F455792
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 502 | 324 | 486 | 191 |
Family's Representative Sequence
| Representative Sequence | 3300003763|Ga0055529_1013820|Ga0055529_10138202 |
| Length | 220 |
| Sequence | MALRHPSTTMSSSAEATLAGSTSGTIEAAVRPAVVLASASPRRLDLLRQIGLEPDRVDPPEIDESHARTELPRAYARRMAEEKLAVAAARHPGAVVIAADTVVACGRRILPKAETEQQARACLKLLNGRRHQVWGGIAVALADGRQISRLVETDVILKRLEPAEIDRYIASGEWHGKAGGYAIQGRAAAFIRSIAGSYSNVVGLSLSDLAAMLHGSGVVW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 2 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 3 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 4 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 5 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 6 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 7 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 8 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 9 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 10 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 11 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 12 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 13 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 14 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 15 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 16 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 17 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 18 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 19 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 20 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 21 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 22 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 116 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 117 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 183 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 203 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 204 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 215 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 218 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 270 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 271 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 275 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 276 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 277 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 278 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 279 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 280 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 281 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 282 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 283 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 294 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 295 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 296 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 297 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 298 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 300 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 301 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 302 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 303 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 309 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 310 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 312 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 313 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 314 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 315 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 316 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 317 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 318 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 319 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 320 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 321 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 322 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 323 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.41 |
| Metatranscriptomes | 0.4 |
| Isolates | 3.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.37 |
| Nodule | 0 |
| Rhizoplane | 2.39 |
| Rhizosphere | 83.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1001634 | 3300001915 | Bacteria | 6243 |
| 2 | JGI24740J21852_10008431 | 3300001979 | Bacteria | 4106 |
| 3 | JGI24739J22299_10013084 | 3300001989 | Bacteria | 3035 |
| 4 | JGI24737J22298_10001465 | 3300001990 | Bacteria | 8407 |
| 5 | JGI24735J21928_10001446 | 3300002067 | Bacteria | 8392 |
| 6 | rootH1_10103122 | 3300003316 | Bacteria | 1631 |
| 7 | rootL2_10314575 | 3300003322 | Bacteria | 1128 |
| 8 | Ga0055529_1013820 | 3300003763 | Bacteria | 1026 |
| 9 | Ga0055536_1010582 | 3300003781 | Bacteria | 3639 |
| 10 | Ga0055530_10004289 | 3300003791 | Bacteria | 7440 |
| 11 | Ga0055530_10009753 | 3300003791 | Bacteria | 3640 |
| 12 | Ga0055531_10004154 | 3300003794 | Bacteria | 8936 |
| 13 | Ga0070658_10017623 | 3300005327 | Bacteria | 5713 |
| 14 | Ga0070658_10104631 | 3300005327 | Bacteria | 2342 |
| 15 | Ga0070658_10374550 | 3300005327 | Bacteria | 1221 |
| 16 | Ga0070676_10301428 | 3300005328 | Bacteria | 1086 |
| 17 | Ga0070683_100150262 | 3300005329 | Bacteria | 2208 |
| 18 | Ga0070690_100162446 | 3300005330 | Bacteria | 1532 |
| 19 | Ga0068869_100985720 | 3300005334 | Bacteria | 733 |
| 20 | Ga0070680_100270310 | 3300005336 | Bacteria | 1439 |
| 21 | Ga0070680_100292487 | 3300005336 | Bacteria | 1381 |
| 22 | Ga0068868_100000020 | 3300005338 | Bacteria | 92590 |
| 23 | Ga0070660_100000567 | 3300005339 | Bacteria | 24778 |
| 24 | Ga0070660_100007313 | 3300005339 | Bacteria | 7695 |
| 25 | Ga0070660_100704604 | 3300005339 | Bacteria | 847 |
| 26 | Ga0070687_100268287 | 3300005343 | Bacteria | 1069 |
