga0207664_10023189 Ga0207664_100231895 187
195 3300025932 Ga0207690_10057213 Ga0207690_100572135 187
196 3300025945 Ga0207679_10008926 Ga0207679_100089263 187
197 3300025949 Ga0207667_10005999 Ga0207667_1000599911 187
198 3300025981 Ga0207640_10058917 Ga0207640_100589171 187
199 3300026041 Ga0207639_10032204 Ga0207639_100322045 187
200 3300026067 Ga0207678_10234638 Ga0207678_102346382 187
201 3300026078 Ga0207702_10014826 Ga0207702_100148264 187
202 3300026116 Ga0207674_10000053 Ga0207674_1000005382 187
203 3300026142 Ga0207698_10007275 Ga0207698_100072757 187
204 3300049581 Ga0501047_0013788 Ga0501047_0013788_4718_5281 187
205 3300049581 Ga0501047_0502873 Ga0501047_0502873_124_774 187
206 3300049589 Ga0501073_0072199 Ga0501073_0072199_1706_2290 187
207 3300049823 Ga0501044_0456979 Ga0501044_0456979_172_822 187
208 3300053096 Ga0500641_0031597 Ga0500641_0031597_367_930 187
209 3300060353 Ga0501082_0018071 Ga0501082_0018071_4840_5424 187
210 3300003316 rootH1_10103122 rootH1_101031221 188
211 3300003781 Ga0055536_1010582 Ga0055536_10105822 188
212 3300003791 Ga0055530_10004289 Ga0055530_100042899 188
213 3300003791 Ga0055530_10009753 Ga0055530_100097532 188
214 3300003794 Ga0055531_10004154 Ga0055531_1000415410 188
215 3300005334 Ga0068869_100985720 Ga0068869_1009857201 188
216 3300005344 Ga0070661_100000003 Ga0070661_10000000312 188
217 3300005345 Ga0070692_10000239 Ga0070692_100002394 188
218 3300005347 Ga0070668_100385830 Ga0070668_1003858301 188
219 3300005354 Ga0070675_100013425 Ga0070675_1000134254 188
220 3300005435 Ga0070714_100049547 Ga0070714_1000495473 188
221 3300005436 Ga0070713_100078371 Ga0070713_1000783714 188
222 3300005437 Ga0070710_10123373 Ga0070710_101233731 188
223 3300005439 Ga0070711_100055689 Ga0070711_1000556893 188
224 3300005543 Ga0070672_100149828 Ga0070672_1001498283 188
225 3300005548 Ga0070665_100124205 Ga0070665_1001242054 188
226 3300005616 Ga0068852_100083796 Ga0068852_1000837963 188
227 3300006186 Ga0075369_10046071 Ga0075369_100460714 188
228 3300013296 Ga0157374_10476176 Ga0157374_104761762 188
229 3300017792 Ga0163161_10228117 Ga0163161_102281172 188
230 3300020081 Ga0206354_10571180 Ga0206354_105711803 188
231 3300020082 Ga0206353_10114243 Ga0206353_101142433 188
232 3300025292 Ga0209676_1000243 Ga0209676_100024335 188
233 3300025292 Ga0209676_1001364 Ga0209676_100136416 188
234 3300025298 Ga0209050_1000244 Ga0209050_100024435 188
235 3300025298 Ga0209050_1001551 Ga0209050_100155115 188
236 3300025299 Ga0209256_1015389 Ga0209256_10153894 188
237 3300025303 Ga0209051_1007439 Ga0209051_10074393 188
238 3300025304 Ga0209257_1000140 Ga0209257_100014089 188
239 3300025304 Ga0209257_1033032 Ga0209257_10330322 188
240 3300025898 Ga0207692_10091514 Ga0207692_100915142 188
241 3300025906 Ga0207699_10033715 Ga0207699_100337154 188
242 3300025920 Ga0207649_10000027 Ga0207649_1000002765 188
243 3300025926 Ga0207659_10003798 Ga0207659_100037986 188
244 3300025929 Ga0207664_10433876 Ga0207664_104338763 188
245 3300025944 Ga0207661_10087963 Ga0207661_100879633 188
246 3300026041 Ga0207639_10020975 Ga0207639_100209752 188
247 3300026142 Ga0207698_10595607 Ga0207698_105956072 188
248 3300028800 Ga0265338_10372959 Ga0265338_103729592 188
249 3300031731 Ga0307405_10928640 Ga0307405_109286402 188
250 3300031995 Ga0307409_101018679 Ga0307409_1010186791 188
251 3300032002 Ga0307416_101164776 Ga0307416_1011647762 188
252 3300032004 Ga0307414_10374754 Ga0307414_103747541 188
253 3300032126 Ga0307415_100383883 Ga0307415_1003838832 188
254 3300035111 Ga0373923_0007488 Ga0373923_0007488_1392_1967 188
255 3300035113 Ga0373936_0068954 Ga0373936_0068954_650_1225 188
256 3300035117 Ga0373953_0100950 Ga0373953_0100950_253_828 188
257 3300035118 Ga0373954_0195921 Ga0373954_0195921_144_719 188
258 3300035119 Ga0373956_0029317 Ga0373956_0029317_256_831 188
259 3300035410 Ga0373924_0044729 Ga0373924_0044729_886_1461 188
260 3300035724 Ga0373933_0032853 Ga0373933_0032853_1361_1936 188
261 3300036401 Ga0373937_0018996 Ga0373937_0018996_3379_3954 188
262 3300037068 Ga0373925_0108098 Ga0373925_0108098_1352_1927 188
263 3300039437 Ga0436365_1142461 Ga0436365_1142461_262_828 188
264 3300046462 Ga0495651_0016247 Ga0495651_0016247_1638_2213 188
265 3300046476 Ga0495662_0278388 Ga0495662_0278388_67_642 188
266 3300046511 Ga0495608_0095061 Ga0495608_0095061_1314_1889 188
267 3300046522 Ga0495643_0219444 Ga0495643_0219444_248_829 188
268 3300046529 Ga0495652_0116448 Ga0495652_0116448_1040_1612 188
269 3300046542 Ga0495597_0014687 Ga0495597_0014687_2498_3079 188
270 3300046559 Ga0495667_0035038 Ga0495667_0035038_1287_1862 188
271 3300046689 Ga0495613_0002574 Ga0495613_0002574_6934_7506 188
272 3300047317 Ga0495604_0095896 Ga0495604_0095896_95_670 188
273 3300047322 Ga0495680_0467800 Ga0495680_0467800_145_720 188
274 3300047444 Ga0495675_0298456 Ga0495675_0298456_222_797 188
275 3300048088 Ga0495602_0337395 Ga0495602_0337395_396_971 188
276 3300048909 Ga0496106_0336944 Ga0496106_0336944_404_997 188
277 3300048910 Ga0496107_0051128 Ga0496107_0051128_1240_1833 188
278 3300048927 Ga0496124_0019330 Ga0496124_0019330_1828_2409 188
279 3300049571 Ga0501034_0783681 Ga0501034_0783681_121_687 188
280 3300050493 nmdc:mga0k408_35954_c1 nmdc:mga0k408_35954_c1_2048_2629 188
281 3300050496 nmdc:mga07m45_487304_c1 nmdc:mga07m45_487304_c1_91_672 188
282 3300053078 Ga0495612_0186223 Ga0495612_0186223_202_777 188
283 3300053085 Ga0495619_0135182 Ga0495619_0135182_1064_1639 188
284 3300053087 Ga0500643_031319 Ga0500643_031319_984_1571 188
285 3300053122 Ga0500608_000030 Ga0500608_000030_61668_62276 188
286 3300053136 Ga0500559_0003848 Ga0500559_0003848_3864_4472 188
287 3300053139 Ga0500568_0001380 Ga0500568_0001380_4681_5247 188
288 3300053151 Ga0500604_0000001 Ga0500604_0000001_159724_160290 188
289 3300053153 Ga0500616_0000070 Ga0500616_0000070_215432_215998 188
290 3300053739 Ga0500587_024849 Ga0500587_024849_92_658 188