| 27 | Ga0070661_100000003 | 3300005344 | Bacteria | 254653 |
| 28 | Ga0070661_100004250 | 3300005344 | Bacteria | 9878 |
| 29 | Ga0070661_100069184 | 3300005344 | Bacteria | 2595 |
| 30 | Ga0070661_100111798 | 3300005344 | Bacteria | 2040 |
| 31 | Ga0070692_10000239 | 3300005345 | Bacteria | 15079 |
| 32 | Ga0070668_100118592 | 3300005347 | Bacteria | 2113 |
| 33 | Ga0070668_100385830 | 3300005347 | Bacteria | 1193 |
| 34 | Ga0070669_100256703 | 3300005353 | Bacteria | 1393 |
| 35 | Ga0070669_100257865 | 3300005353 | Bacteria | 1390 |
| 36 | Ga0070669_100277633 | 3300005353 | Bacteria | 1341 |
| 37 | Ga0070675_100013425 | 3300005354 | Bacteria | 6437 |
| 38 | Ga0070675_100088998 | 3300005354 | Bacteria | 2584 |
| 39 | Ga0070671_100256929 | 3300005355 | Bacteria | 1484 |
| 40 | Ga0070673_100449758 | 3300005364 | Bacteria | 1159 |
| 41 | Ga0070688_100081070 | 3300005365 | Bacteria | 2100 |
| 42 | Ga0070659_100000017 | 3300005366 | Bacteria | 163966 |
| 43 | Ga0070659_100012507 | 3300005366 | Bacteria | 6293 |
| 44 | Ga0070659_101050401 | 3300005366 | Bacteria | 716 |
| 45 | Ga0070667_100488585 | 3300005367 | Bacteria | 1128 |
| 46 | Ga0070714_100018613 | 3300005435 | Bacteria | 5645 |
| 47 | Ga0070714_100049547 | 3300005435 | Bacteria | 3575 |
| 48 | Ga0070714_100163889 | 3300005435 | Bacteria | 2013 |
| 49 | Ga0070713_100078371 | 3300005436 | Bacteria | 2812 |
| 50 | Ga0070713_100281729 | 3300005436 | Bacteria | 1525 |
| 51 | Ga0070713_101048341 | 3300005436 | Bacteria | 787 |
| 52 | Ga0070710_10123373 | 3300005437 | Bacteria | 1571 |
| 53 | Ga0070710_10127750 | 3300005437 | Bacteria | 1546 |
| 54 | Ga0070711_100055689 | 3300005439 | Bacteria | 2733 |
| 55 | Ga0070708_100385287 | 3300005445 | Bacteria | 1322 |
| 56 | Ga0070663_100012402 | 3300005455 | Bacteria | 5391 |
| 57 | Ga0070663_100212549 | 3300005455 | Bacteria | 1515 |
| 58 | Ga0070678_100210785 | 3300005456 | Bacteria | 1610 |
| 59 | Ga0070681_10014645 | 3300005458 | Bacteria | 7801 |
| 60 | Ga0070699_100087578 | 3300005518 | Bacteria | 2718 |
| 61 | Ga0070679_100049104 | 3300005530 | Bacteria | 4203 |
| 62 | Ga0070684_100031471 | 3300005535 | Bacteria | 4517 |
| 63 | Ga0068853_100008824 | 3300005539 | Bacteria | 8110 |
| 64 | Ga0068853_100036479 | 3300005539 | Bacteria | 4182 |
| 65 | Ga0068853_100683020 | 3300005539 | Bacteria | 979 |
| 66 | Ga0070672_100149828 | 3300005543 | Bacteria | 1929 |
| 67 | Ga0070696_100022243 | 3300005546 | Bacteria | 4307 |
| 68 | Ga0070665_100124205 | 3300005548 | Bacteria | 2583 |
| 69 | Ga0070665_100124502 | 3300005548 | Bacteria | 2580 |
| 70 | Ga0070704_100437436 | 3300005549 | Bacteria | 1123 |
| 71 | Ga0068855_100005356 | 3300005563 | Bacteria | 15649 |
| 72 | Ga0068855_101273253 | 3300005563 | Unclassified | 762 |
| 73 | Ga0068855_101473605 | 3300005563 | Bacteria | 699 |
| 74 | Ga0070664_100000563 | 3300005564 | Bacteria | 28381 |
| 75 | Ga0070664_100083231 | 3300005564 | Bacteria | 2760 |
| 76 | Ga0070664_100226662 | 3300005564 | Bacteria | 1674 |
| 77 | Ga0068857_100002279 | 3300005577 | Bacteria | 15601 |
| 78 | Ga0068857_100230256 | 3300005577 | Bacteria | 1695 |
| 79 | Ga0068857_100676244 | 3300005577 | Bacteria | 979 |
| 80 | Ga0068856_100004757 | 3300005614 | Bacteria | 13477 |
| 81 | Ga0068856_100048633 | 3300005614 | Bacteria | 4180 |
| 82 | Ga0068856_100430051 | 3300005614 | Bacteria | 1340 |
| 83 | Ga0068852_100003269 | 3300005616 | Bacteria | 11314 |
| 84 | Ga0068852_100033251 | 3300005616 | Bacteria | 4279 |
| 85 | Ga0068852_100083796 | 3300005616 | Bacteria | 2836 |
| 86 | Ga0068864_100049637 | 3300005618 | Bacteria | 3610 |
| 87 | Ga0068851_10011715 | 3300005834 | Bacteria | 4117 |
| 88 | Ga0068870_10203854 | 3300005840 | Bacteria | 1201 |
| 89 | Ga0068863_100362810 | 3300005841 | Bacteria | 1412 |
| 90 | Ga0068858_100380184 | 3300005842 | Bacteria | 1355 |
| 91 | Ga0068860_100328464 | 3300005843 | Bacteria | 1502 |
| 92 | Ga0068862_100140226 | 3300005844 | Bacteria | 2145 |
| 93 | Ga0081455_10139756 | 3300005937 | Bacteria | 1882 |
| 94 | Ga0081455_10144006 | 3300005937 | Bacteria | 1846 |
| 95 | Ga0081538_10032951 | 3300005981 | Bacteria | 3459 |
| 96 | Ga0070717_10446966 | 3300006028 | Bacteria | 1165 |
| 97 | Ga0075365_10131464 | 3300006038 | Bacteria | 1732 |
| 98 | Ga0075364_10085153 | 3300006051 | Bacteria | 2093 |
| 99 | Ga0070716_100136574 | 3300006173 | Bacteria | 1558 |
| 100 | Ga0075362_10128066 | 3300006177 | Bacteria | 1206 |
| 101 | Ga0075369_10046071 | 3300006186 | Bacteria | 1877 |
| 102 | Ga0075370_10007752 | 3300006353 | Bacteria | 5483 |
| 103 | Ga0075433_10183812 | 3300006852 | Bacteria | 1860 |
| 104 | Ga0068865_100676478 | 3300006881 | Bacteria | 879 |
| 105 | Ga0105251_10003145 | 3300009011 | Bacteria | 12252 |
| 106 | Ga0105250_10108305 | 3300009092 | Bacteria | 1137 |
| 107 | Ga0105240_10001484 | 3300009093 | Bacteria | 39913 |
| 108 | Ga0105240_10238459 | 3300009093 | Bacteria | 2110 |
| 109 | Ga0105240_10365567 | 3300009093 | Bacteria | 1633 |
| 110 | Ga0111539_10028255 | 3300009094 | Bacteria | 6846 |
| 111 | Ga0105245_10088434 | 3300009098 | Bacteria | 2845 |
| 112 | Ga0114129_10204402 | 3300009147 | Bacteria | 2673 |
| 113 | Ga0114129_10709329 | 3300009147 | Bacteria | 1292 |
| 114 | Ga0105243_10677125 | 3300009148 | Bacteria | 1003 |
| 115 | Ga0105241_10037937 | 3300009174 | Bacteria | 3632 |
| 116 | Ga0105241_10064296 | 3300009174 | Bacteria | 2832 |
| 117 | Ga0105241_10258466 | 3300009174 | Bacteria | 1479 |
| 118 | Ga0105242_10180480 | 3300009176 | Bacteria | 1862 |
| 119 | Ga0105242_10531227 | 3300009176 | Bacteria | 1124 |
| 120 | Ga0105242_10990116 | 3300009176 | Bacteria | 848 |
| 121 | Ga0105248_10065793 | 3300009177 | Bacteria | 4070 |
| 122 | Ga0105248_11892277 | 3300009177 | Bacteria | 677 |
| 123 | Ga0105237_10010720 | 3300009545 | Bacteria | 9724 |
| 124 | Ga0105238_10007836 | 3300009551 | Bacteria | 10680 |