291 iso_pu_bacteria 2643221640 2644224591 188
292 iso_pu_bacteria 2643221642 2644234474 188
293 iso_pu_bacteria 2857504554 2857504850 188
294 3300005518 Ga0070699_100087578 Ga0070699_1000875781 189
295 3300005546 Ga0070696_100022243 Ga0070696_1000222435 189
296 3300006852 Ga0075433_10183812 Ga0075433_101838122 189
297 3300009093 Ga0105240_10365567 Ga0105240_103655672 189
298 3300009094 Ga0111539_10028255 Ga0111539_100282553 189
299 3300009147 Ga0114129_10204402 Ga0114129_102044023 189
300 3300009147 Ga0114129_10709329 Ga0114129_107093292 189
301 3300009551 Ga0105238_10480091 Ga0105238_104800912 189
302 3300014326 Ga0157380_10009778 Ga0157380_100097785 189
303 3300026118 Ga0207675_100014967 Ga0207675_1000149674 189
304 3300027907 Ga0207428_10000208 Ga0207428_100002085 189
305 3300028380 Ga0268265_10245555 Ga0268265_102455553 189
306 3300028794 Ga0307515_10045998 Ga0307515_100459988 189
307 3300031824 Ga0307413_10029578 Ga0307413_100295782 189
308 3300031995 Ga0307409_100006166 Ga0307409_1000061665 189
309 3300032002 Ga0307416_100795163 Ga0307416_1007951632 189
310 3300032005 Ga0307411_10124102 Ga0307411_101241022 189
311 3300032126 Ga0307415_100379456 Ga0307415_1003794562 189
312 3300038443 Ga0395901_1099174 Ga0395901_1099174_47_640 189
313 3300046457 Ga0495590_0006148 Ga0495590_0006148_659_1255 189
314 3300046512 Ga0495610_0001911 Ga0495610_0001911_17202_17798 189
315 3300046518 Ga0495631_0006778 Ga0495631_0006778_2670_3269 189
316 3300046520 Ga0495637_0059996 Ga0495637_0059996_600_1199 189
317 3300046616 Ga0495668_0031091 Ga0495668_0031091_1998_2594 189
318 3300047472 Ga0495686_0003559 Ga0495686_0003559_12645_13244 189
319 3300048928 Ga0496125_0127786 Ga0496125_0127786_821_1441 189
320 3300048929 Ga0496126_0518415 Ga0496126_0518415_215_835 189
321 3300049459 Ga0495678_001026 Ga0495678_001026_15979_16575 189
322 3300050511 nmdc:mga08y16_35_c1 nmdc:mga08y16_35_c1_154996_155589 189
323 3300053086 Ga0500578_0000004 Ga0500578_0000004_25246_25842 189
324 3300053088 Ga0500644_0010227 Ga0500644_0010227_853_1452 189
325 3300053108 Ga0500562_002291 Ga0500562_002291_3115_3711 189
326 3300053118 Ga0500594_0000109 Ga0500594_0000109_146_742 189
327 3300053156 Ga0500622_0001704 Ga0500622_0001704_2632_3231 189
328 3300059421 Ga0590071_010336 Ga0590071_010336_373_966 189
329 3300059424 Ga0590075_037595 Ga0590075_037595_147_740 189
330 iso_pu_bacteria 2791355048 2792461092 189
331 iso_pu_bacteria 2843744320 2843749377 189
332 iso_pu_bacteria 2849560528 2849562648 189
333 iso_pu_bacteria 2849573788 2849576963 189
334 iso_pu_bacteria 2851153111 2851156073 189
335 iso_pu_bacteria 2928531327 2928532898 189
336 3300001915 JGI24741J21665_1001634 JGI24741J21665_10016342 190
337 3300001979 JGI24740J21852_10008431 JGI24740J21852_100084314 190
338 3300001989 JGI24739J22299_10013084 JGI24739J22299_100130842 190
339 3300001990 JGI24737J22298_10001465 JGI24737J22298_100014658 190
340 3300002067 JGI24735J21928_10001446 JGI24735J21928_100014462 190
341 3300005327 Ga0070658_10374550 Ga0070658_103745502 190
342 3300005336 Ga0070680_100270310 Ga0070680_1002703102 190
343 3300005344 Ga0070661_100069184 Ga0070661_1000691842 190
344 3300005347 Ga0070668_100118592 Ga0070668_1001185923 190
345 3300005353 Ga0070669_100256703 Ga0070669_1002567032 190
346 3300005353 Ga0070669_100257865 Ga0070669_1002578652 190
347 3300005355 Ga0070671_100256929 Ga0070671_1002569292 190
348 3300005364 Ga0070673_100449758 Ga0070673_1004497582 190
349 3300005367 Ga0070667_100488585 Ga0070667_1004885852 190
350 3300005435 Ga0070714_100163889 Ga0070714_1001638892 190
351 3300005436 Ga0070713_100281729 Ga0070713_1002817293 190
352 3300005437 Ga0070710_10127750 Ga0070710_101277502 190
353 3300005445 Ga0070708_100385287 Ga0070708_1003852872 190
354 3300005455 Ga0070663_100012402 Ga0070663_1000124025 190
355 3300005548 Ga0070665_100124502 Ga0070665_1001245021 190
356 3300005564 Ga0070664_100083231 Ga0070664_1000832313 190
357 3300005564 Ga0070664_100226662 Ga0070664_1002266622 190
358 3300005577 Ga0068857_100676244 Ga0068857_1006762442 190
359 3300005614 Ga0068856_100430051 Ga0068856_1004300512 190
360 3300005618 Ga0068864_100049637 Ga0068864_1000496375 190
361 3300005841 Ga0068863_100362810 Ga0068863_1003628103 190
362 3300006028 Ga0070717_10446966 Ga0070717_104469661 190
363 3300006173 Ga0070716_100136574 Ga0070716_1001365742 190
364 3300006353 Ga0075370_10007752 Ga0075370_100077522 190
365 3300009011 Ga0105251_10003145 Ga0105251_100031459 190
366 3300009092 Ga0105250_10108305 Ga0105250_101083051 190
367 3300009093 Ga0105240_10238459 Ga0105240_102384593 190
368 3300009174 Ga0105241_10037937 Ga0105241_100379374 190
369 3300009177 Ga0105248_10065793 Ga0105248_100657936 190
370 3300009545 Ga0105237_10010720 Ga0105237_100107205 190
371 3300010375 Ga0105239_10536770 Ga0105239_105367702 190
372 3300010375 Ga0105239_11832096 Ga0105239_118320962 190
373 3300013100 Ga0157373_10175019 Ga0157373_101750192 190
374 3300013104 Ga0157370_10008878 Ga0157370_1000887811 190
375 3300013104 Ga0157370_10467583 Ga0157370_104675832 190
376 3300013296 Ga0157374_10668299 Ga0157374_106682992 190
377 3300014325 Ga0163163_10062375 Ga0163163_100623755 190
378 3300017792 Ga0163161_10414479 Ga0163161_104144792 190
379 3300021361 Ga0213872_10013257 Ga0213872_100132572 190
380 3300021361 Ga0213872_10028746 Ga0213872_100287462 190
381 3300025735 Ga0207713_1024953 Ga0207713_10249532 190
382 3300025898 Ga0207692_10233576 Ga0207692_102335762 190
383 3300025904 Ga0207647_10009795 Ga0207647_100097957 190
384 3300025906 Ga0207699_10234911 Ga0207699_102349112 190
385 3300025909 Ga0207705_10179691 Ga0207705_101796912 190
386 3300025909 Ga0207705_10191496 Ga0207705_101914962 190
387 3300025911 Ga0207654_10016559 Ga0207654_100165592 190
388 3300025912 Ga0207707_10443838 Ga0207707_104438382 190
389 3300025913 Ga0207695_10064545 Ga0207695_100645455 190
390 3300025914 Ga0207671_10008001 Ga0207671_1000800113 190