| 125 | Ga0105238_10480091 | 3300009551 | Bacteria | 1242 |
| 126 | Ga0105238_10869305 | 3300009551 | Bacteria | 919 |
| 127 | Ga0105239_10063498 | 3300010375 | Bacteria | 4055 |
| 128 | Ga0105239_10536770 | 3300010375 | Bacteria | 1331 |
| 129 | Ga0105239_11832096 | 3300010375 | Bacteria | 703 |
| 130 | Ga0157373_10030058 | 3300013100 | Bacteria | 3910 |
| 131 | Ga0157373_10175019 | 3300013100 | Bacteria | 1510 |
| 132 | Ga0157371_10109325 | 3300013102 | Bacteria | 1962 |
| 133 | Ga0157370_10008878 | 3300013104 | Bacteria | 10804 |
| 134 | Ga0157370_10263161 | 3300013104 | Bacteria | 1594 |
| 135 | Ga0157370_10263948 | 3300013104 | Bacteria | 1591 |
| 136 | Ga0157370_10467583 | 3300013104 | Bacteria | 1159 |
| 137 | Ga0157369_10005068 | 3300013105 | Bacteria | 15414 |
| 138 | Ga0157369_10037786 | 3300013105 | Bacteria | 5285 |
| 139 | Ga0157374_10476176 | 3300013296 | Bacteria | 1251 |
| 140 | Ga0157374_10668299 | 3300013296 | Bacteria | 1051 |
| 141 | Ga0157378_10312610 | 3300013297 | Bacteria | 1524 |
| 142 | Ga0157372_10005517 | 3300013307 | Bacteria | 13448 |
| 143 | Ga0157372_12153002 | 3300013307 | Bacteria | 641 |
| 144 | Ga0157375_10371145 | 3300013308 | Bacteria | 1597 |
| 145 | Ga0163163_10062375 | 3300014325 | Bacteria | 3693 |
| 146 | Ga0157380_10009778 | 3300014326 | Bacteria | 6884 |
| 147 | Ga0182008_10056310 | 3300014497 | Bacteria | 1943 |
| 148 | Ga0157379_11076381 | 3300014968 | Bacteria | 769 |
| 149 | Ga0157376_10028710 | 3300014969 | Bacteria | 4425 |
| 150 | Ga0163161_10228117 | 3300017792 | Bacteria | 1444 |
| 151 | Ga0163161_10311554 | 3300017792 | Bacteria | 1242 |
| 152 | Ga0163161_10414479 | 3300017792 | Bacteria | 1082 |
| 153 | Ga0206354_10571180 | 3300020081 | Bacteria | 3548 |
| 154 | Ga0206353_10114243 | 3300020082 | Bacteria | 2901 |
| 155 | Ga0213872_10013257 | 3300021361 | Bacteria | 3865 |
| 156 | Ga0213872_10028746 | 3300021361 | Bacteria | 2549 |
| 157 | Ga0213875_10007362 | 3300021388 | Bacteria | 5688 |
| 158 | Ga0209148_1001566 | 3300025254 | Bacteria | 10979 |
| 159 | Ga0209455_1001154 | 3300025272 | Bacteria | 12757 |
| 160 | Ga0209676_1000243 | 3300025292 | Bacteria | 117113 |
| 161 | Ga0209676_1001364 | 3300025292 | Bacteria | 24001 |
| 162 | Ga0209050_1000244 | 3300025298 | Bacteria | 117105 |
| 163 | Ga0209050_1001551 | 3300025298 | Bacteria | 24060 |
| 164 | Ga0209256_1015389 | 3300025299 | Bacteria | 2679 |
| 165 | Ga0209051_1007439 | 3300025303 | Bacteria | 5982 |
| 166 | Ga0209257_1000140 | 3300025304 | Bacteria | 201515 |
| 167 | Ga0209257_1033032 | 3300025304 | Bacteria | 1632 |
| 168 | Ga0207656_10013188 | 3300025321 | Bacteria | 3153 |
| 169 | Ga0207713_1024953 | 3300025735 | Bacteria | 2771 |
| 170 | Ga0207692_10091514 | 3300025898 | Bacteria | 1650 |
| 171 | Ga0207692_10233576 | 3300025898 | Bacteria | 1095 |
| 172 | Ga0207647_10009795 | 3300025904 | Bacteria | 6795 |
| 173 | Ga0207699_10033715 | 3300025906 | Bacteria | 2896 |
| 174 | Ga0207699_10234911 | 3300025906 | Bacteria | 1257 |
| 175 | Ga0207645_10221544 | 3300025907 | Bacteria | 1247 |
| 176 | Ga0207705_10069782 | 3300025909 | Bacteria | 2545 |
| 177 | Ga0207705_10179691 | 3300025909 | Bacteria | 1596 |
| 178 | Ga0207705_10191496 | 3300025909 | Bacteria | 1547 |
| 179 | Ga0207654_10016559 | 3300025911 | Bacteria | 3841 |
| 180 | Ga0207654_10072813 | 3300025911 | Bacteria | 2046 |
| 181 | Ga0207707_10356000 | 3300025912 | Bacteria | 1261 |
| 182 | Ga0207707_10443838 | 3300025912 | Bacteria | 1111 |
| 183 | Ga0207695_10011192 | 3300025913 | Bacteria | 10884 |
| 184 | Ga0207695_10064545 | 3300025913 | Bacteria | 3769 |
| 185 | Ga0207671_10008001 | 3300025914 | Bacteria | 9055 |
| 186 | Ga0207671_10410931 | 3300025914 | Bacteria | 1076 |
| 187 | Ga0207693_10003277 | 3300025915 | Bacteria | 13862 |
| 188 | Ga0207663_10017893 | 3300025916 | Bacteria | 3958 |
| 189 | Ga0207657_10001546 | 3300025919 | Bacteria | 24651 |
| 190 | Ga0207657_10011306 | 3300025919 | Bacteria | 8865 |
| 191 | Ga0207657_10064057 | 3300025919 | Bacteria | 3140 |
| 192 | Ga0207649_10000027 | 3300025920 | Bacteria | 161926 |
| 193 | Ga0207649_10013560 | 3300025920 | Bacteria | 4551 |
| 194 | Ga0207649_10022394 | 3300025920 | Bacteria | 3650 |
| 195 | Ga0207649_10689543 | 3300025920 | Unclassified | 792 |
| 196 | Ga0207652_10050287 | 3300025921 | Bacteria | 3571 |
| 197 | Ga0207681_10109631 | 3300025923 | Bacteria | 2006 |
| 198 | Ga0207681_11076794 | 3300025923 | Bacteria | 675 |
| 199 | Ga0207694_10001424 | 3300025924 | Bacteria | 20507 |
| 200 | Ga0207694_10189128 | 3300025924 | Bacteria | 1672 |
| 201 | Ga0207650_10165711 | 3300025925 | Bacteria | 1753 |
| 202 | Ga0207659_10003798 | 3300025926 | Bacteria | 9113 |
| 203 | Ga0207687_10044674 | 3300025927 | Bacteria | 3059 |
| 204 | Ga0207700_10171922 | 3300025928 | Bacteria | 1808 |
| 205 | Ga0207664_10023189 | 3300025929 | Bacteria | 4647 |
| 206 | Ga0207664_10058674 | 3300025929 | Bacteria | 3062 |
| 207 | Ga0207664_10433876 | 3300025929 | Bacteria | 1171 |
| 208 | Ga0207644_10174383 | 3300025931 | Bacteria | 1681 |
| 209 | Ga0207690_10000035 | 3300025932 | Bacteria | 149201 |
| 210 | Ga0207690_10057213 | 3300025932 | Bacteria | 2633 |
| 211 | Ga0207690_10306496 | 3300025932 | Bacteria | 1244 |
| 212 | Ga0207706_10010045 | 3300025933 | Bacteria | 8674 |
| 213 | Ga0207706_11159884 | 3300025933 | Bacteria | 643 |
| 214 | Ga0207686_10102679 | 3300025934 | Bacteria | 1912 |
| 215 | Ga0207709_10242697 | 3300025935 | Bacteria | 1311 |
| 216 | Ga0207691_10221866 | 3300025940 | Bacteria | 1639 |
| 217 | Ga0207711_10276624 | 3300025941 | Bacteria | 1545 |
| 218 | Ga0207689_10367284 | 3300025942 | Bacteria | 1197 |
| 219 | Ga0207661_10087963 | 3300025944 | Bacteria | 2582 |
| 220 | Ga0207661_10206700 | 3300025944 | Bacteria | 1729 |
| 221 | Ga0207679_10008926 | 3300025945 | Bacteria | 6400 |
| 222 | Ga0207679_10366122 | 3300025945 | Bacteria | 1260 |
| 223 | Ga0207667_10005999 | 3300025949 | Bacteria | 14784 |
| 224 | Ga0207667_10147441 | 3300025949 | Bacteria | 2422 |
| 225 | Ga0207667_10364687 | 3300025949 | Bacteria | 1473 |
| 226 | Ga0207651_10232052 | 3300025960 | Bacteria | 1499 |
| 227 | Ga0207651_10268145 | 3300025960 | Bacteria | 1405 |
| 228 | Ga0207712_10101875 | 3300025961 | Bacteria | 2136 |
| 229 | Ga0207640_10058917 | 3300025981 | Bacteria | 2532 |
| 230 | Ga0207677_10000071 | 3300026023 | Bacteria | 84386 |
| 231 | Ga0207703_10420607 | 3300026035 | Bacteria | 1243 |
| 232 | Ga0207703_10669502 | 3300026035 | Bacteria | 985 |
| 233 | Ga0207639_10001044 | 3300026041 | Bacteria | 18817 |
| 234 | Ga0207639_10013130 | 3300026041 | Bacteria | 5787 |
| 235 | Ga0207639_10020975 | 3300026041 | Bacteria | 4686 |
| 236 | Ga0207639_10032204 | 3300026041 | Bacteria | 3858 |
| 237 | Ga0207639_11259315 | 3300026041 | Bacteria | 694 |
| 238 | Ga0207678_10008945 | 3300026067 | Bacteria | 8818 |
| 239 | Ga0207678_10234638 | 3300026067 | Bacteria | 1571 |
| 240 | Ga0207702_10003692 | 3300026078 | Bacteria | 13850 |
| 241 | Ga0207702_10005099 | 3300026078 | Bacteria | 11548 |
| 242 | Ga0207702_10014826 | 3300026078 | Bacteria | 6464 |
| 243 | Ga0207702_11193767 | 3300026078 | Bacteria | 755 |
| 244 | Ga0207641_10507707 | 3300026088 | Bacteria | 1171 |
| 245 | Ga0207641_10881642 | 3300026088 | Bacteria | 888 |
| 246 | Ga0207648_10995945 | 3300026089 | Bacteria | 785 |
| 247 | Ga0207676_10125694 | 3300026095 | Bacteria | 2171 |
| 248 | Ga0207674_10000053 | 3300026116 | Bacteria | 114437 |
| 249 | Ga0207674_10349763 | 3300026116 | Bacteria | 1429 |
| 250 | Ga0207674_10598668 | 3300026116 | Bacteria | 1065 |
| 251 | Ga0207675_100014967 | 3300026118 | Bacteria | 7241 |
| 252 | Ga0207683_10115146 | 3300026121 | Bacteria | 2410 |
| 253 | Ga0207683_10883269 | 3300026121 | Bacteria | 830 |
| 254 | Ga0207698_10000279 | 3300026142 | Bacteria | 31023 |
| 255 | Ga0207698_10007275 | 3300026142 | Bacteria | 6936 |
| 256 | Ga0207698_10074915 | 3300026142 | Bacteria | 2702 |
| 257 | Ga0207698_10291383 | 3300026142 | Bacteria | 1515 |
| 258 | Ga0207698_10595607 | 3300026142 | Bacteria | 1089 |
| 259 | Ga0209813_10000240 | 3300027866 | Bacteria | 16302 |
| 260 | Ga0207428_10000208 | 3300027907 | Bacteria | 81781 |
| 261 | Ga0268266_10022326 | 3300028379 | Bacteria | 5394 |
| 262 | Ga0268265_10110045 | 3300028380 | Bacteria | 2247 |
| 263 | Ga0268265_10245555 | 3300028380 | Bacteria | 1582 |
| 264 | Ga0268264_10290378 | 3300028381 | Bacteria | 1535 |
| 265 | Ga0265318_10042759 | 3300028577 | Bacteria | 1719 |
| 266 | Ga0307515_10045998 | 3300028794 | Bacteria | 6685 |
| 267 | Ga0265338_10106774 | 3300028800 | Bacteria | 2266 |
| 268 | Ga0265338_10372959 | 3300028800 | Bacteria | 1022 |
| 269 | Ga0265331_10000641 | 3300031250 | Bacteria | 30240 |
| 270 | Ga0307408_100165099 | 3300031548 | Bacteria | 1762 |
| 271 | Ga0265313_10110726 | 3300031595 | Bacteria | 1208 |
| 272 | Ga0265314_10384477 | 3300031711 | Bacteria | 763 |
| 273 | Ga0307405_10928640 | 3300031731 | Bacteria | 738 |
| 274 | Ga0307413_10029578 | 3300031824 | Bacteria | 3067 |
| 275 | Ga0307412_10000991 | 3300031911 | Bacteria | 16260 |
| 276 | Ga0307409_100006166 | 3300031995 | Bacteria | 7013 |
| 277 | Ga0307409_101018679 | 3300031995 | Bacteria | 847 |
| 278 | Ga0307416_100283338 | 3300032002 | Bacteria | 1635 |
| 279 | Ga0307416_100795163 | 3300032002 | Bacteria | 1041 |
| 280 | Ga0307416_101164776 | 3300032002 | Bacteria | 876 |
| 281 | Ga0307414_10179156 | 3300032004 | Bacteria | 1703 |
| 282 | Ga0307414_10374754 | 3300032004 | Bacteria | 1229 |
| 283 | Ga0307414_10690160 | 3300032004 | Bacteria | 923 |
| 284 | Ga0307411_10124102 | 3300032005 | Bacteria | 1874 |
| 285 | Ga0307411_10344795 | 3300032005 | Bacteria | 1212 |
| 286 | Ga0307415_100379456 | 3300032126 | Bacteria | 1200 |
| 287 | Ga0307415_100383883 | 3300032126 | Bacteria | 1194 |
| 288 | Ga0373934_0079843 | 3300035086 | Bacteria | 1314 |
| 289 | Ga0373923_0007488 | 3300035111 | Bacteria | 3841 |
| 290 | Ga0373923_0390765 | 3300035111 | Bacteria | 668 |
| 291 | Ga0373936_0068954 | 3300035113 | Bacteria | 1455 |
| 292 | Ga0373945_0200139 | 3300035116 | Bacteria | 829 |
| 293 | Ga0373953_0100950 | 3300035117 | Bacteria | 1214 |
| 294 | Ga0373953_0373036 | 3300035117 | Bacteria | 626 |
| 295 | Ga0373954_0195921 | 3300035118 | Bacteria | 992 |
| 296 | Ga0373956_0029317 | 3300035119 | Bacteria | 2399 |
| 297 | Ga0373956_0088216 | 3300035119 | Bacteria | 1429 |
| 298 | Ga0373943_0508143 | 3300035170 | Bacteria | 705 |
| 299 | Ga0373924_0044729 | 3300035410 | Bacteria | 1820 |
| 300 | Ga0373927_0406876 | 3300035695 | Bacteria | 898 |
| 301 | Ga0373933_0032853 | 3300035724 | Bacteria | 3016 |
| 302 | Ga0373933_0054875 | 3300035724 | Bacteria | 2389 |
| 303 | Ga0373947_0072836 | 3300035725 | Bacteria | 2110 |
| 304 | Ga0373937_0018996 | 3300036401 | Bacteria | 6148 |
| 305 | Ga0373937_0033932 | 3300036401 | Bacteria | 4639 |
| 306 | Ga0373925_0108098 | 3300037068 | Bacteria | 2146 |
| 307 | Ga0373925_0127412 | 3300037068 | Bacteria | 1982 |
| 308 | Ga0373925_0208535 | 3300037068 | Bacteria | 1556 |
| 309 | Ga0395899_0014457 | 3300037312 | Bacteria | 6024 |
| 310 | Ga0395900_0030524 | 3300037418 | Bacteria | 5534 |
| 311 | Ga0395898_0040971 | 3300037466 | Bacteria | 4576 |
| 312 | Ga0395905_0228053 | 3300037471 | Bacteria | 1742 |
| 313 | Ga0436364_0351709 | 3300037853 | Bacteria | 21332 |
| 314 | Ga0395901_0088078 | 3300038443 | Bacteria | 3246 |
| 315 | Ga0395901_0230303 | 3300038443 | Bacteria | 1934 |
| 316 | Ga0395901_1099174 | 3300038443 | Bacteria | 766 |
| 317 | Ga0395901_1103104 | 3300038443 | Bacteria | 764 |
| 318 | Ga0436365_1142461 | 3300039437 | Bacteria | 901 |