391 3300025914 Ga0207671_10410931 Ga0207671_104109312 190
392 3300025915 Ga0207693_10003277 Ga0207693_1000327710 190
393 3300025916 Ga0207663_10017893 Ga0207663_100178932 190
394 3300025919 Ga0207657_10064057 Ga0207657_100640572 190
395 3300025920 Ga0207649_10022394 Ga0207649_100223943 190
396 3300025920 Ga0207649_10689543 Ga0207649_106895431 190
397 3300025925 Ga0207650_10165711 Ga0207650_101657112 190
398 3300025928 Ga0207700_10171922 Ga0207700_101719221 190
399 3300025929 Ga0207664_10058674 Ga0207664_100586742 190
400 3300025932 Ga0207690_10306496 Ga0207690_103064963 190
401 3300025933 Ga0207706_10010045 Ga0207706_100100459 190
402 3300025941 Ga0207711_10276624 Ga0207711_102766243 190
403 3300025945 Ga0207679_10366122 Ga0207679_103661222 190
404 3300025960 Ga0207651_10232052 Ga0207651_102320522 190
405 3300025961 Ga0207712_10101875 Ga0207712_101018752 190
406 3300026041 Ga0207639_10001044 Ga0207639_1000104412 190
407 3300026067 Ga0207678_10008945 Ga0207678_100089452 190
408 3300026078 Ga0207702_10005099 Ga0207702_100050992 190
409 3300026088 Ga0207641_10507707 Ga0207641_105077072 190
410 3300026088 Ga0207641_10881642 Ga0207641_108816422 190
411 3300026089 Ga0207648_10995945 Ga0207648_109959451 190
412 3300026095 Ga0207676_10125694 Ga0207676_101256942 190
413 3300026121 Ga0207683_10883269 Ga0207683_108832692 190
414 3300026142 Ga0207698_10000279 Ga0207698_100002793 190
415 3300027866 Ga0209813_10000240 Ga0209813_1000024011 190
416 3300028379 Ga0268266_10022326 Ga0268266_100223268 190
417 3300028577 Ga0265318_10042759 Ga0265318_100427592 190
418 3300031250 Ga0265331_10000641 Ga0265331_1000064128 190
419 3300031548 Ga0307408_100165099 Ga0307408_1001650991 190
420 3300031595 Ga0265313_10110726 Ga0265313_101107262 190
421 3300031711 Ga0265314_10384477 Ga0265314_103844772 190
422 3300031911 Ga0307412_10000991 Ga0307412_1000099118 190
423 3300032002 Ga0307416_100283338 Ga0307416_1002833383 190
424 3300032004 Ga0307414_10690160 Ga0307414_106901602 190
425 3300039438 Ga0436360_0394921 Ga0436360_0394921_2420_3010 190
426 3300039447 Ga0436361_0558812 Ga0436361_0558812_517_1110 190
427 3300039447 Ga0436361_0796148 Ga0436361_0796148_505_1101 190
428 3300039447 Ga0436361_0807596 Ga0436361_0807596_1314_1907 190
429 3300039447 Ga0436361_1115951 Ga0436361_1115951_1538_2119 190
430 3300044719 Ga0466971_0160381 Ga0466971_0160381_399_977 190
431 3300045836 Ga0466958_0002177 Ga0466958_0002177_1478_2056 190
432 3300046452 Ga0495617_001529 Ga0495617_001529_2103_2678 190
433 3300046453 Ga0495627_000225 Ga0495627_000225_22435_23010 190
434 3300046453 Ga0495627_000324 Ga0495627_000324_20894_21466 190
435 3300046460 Ga0495638_0000012 Ga0495638_0000012_112029_112628 190
436 3300046471 Ga0495650_0003357 Ga0495650_0003357_8933_9505 190
437 3300046474 Ga0495605_0238071 Ga0495605_0238071_171_761 190
438 3300046491 Ga0495584_0062213 Ga0495584_0062213_525_1100 190
439 3300046506 Ga0495583_0001198 Ga0495583_0001198_14046_14645 190
440 3300046512 Ga0495610_0000085 Ga0495610_0000085_2469_3044 190
441 3300046512 Ga0495610_0084972 Ga0495610_0084972_138_710 190
442 3300046518 Ga0495631_0144026 Ga0495631_0144026_301_876 190
443 3300046519 Ga0495632_0000013 Ga0495632_0000013_142287_142862 190
444 3300046519 Ga0495632_0000612 Ga0495632_0000612_7130_7729 190
445 3300046520 Ga0495637_0000100 Ga0495637_0000100_25856_26431 190
446 3300046520 Ga0495637_0004041 Ga0495637_0004041_6826_7401 190
447 3300046522 Ga0495643_0000010 Ga0495643_0000010_280716_281291 190
448 3300046524 Ga0495648_0000038 Ga0495648_0000038_78985_79584 190
449 3300046524 Ga0495648_0000933 Ga0495648_0000933_15963_16535 190
450 3300046524 Ga0495648_0013969 Ga0495648_0013969_4022_4594 190
451 3300046525 Ga0495663_0000004 Ga0495663_0000004_249551_250126 190
452 3300046528 Ga0495642_0051532 Ga0495642_0051532_146_733 190
453 3300046528 Ga0495642_0136290 Ga0495642_0136290_169_759 190
454 3300046542 Ga0495597_0030655 Ga0495597_0030655_14_604 190
455 3300046558 Ga0495633_0000092 Ga0495633_0000092_117955_118527 190
456 3300046558 Ga0495633_0001757 Ga0495633_0001757_1309_1884 190
457 3300046558 Ga0495633_0005139 Ga0495633_0005139_2156_2755 190
458 3300046558 Ga0495633_0024664 Ga0495633_0024664_1398_1973 190
459 3300046684 Ga0495669_0000042 Ga0495669_0000042_78638_79228 190
460 3300046684 Ga0495669_0321320 Ga0495669_0321320_23_610 190
461 3300046692 Ga0495671_0000014 Ga0495671_0000014_280716_281291 190
462 3300046692 Ga0495671_0000034 Ga0495671_0000034_78407_79006 190
463 3300046692 Ga0495671_0044633 Ga0495671_0044633_1285_1860 190
464 3300047320 Ga0495672_0019590 Ga0495672_0019590_3022_3609 190
465 3300047445 Ga0495677_0152105 Ga0495677_0152105_260_847 190
466 3300047469 Ga0495673_0000013 Ga0495673_0000013_151108_151707 190
467 3300047469 Ga0495673_0008628 Ga0495673_0008628_2913_3485 190
468 3300047470 Ga0495681_0000013 Ga0495681_0000013_5512_6087 190
469 3300047470 Ga0495681_0000725 Ga0495681_0000725_8463_9038 190
470 3300047472 Ga0495686_0043333 Ga0495686_0043333_536_1111 190
471 3300047472 Ga0495686_0084335 Ga0495686_0084335_1207_1779 190
472 3300048906 Ga0496103_0264954 Ga0496103_0264954_174_761 190
473 3300048911 Ga0496108_0003651 Ga0496108_0003651_7901_8473 190
474 3300048911 Ga0496108_0121547 Ga0496108_0121547_1637_2224 190
475 3300048912 Ga0496109_0038403 Ga0496109_0038403_2760_3347 190
476 3300048913 Ga0496110_0063103 Ga0496110_0063103_1307_1879 190
477 3300048913 Ga0496110_0237350 Ga0496110_0237350_702_1289 190
478 3300048915 Ga0496112_0506307 Ga0496112_0506307_421_993 190
479 3300048916 Ga0496113_0211684 Ga0496113_0211684_736_1323 190
480 3300048919 Ga0496116_0171870 Ga0496116_0171870_488_1060 190
481 3300048924 Ga0496121_0002040 Ga0496121_0002040_21106_21678 190
482 3300048925 Ga0496122_0009972 Ga0496122_0009972_7006_7578 190
483 3300048926 Ga0496123_0007161 Ga0496123_0007161_8820_9392 190
484 3300048927 Ga0496124_0025313 Ga0496124_0025313_2676_3248 190