| 319 | Ga0436360_0394921 | 3300039438 | Bacteria | 3170 |
| 320 | Ga0436360_1166518 | 3300039438 | Bacteria | 1017 |
| 321 | Ga0436361_0558812 | 3300039447 | Bacteria | 2364 |
| 322 | Ga0436361_0796148 | 3300039447 | Bacteria | 3566 |
| 323 | Ga0436361_0807596 | 3300039447 | Bacteria | 2716 |
| 324 | Ga0436361_1115951 | 3300039447 | Bacteria | 8723 |
| 325 | Ga0466963_0041585 | 3300044694 | Bacteria | 3015 |
| 326 | Ga0466971_0160381 | 3300044719 | Bacteria | 1053 |
| 327 | Ga0466957_0016054 | 3300044842 | Bacteria | 4377 |
| 328 | Ga0466958_0002177 | 3300045836 | Bacteria | 9770 |
| 329 | Ga0466967_0021905 | 3300045976 | Bacteria | 5201 |
| 330 | Ga0495617_001529 | 3300046452 | Bacteria | 10042 |
| 331 | Ga0495627_000225 | 3300046453 | Bacteria | 60005 |
| 332 | Ga0495627_000324 | 3300046453 | Bacteria | 46576 |
| 333 | Ga0495590_0006148 | 3300046457 | Bacteria | 4703 |
| 334 | Ga0495638_0000012 | 3300046460 | Bacteria | 435577 |
| 335 | Ga0495651_0016247 | 3300046462 | Bacteria | 5765 |
| 336 | Ga0495650_0003357 | 3300046471 | Bacteria | 11747 |
| 337 | Ga0495605_0238071 | 3300046474 | Bacteria | 782 |
| 338 | Ga0495662_0278388 | 3300046476 | Bacteria | 824 |
| 339 | Ga0495664_0024256 | 3300046477 | Bacteria | 3524 |
| 340 | Ga0495584_0062213 | 3300046491 | Bacteria | 1876 |
| 341 | Ga0495583_0001198 | 3300046506 | Bacteria | 27870 |
| 342 | Ga0495608_0030067 | 3300046511 | Bacteria | 3680 |
| 343 | Ga0495608_0095061 | 3300046511 | Bacteria | 1925 |
| 344 | Ga0495610_0000085 | 3300046512 | Bacteria | 112390 |
| 345 | Ga0495610_0001911 | 3300046512 | Bacteria | 17969 |
| 346 | Ga0495610_0084972 | 3300046512 | Bacteria | 1445 |
| 347 | Ga0495631_0006778 | 3300046518 | Bacteria | 5880 |
| 348 | Ga0495631_0144026 | 3300046518 | Bacteria | 1023 |
| 349 | Ga0495632_0000013 | 3300046519 | Bacteria | 247879 |
| 350 | Ga0495632_0000612 | 3300046519 | Bacteria | 32954 |
| 351 | Ga0495637_0000100 | 3300046520 | Bacteria | 65373 |
| 352 | Ga0495637_0004041 | 3300046520 | Bacteria | 7662 |
| 353 | Ga0495637_0059996 | 3300046520 | Bacteria | 1564 |
| 354 | Ga0495643_0000010 | 3300046522 | Bacteria | 341431 |
| 355 | Ga0495643_0219444 | 3300046522 | Bacteria | 903 |
| 356 | Ga0495648_0000038 | 3300046524 | Bacteria | 191612 |
| 357 | Ga0495648_0000933 | 3300046524 | Bacteria | 30373 |
| 358 | Ga0495648_0013969 | 3300046524 | Bacteria | 5908 |
| 359 | Ga0495663_0000004 | 3300046525 | Bacteria | 355166 |
| 360 | Ga0495642_0051532 | 3300046528 | Bacteria | 1693 |
| 361 | Ga0495642_0136290 | 3300046528 | Bacteria | 1058 |
| 362 | Ga0495652_0116448 | 3300046529 | Bacteria | 2140 |
| 363 | Ga0495652_0438879 | 3300046529 | Bacteria | 916 |
| 364 | Ga0495640_0103298 | 3300046533 | Bacteria | 1869 |
| 365 | Ga0495587_0021169 | 3300046536 | Bacteria | 4010 |
| 366 | Ga0495597_0014687 | 3300046542 | Bacteria | 3725 |
| 367 | Ga0495597_0030655 | 3300046542 | Bacteria | 2450 |
| 368 | Ga0495645_0036582 | 3300046543 | Bacteria | 3578 |
| 369 | Ga0495633_0000092 | 3300046558 | Bacteria | 121446 |
| 370 | Ga0495633_0001757 | 3300046558 | Bacteria | 16080 |
| 371 | Ga0495633_0005139 | 3300046558 | Bacteria | 8110 |
| 372 | Ga0495633_0024664 | 3300046558 | Bacteria | 2969 |
| 373 | Ga0495667_0035038 | 3300046559 | Bacteria | 3356 |
| 374 | Ga0495667_0060267 | 3300046559 | Bacteria | 2489 |
| 375 | Ga0495668_0031091 | 3300046616 | Bacteria | 3009 |
| 376 | Ga0495635_0089065 | 3300046663 | Bacteria | 2111 |
| 377 | Ga0495657_0070715 | 3300046675 | Bacteria | 2280 |
| 378 | Ga0495599_0006314 | 3300046678 | Bacteria | 7144 |
| 379 | Ga0495623_0345806 | 3300046679 | Bacteria | 811 |
| 380 | Ga0495669_0000042 | 3300046684 | Bacteria | 87033 |
| 381 | Ga0495669_0321320 | 3300046684 | Bacteria | 747 |
| 382 | Ga0495613_0002574 | 3300046689 | Bacteria | 13649 |
| 383 | Ga0495670_0118029 | 3300046691 | Bacteria | 1377 |
| 384 | Ga0495671_0000014 | 3300046692 | Bacteria | 341431 |
| 385 | Ga0495671_0000034 | 3300046692 | Bacteria | 195385 |
| 386 | Ga0495671_0044633 | 3300046692 | Bacteria | 2221 |
| 387 | Ga0495600_0209641 | 3300046809 | Bacteria | 1249 |
| 388 | Ga0495604_0095896 | 3300047317 | Bacteria | 2190 |
| 389 | Ga0495604_0496010 | 3300047317 | Bacteria | 793 |
| 390 | Ga0495674_0153881 | 3300047319 | Bacteria | 1927 |
| 391 | Ga0495674_0677042 | 3300047319 | Bacteria | 811 |
| 392 | Ga0495672_0019590 | 3300047320 | Bacteria | 4460 |
| 393 | Ga0495680_0239145 | 3300047322 | Bacteria | 1290 |
| 394 | Ga0495680_0467800 | 3300047322 | Bacteria | 860 |
| 395 | Ga0495675_0009072 | 3300047444 | Bacteria | 6181 |
| 396 | Ga0495675_0298456 | 3300047444 | Bacteria | 957 |
| 397 | Ga0495677_0152105 | 3300047445 | Bacteria | 891 |
| 398 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 399 | Ga0495673_0008628 | 3300047469 | Bacteria | 5707 |
| 400 | Ga0495681_0000013 | 3300047470 | Bacteria | 189155 |
| 401 | Ga0495681_0000725 | 3300047470 | Bacteria | 25287 |
| 402 | Ga0495684_0104179 | 3300047471 | Bacteria | 2144 |
| 403 | Ga0495686_0003559 | 3300047472 | Bacteria | 13392 |
| 404 | Ga0495686_0043333 | 3300047472 | Bacteria | 2853 |
| 405 | Ga0495686_0084335 | 3300047472 | Bacteria | 1936 |
| 406 | Ga0495602_0044589 | 3300048088 | Bacteria | 4021 |
| 407 | Ga0495602_0337395 | 3300048088 | Bacteria | 1091 |
| 408 | Ga0496103_0264954 | 3300048906 | Bacteria | 1105 |
| 409 | Ga0496106_0336944 | 3300048909 | Bacteria | 1211 |
| 410 | Ga0496107_0051128 | 3300048910 | Bacteria | 2980 |
| 411 | Ga0496108_0003651 | 3300048911 | Bacteria | 12345 |
| 412 | Ga0496108_0121547 | 3300048911 | Bacteria | 2240 |
| 413 | Ga0496109_0038403 | 3300048912 | Bacteria | 4329 |
| 414 | Ga0496110_0063103 | 3300048913 | Bacteria | 3273 |
| 415 | Ga0496110_0237350 | 3300048913 | Bacteria | 1659 |
| 416 | Ga0496112_0506307 | 3300048915 | Bacteria | 1143 |
| 417 | Ga0496112_0748361 | 3300048915 | Bacteria | 904 |