485 3300048927 Ga0496124_0072512 Ga0496124_0072512_920_1492 190
486 3300048928 Ga0496125_0004828 Ga0496125_0004828_530_1102 190
487 3300048928 Ga0496125_0036346 Ga0496125_0036346_1697_2269 190
488 3300048929 Ga0496126_0033919 Ga0496126_0033919_3828_4400 190
489 3300049571 Ga0501034_0311610 Ga0501034_0311610_49_627 190
490 3300049663 Ga0501223_000008 Ga0501223_000008_31549_32121 190
491 3300049676 Ga0501246_000753 Ga0501246_000753_843_1415 190
492 3300049705 Ga0501225_0000046 Ga0501225_0000046_29851_30423 190
493 3300049705 Ga0501225_0019747 Ga0501225_0019747_447_1019 190
494 3300049823 Ga0501044_0118917 Ga0501044_0118917_1392_1973 190
495 3300053087 Ga0500643_019285 Ga0500643_019285_745_1320 190
496 3300053108 Ga0500562_001202 Ga0500562_001202_622_1209 190
497 3300053156 Ga0500622_0057238 Ga0500622_0057238_699_1280 190
498 3300061719 Ga0466962_0378169 Ga0466962_0378169_99_677 190
499 iso_pu_bacteria 2522572158 2523105851 190
500 iso_pu_bacteria 2597490356 2599104485 190
501 iso_pu_bacteria 2846952575 2846956798 190
502 iso_pu_bacteria 2848858292 2848862481 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02545

Maf

Maf-like protein

33

216

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4heb-assembly1.cif.gz_A the crystal structure of maf protein of bacillus subtilis 0.9695 1 184
1exc-assembly1.cif.gz_A crystal structure of b. subtilis maf protein complexed with d-(utp) 0.9643 2 184
4heb-assembly1.cif.gz_A the crystal structure of maf protein of bacillus subtilis 0.9592 1 184
4heb-assembly1.cif.gz_B the crystal structure of maf protein of bacillus subtilis 0.956 2 188
4lu1-assembly1.cif.gz_B crystal structure of the uncharacterized maf protein ycef from e. coli, mutant d69a 0.9439 2 187
ID Description Score Start End Superfamily
4hebA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9695 1 184 3.90.950.10
4hebA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9592 1 184 3.90.950.10
4lu1B00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9439 2 187 3.90.950.10
4p0uA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9386 3 188 3.90.950.10
4p0uA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9289 3 188 3.90.950.10
ID Description Score Start End GO Terms
AF-A5VDT8-F1-model_v4 deleted 0.9954 3 190
AF-A0A7L9RSW7-F1-model_v4 Nucleoside triphosphate pyrophosphatase (EC 3.6.1.9) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.9933 2 187 GO:0005737
GO:0009117
GO:0047429
AF-A0A838VA29-F1-model_v4 dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.9932 2 190 GO:0005737
GO:0009117
GO:0047429
AF-A0A843RJH7-F1-model_v4 dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.9923 2 188 GO:0005737
GO:0009117
GO:0047429
AF-A0A1Z8Q2P4-F1-model_v4 dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.9918 2 187 GO:0005737
GO:0009117
GO:0036218
GO:0036221
GO:0106379

Feature Viewer

pLDDT pTM Quality
96.5 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map