| 418 | Ga0496113_0211684 | 3300048916 | Bacteria | 1543 |
| 419 | Ga0496115_0136960 | 3300048918 | Bacteria | 2019 |
| 420 | Ga0496116_0171870 | 3300048919 | Bacteria | 1173 |
| 421 | Ga0496121_0002040 | 3300048924 | Bacteria | 31978 |
| 422 | Ga0496122_0009972 | 3300048925 | Bacteria | 9892 |
| 423 | Ga0496123_0007161 | 3300048926 | Bacteria | 10587 |
| 424 | Ga0496124_0019330 | 3300048927 | Bacteria | 6343 |
| 425 | Ga0496124_0025313 | 3300048927 | Bacteria | 5377 |
| 426 | Ga0496124_0072512 | 3300048927 | Bacteria | 2852 |
| 427 | Ga0496125_0004828 | 3300048928 | Bacteria | 15318 |
| 428 | Ga0496125_0036346 | 3300048928 | Bacteria | 4303 |
| 429 | Ga0496125_0127786 | 3300048928 | Bacteria | 1797 |
| 430 | Ga0496126_0033919 | 3300048929 | Bacteria | 4800 |
| 431 | Ga0496126_0518415 | 3300048929 | Bacteria | 950 |
| 432 | Ga0495678_001026 | 3300049459 | Bacteria | 23707 |
| 433 | Ga0501300_004933 | 3300049523 | Bacteria | 1971 |
| 434 | Ga0501034_0019739 | 3300049571 | Bacteria | 6889 |
| 435 | Ga0501034_0132793 | 3300049571 | Bacteria | 2472 |
| 436 | Ga0501034_0311610 | 3300049571 | Bacteria | 1508 |
| 437 | Ga0501034_0783681 | 3300049571 | Bacteria | 847 |
| 438 | Ga0501047_0013788 | 3300049581 | Bacteria | 7677 |
| 439 | Ga0501047_0502873 | 3300049581 | Bacteria | 1039 |
| 440 | Ga0501068_0076306 | 3300049584 | Bacteria | 2051 |
| 441 | Ga0501069_0002191 | 3300049585 | Bacteria | 9832 |
| 442 | Ga0501070_0035483 | 3300049586 | Bacteria | 4167 |
| 443 | Ga0501073_0072199 | 3300049589 | Bacteria | 2404 |
| 444 | Ga0501073_0087779 | 3300049589 | Bacteria | 2163 |
| 445 | Ga0501223_000008 | 3300049663 | Bacteria | 117828 |
| 446 | Ga0501246_000753 | 3300049676 | Bacteria | 2383 |
| 447 | Ga0501225_0000046 | 3300049705 | Bacteria | 41537 |
| 448 | Ga0501225_0019747 | 3300049705 | Bacteria | 1863 |
| 449 | Ga0501229_001868 | 3300049706 | Bacteria | 2464 |
| 450 | Ga0501272_001438 | 3300049769 | Bacteria | 2256 |
| 451 | Ga0501044_0118917 | 3300049823 | Bacteria | 2645 |
| 452 | Ga0501044_0456979 | 3300049823 | Bacteria | 1183 |
| 453 | nmdc:mga00v17_95361_c1 | 3300050491 | Bacteria | 1873 |
| 454 | nmdc:mga0yw44_355408_c1 | 3300050492 | Unclassified | 987 |
| 455 | nmdc:mga0k408_35954_c1 | 3300050493 | Bacteria | 2841 |
| 456 | nmdc:mga07m45_487304_c1 | 3300050496 | Bacteria | 714 |
| 457 | nmdc:mga05p37_1438459_c1 | 3300050507 | Bacteria | 691 |
| 458 | nmdc:mga08y16_35_c1 | 3300050511 | Bacteria | 157578 |
| 459 | Ga0495601_0012838 | 3300053077 | Bacteria | 5028 |
| 460 | Ga0495612_0005462 | 3300053078 | Bacteria | 5254 |
| 461 | Ga0495612_0186223 | 3300053078 | Bacteria | 913 |
| 462 | Ga0495619_0123849 | 3300053085 | Bacteria | 1773 |
| 463 | Ga0495619_0135182 | 3300053085 | Bacteria | 1696 |
| 464 | Ga0500578_0000004 | 3300053086 | Bacteria | 260037 |
| 465 | Ga0500643_000078 | 3300053087 | Bacteria | 104681 |
| 466 | Ga0500643_019285 | 3300053087 | Bacteria | 2248 |
| 467 | Ga0500643_031319 | 3300053087 | Bacteria | 1623 |
| 468 | Ga0500644_0010227 | 3300053088 | Bacteria | 2533 |
| 469 | Ga0500641_0031597 | 3300053096 | Bacteria | 2089 |
| 470 | Ga0500562_001202 | 3300053108 | Bacteria | 6371 |
| 471 | Ga0500562_002291 | 3300053108 | Bacteria | 4796 |
| 472 | Ga0500594_0000109 | 3300053118 | Bacteria | 24096 |
| 473 | Ga0500608_000030 | 3300053122 | Bacteria | 66677 |
| 474 | Ga0500559_0003848 | 3300053136 | Bacteria | 7262 |
| 475 | Ga0500568_0001380 | 3300053139 | Bacteria | 15752 |
| 476 | Ga0500604_0000001 | 3300053151 | Bacteria | 174619 |
| 477 | Ga0500616_0000070 | 3300053153 | Bacteria | 232610 |
| 478 | Ga0500622_0001704 | 3300053156 | Bacteria | 17055 |
| 479 | Ga0500622_0057238 | 3300053156 | Bacteria | 1994 |
| 480 | Ga0500587_024849 | 3300053739 | Bacteria | 796 |
| 481 | Ga0590071_010336 | 3300059421 | Bacteria | 2187 |
| 482 | Ga0590075_037595 | 3300059424 | Bacteria | 1234 |
| 483 | Ga0501082_0018071 | 3300060353 | Bacteria | 6071 |
| 484 | Ga0501082_0419661 | 3300060353 | Bacteria | 1168 |
| 485 | Ga0466962_0142505 | 3300061719 | Bacteria | 1161 |
| 486 | Ga0466962_0378169 | 3300061719 | Bacteria | 707 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035116 | Ga0373945_0200139 | Ga0373945_0200139_159_734 | 159 |
| 2 | 3300035725 | Ga0373947_0072836 | Ga0373947_0072836_198_773 | 159 |
| 3 | 3300037068 | Ga0373925_0208535 | Ga0373925_0208535_388_963 | 159 |
| 4 | 3300046533 | Ga0495640_0103298 | Ga0495640_0103298_284_859 | 159 |
| 5 | 3300047319 | Ga0495674_0677042 | Ga0495674_0677042_151_726 | 159 |
| 6 | 3300032005 | Ga0307411_10344795 | Ga0307411_103447953 | 162 |
| 7 | 3300035170 | Ga0373943_0508143 | Ga0373943_0508143_118_693 | 163 |
| 8 | 3300039438 | Ga0436360_1166518 | Ga0436360_1166518_133_624 | 163 |
| 9 | 3300021388 | Ga0213875_10007362 | Ga0213875_100073622 | 168 |
| 10 | 3300037853 | Ga0436364_0351709 | Ga0436364_0351709_4423_4929 | 168 |
| 11 | 3300013307 | Ga0157372_12153002 | Ga0157372_121530021 | 173 |
| 12 | 3300035086 | Ga0373934_0079843 | Ga0373934_0079843_64_585 | 173 |
| 13 | 3300035111 | Ga0373923_0390765 | Ga0373923_0390765_13_534 | 173 |
| 14 | 3300035117 | Ga0373953_0373036 | Ga0373953_0373036_90_611 | 173 |
| 15 | 3300035119 | Ga0373956_0088216 | Ga0373956_0088216_690_1211 | 173 |
| 16 | 3300035724 | Ga0373933_0054875 | Ga0373933_0054875_509_1030 | 173 |
| 17 | 3300036401 | Ga0373937_0033932 | Ga0373937_0033932_1356_1877 | 173 |
| 18 | 3300046477 | Ga0495664_0024256 | Ga0495664_0024256_207_728 | 173 |
| 19 | 3300046511 | Ga0495608_0030067 | Ga0495608_0030067_71_592 | 173 |
| 20 | 3300046529 | Ga0495652_0438879 | Ga0495652_0438879_38_559 | 173 |
| 21 | 3300046536 | Ga0495587_0021169 | Ga0495587_0021169_1812_2333 | 173 |
| 22 | 3300046543 | Ga0495645_0036582 | Ga0495645_0036582_1549_2070 | 173 |
| 23 | 3300046559 | Ga0495667_0060267 | Ga0495667_0060267_432_953 | 173 |
| 24 | 3300046663 | Ga0495635_0089065 | Ga0495635_0089065_1411_1932 | 173 |
| 25 | 3300046675 | Ga0495657_0070715 | Ga0495657_0070715_370_891 | 173 |
| 26 | 3300046678 | Ga0495599_0006314 | Ga0495599_0006314_4290_4811 | 173 |
| 27 | 3300046679 | Ga0495623_0345806 | Ga0495623_0345806_77_598 | 173 |
| 28 | 3300046809 | Ga0495600_0209641 | Ga0495600_0209641_671_1192 | 173 |
| 29 | 3300047319 | Ga0495674_0153881 | Ga0495674_0153881_38_559 | 173 |
| 30 | 3300047322 | Ga0495680_0239145 | Ga0495680_0239145_649_1170 | 173 |
| 31 | 3300047444 | Ga0495675_0009072 | Ga0495675_0009072_2920_3441 | 173 |
| 32 | 3300047471 | Ga0495684_0104179 | Ga0495684_0104179_1503_2024 | 173 |
| 33 | 3300048088 | Ga0495602_0044589 | Ga0495602_0044589_1783_2304 | 173 |
| 34 | 3300049571 | Ga0501034_0132793 | Ga0501034_0132793_751_1368 | 173 |
| 35 | 3300053077 | Ga0495601_0012838 | Ga0495601_0012838_3495_4016 | 173 |
| 36 | 3300053078 | Ga0495612_0005462 | Ga0495612_0005462_4066_4587 | 173 |
| 37 | 3300053085 | Ga0495619_0123849 | Ga0495619_0123849_998_1519 | 173 |
| 38 | 3300005329 | Ga0070683_100150262 | Ga0070683_1001502622 | 174 |
| 39 | 3300005563 | Ga0068855_101273253 | Ga0068855_1012732532 | 174 |
| 40 | 3300025944 | Ga0207661_10206700 | Ga0207661_102067002 | 174 |
| 41 | 3300032004 | Ga0307414_10179156 | Ga0307414_101791562 | 176 |
| 42 | 3300038443 | Ga0395901_1103104 | Ga0395901_1103104_82_672 | 177 |
| 43 | 3300005981 | Ga0081538_10032951 | Ga0081538_100329514 | 178 |
| 44 | 3300026078 | Ga0207702_11193767 | Ga0207702_111937672 | 178 |
| 45 | 3300049585 | Ga0501069_0002191 | Ga0501069_0002191_5720_6286 | 178 |
| 46 | 3300049586 | Ga0501070_0035483 | Ga0501070_0035483_627_1193 | 178 |
| 47 | 3300060353 | Ga0501082_0419661 | Ga0501082_0419661_559_1125 | 178 |
| 48 | 3300025933 | Ga0207706_11159884 | Ga0207706_111598841 | 180 |
| 49 | 3300049584 | Ga0501068_0076306 | Ga0501068_0076306_419_1075 | 180 |
| 50 | 3300006038 | Ga0075365_10131464 | Ga0075365_101314643 | 181 |
| 51 | 3300006051 | Ga0075364_10085153 | Ga0075364_100851533 | 181 |
| 52 | 3300009551 | Ga0105238_10869305 | Ga0105238_108693052 | 181 |
| 53 | 3300050491 | nmdc:mga00v17_95361_c1 | nmdc:mga00v17_95361_c1_190_771 | 181 |
| 54 | 3300050492 | nmdc:mga0yw44_355408_c1 | nmdc:mga0yw44_355408_c1_333_914 | 181 |
| 55 | 3300005338 | Ga0068868_100000020 | Ga0068868_10000002044 | 182 |
| 56 | 3300005339 | Ga0070660_100000567 | Ga0070660_10000056710 | 182 |
| 57 | 3300005366 | Ga0070659_100000017 | Ga0070659_100000017101 | 182 |
| 58 | 3300009098 | Ga0105245_10088434 | Ga0105245_100884345 | 182 |
| 59 | 3300025919 | Ga0207657_10001546 | Ga0207657_1000154610 | 182 |
| 60 | 3300025927 | Ga0207687_10044674 | Ga0207687_100446745 | 182 |
| 61 | 3300025932 | Ga0207690_10000035 | Ga0207690_10000035105 | 182 |
| 62 | 3300026023 | Ga0207677_10000071 | Ga0207677_1000007116 | 182 |
| 63 | 3300005328 | Ga0070676_10301428 | Ga0070676_103014282 | 184 |
| 64 | 3300005330 | Ga0070690_100162446 | Ga0070690_1001624462 | 184 |
| 65 | 3300005336 | Ga0070680_100292487 | Ga0070680_1002924872 | 184 |
| 66 | 3300005339 | Ga0070660_100704604 | Ga0070660_1007046041 | 184 |
| 67 | 3300005344 | Ga0070661_100111798 | Ga0070661_1001117982 | 184 |
| 68 | 3300005353 | Ga0070669_100277633 | Ga0070669_1002776332 | 184 |
| 69 | 3300005354 | Ga0070675_100088998 | Ga0070675_1000889984 | 184 |
| 70 | 3300005365 | Ga0070688_100081070 | Ga0070688_1000810703 | 184 |
| 71 | 3300005366 | Ga0070659_101050401 | Ga0070659_1010504012 | 184 |
| 72 | 3300005456 | Ga0070678_100210785 | Ga0070678_1002107852 | 184 |
| 73 | 3300005535 | Ga0070684_100031471 | Ga0070684_1000314715 | 184 |
| 74 | 3300005539 | Ga0068853_100683020 | Ga0068853_1006830202 | 184 |
| 75 | 3300005563 | Ga0068855_101473605 | Ga0068855_1014736052 | 184 |
| 76 | 3300005577 | Ga0068857_100230256 | Ga0068857_1002302561 | 184 |
| 77 | 3300005614 | Ga0068856_100048633 | Ga0068856_1000486336 | 184 |
| 78 | 3300005616 | Ga0068852_100033251 | Ga0068852_1000332516 | 184 |
| 79 | 3300005840 | Ga0068870_10203854 | Ga0068870_102038542 | 184 |
| 80 | 3300006881 | Ga0068865_100676478 | Ga0068865_1006764782 | 184 |
| 81 | 3300009148 | Ga0105243_10677125 | Ga0105243_106771252 | 184 |
| 82 | 3300009176 | Ga0105242_10990116 | Ga0105242_109901161 | 184 |
| 83 | 3300009177 | Ga0105248_11892277 | Ga0105248_118922771 | 184 |
| 84 | 3300010375 | Ga0105239_10063498 | Ga0105239_100634984 | 184 |
| 85 | 3300013102 | Ga0157371_10109325 | Ga0157371_101093254 | 184 |
| 86 | 3300013104 | Ga0157370_10263948 | Ga0157370_102639483 | 184 |
| 87 | 3300013105 | Ga0157369_10037786 | Ga0157369_100377866 | 184 |
| 88 | 3300013308 | Ga0157375_10371145 | Ga0157375_103711452 | 184 |
| 89 | 3300014969 | Ga0157376_10028710 | Ga0157376_100287104 | 184 |
| 90 | 3300017792 | Ga0163161_10311554 | Ga0163161_103115542 | 184 |
| 91 | 3300025907 | Ga0207645_10221544 | Ga0207645_102215442 | 184 |
| 92 | 3300025923 | Ga0207681_10109631 | Ga0207681_101096313 | 184 |
| 93 | 3300025924 | Ga0207694_10189128 | Ga0207694_101891282 | 184 |
| 94 | 3300025931 | Ga0207644_10174383 | Ga0207644_101743832 | 184 |
| 95 | 3300025935 | Ga0207709_10242697 | Ga0207709_102426972 | 184 |
| 96 | 3300025940 | Ga0207691_10221866 | Ga0207691_102218662 | 184 |
| 97 | 3300025949 | Ga0207667_10147441 | Ga0207667_101474415 | 184 |
| 98 | 3300025949 | Ga0207667_10364687 | Ga0207667_103646872 | 184 |
| 99 | 3300025960 | Ga0207651_10268145 | Ga0207651_102681452 | 184 |
| 100 | 3300026035 | Ga0207703_10669502 | Ga0207703_106695022 | 184 |
| 101 | 3300026041 | Ga0207639_11259315 | Ga0207639_112593151 | 184 |
| 102 | 3300026078 | Ga0207702_10003692 | Ga0207702_1000369218 | 184 |
| 103 | 3300026116 | Ga0207674_10349763 | Ga0207674_103497633 | 184 |
| 104 | 3300026121 | Ga0207683_10115146 | Ga0207683_101151463 | 184 |
| 105 | 3300026142 | Ga0207698_10074915 | Ga0207698_100749152 | 184 |
| 106 | 3300028800 | Ga0265338_10106774 | Ga0265338_101067741 | 184 |
| 107 | 3300035695 | Ga0373927_0406876 | Ga0373927_0406876_194_748 | 184 |
| 108 | 3300037068 | Ga0373925_0127412 | Ga0373925_0127412_504_1058 | 184 |
| 109 | 3300037312 | Ga0395899_0014457 | Ga0395899_0014457_1650_2204 | 184 |
| 110 | 3300037418 | Ga0395900_0030524 | Ga0395900_0030524_1452_2006 | 184 |
| 111 | 3300037466 | Ga0395898_0040971 | Ga0395898_0040971_1263_1817 | 184 |
| 112 | 3300037471 | Ga0395905_0228053 | Ga0395905_0228053_93_647 | 184 |
| 113 | 3300038443 | Ga0395901_0088078 | Ga0395901_0088078_861_1415 | 184 |
| 114 | 3300038443 | Ga0395901_0230303 | Ga0395901_0230303_646_1200 | 184 |
| 115 | 3300044694 | Ga0466963_0041585 | Ga0466963_0041585_1706_2260 | 184 |
| 116 | 3300044842 | Ga0466957_0016054 | Ga0466957_0016054_523_1077 | 184 |
| 117 | 3300045976 | Ga0466967_0021905 | Ga0466967_0021905_3664_4218 | 184 |
| 118 | 3300046691 | Ga0495670_0118029 | Ga0495670_0118029_632_1204 | 184 |
| 119 | 3300047317 | Ga0495604_0496010 | Ga0495604_0496010_112_666 | 184 |
| 120 | 3300048915 | Ga0496112_0748361 | Ga0496112_0748361_202_756 | 184 |
| 121 | 3300049523 | Ga0501300_004933 | Ga0501300_004933_1347_1949 | 184 |
| 122 | 3300049571 | Ga0501034_0019739 | Ga0501034_0019739_3396_3950 | 184 |
| 123 | 3300049706 | Ga0501229_001868 | Ga0501229_001868_746_1348 | 184 |
| 124 | 3300049769 | Ga0501272_001438 | Ga0501272_001438_689_1291 | 184 |
| 125 | 3300053087 | Ga0500643_000078 | Ga0500643_000078_19142_19714 | 184 |
| 126 | 3300061719 | Ga0466962_0142505 | Ga0466962_0142505_591_1145 | 184 |
| 127 | 3300009176 | Ga0105242_10531227 | Ga0105242_105312272 | 185 |
| 128 | 3300013297 | Ga0157378_10312610 | Ga0157378_103126102 | 185 |
| 129 | 3300025254 | Ga0209148_1001566 | Ga0209148_100156614 | 185 |
| 130 | 3300025272 | Ga0209455_1001154 | Ga0209455_10011547 | 185 |
| 131 | 3300025923 | Ga0207681_11076794 | Ga0207681_110767941 | 185 |
| 132 | 3300026142 | Ga0207698_10291383 | Ga0207698_102913832 | 185 |
| 133 | 3300049589 | Ga0501073_0087779 | Ga0501073_0087779_971_1576 | 185 |
| 134 | 3300050507 | nmdc:mga05p37_1438459_c1 | nmdc:mga05p37_1438459_c1_108_665 | 185 |
| 135 | 3300003322 | rootL2_10314575 | rootL2_103145752 | 186 |
| 136 | 3300005343 | Ga0070687_100268287 | Ga0070687_1002682872 | 186 |
| 137 | 3300005539 | Ga0068853_100036479 | Ga0068853_1000364794 | 186 |
| 138 | 3300005549 | Ga0070704_100437436 | Ga0070704_1004374362 | 186 |
| 139 | 3300005842 | Ga0068858_100380184 | Ga0068858_1003801842 | 186 |
| 140 | 3300005843 | Ga0068860_100328464 | Ga0068860_1003284642 | 186 |
| 141 | 3300005844 | Ga0068862_100140226 | Ga0068862_1001402262 | 186 |
| 142 | 3300005937 | Ga0081455_10139756 | Ga0081455_101397564 | 186 |
| 143 | 3300006177 | Ga0075362_10128066 | Ga0075362_101280663 | 186 |
| 144 | 3300009174 | Ga0105241_10258466 | Ga0105241_102584661 | 186 |
| 145 | 3300009176 | Ga0105242_10180480 | Ga0105242_101804802 | 186 |
| 146 | 3300014968 | Ga0157379_11076381 | Ga0157379_110763811 | 186 |
| 147 | 3300025934 | Ga0207686_10102679 | Ga0207686_101026792 | 186 |
| 148 | 3300025942 | Ga0207689_10367284 | Ga0207689_103672842 | 186 |
| 149 | 3300026035 | Ga0207703_10420607 | Ga0207703_104206071 | 186 |
| 150 | 3300026041 | Ga0207639_10013130 | Ga0207639_100131305 | 186 |
| 151 | 3300026116 | Ga0207674_10598668 | Ga0207674_105986682 | 186 |
| 152 | 3300028380 | Ga0268265_10110045 | Ga0268265_101100452 | 186 |
| 153 | 3300028381 | Ga0268264_10290378 | Ga0268264_102903782 | 186 |
| 154 | 3300048918 | Ga0496115_0136960 | Ga0496115_0136960_644_1204 | 186 |
| 155 | iso_pu_bacteria | 2512564014 | 2512645070 | 186 |
| 156 | iso_pu_bacteria | 2775507255 | 2778125790 | 186 |
| 157 | iso_pu_bacteria | 2919709256 | 2919711239 | 186 |
| 158 | 3300003763 | Ga0055529_1013820 | Ga0055529_10138202 | 187 |
| 159 | 3300005327 | Ga0070658_10017623 | Ga0070658_100176237 | 187 |
| 160 | 3300005327 | Ga0070658_10104631 | Ga0070658_101046314 | 187 |
| 161 | 3300005339 | Ga0070660_100007313 | Ga0070660_1000073135 | 187 |
| 162 | 3300005344 | Ga0070661_100004250 | Ga0070661_1000042505 | 187 |
| 163 | 3300005366 | Ga0070659_100012507 | Ga0070659_1000125076 | 187 |
| 164 | 3300005435 | Ga0070714_100018613 | Ga0070714_1000186135 | 187 |
| 165 | 3300005436 | Ga0070713_101048341 | Ga0070713_1010483411 | 187 |
| 166 | 3300005455 | Ga0070663_100212549 | Ga0070663_1002125492 | 187 |
| 167 | 3300005458 | Ga0070681_10014645 | Ga0070681_100146452 | 187 |
| 168 | 3300005530 | Ga0070679_100049104 | Ga0070679_1000491046 | 187 |
| 169 | 3300005539 | Ga0068853_100008824 | Ga0068853_1000088246 | 187 |
| 170 | 3300005563 | Ga0068855_100005356 | Ga0068855_10000535610 | 187 |
| 171 | 3300005564 | Ga0070664_100000563 | Ga0070664_10000056318 | 187 |
| 172 | 3300005577 | Ga0068857_100002279 | Ga0068857_1000022794 | 187 |
| 173 | 3300005614 | Ga0068856_100004757 | Ga0068856_1000047579 | 187 |
| 174 | 3300005616 | Ga0068852_100003269 | Ga0068852_1000032692 | 187 |
| 175 | 3300005834 | Ga0068851_10011715 | Ga0068851_100117155 | 187 |
| 176 | 3300005937 | Ga0081455_10144006 | Ga0081455_101440062 | 187 |
| 177 | 3300009093 | Ga0105240_10001484 | Ga0105240_1000148432 | 187 |
| 178 | 3300009174 | Ga0105241_10064296 | Ga0105241_100642964 | 187 |
| 179 | 3300009551 | Ga0105238_10007836 | Ga0105238_1000783610 | 187 |
| 180 | 3300013100 | Ga0157373_10030058 | Ga0157373_100300582 | 187 |
| 181 | 3300013104 | Ga0157370_10263161 | Ga0157370_102631611 | 187 |
| 182 | 3300013105 | Ga0157369_10005068 | Ga0157369_1000506811 | 187 |
| 183 | 3300013307 | Ga0157372_10005517 | Ga0157372_1000551710 | 187 |
| 184 | 3300014497 | Ga0182008_10056310 | Ga0182008_100563101 | 187 |
| 185 | 3300025321 | Ga0207656_10013188 | Ga0207656_100131885 | 187 |
| 186 | 3300025909 | Ga0207705_10069782 | Ga0207705_100697821 | 187 |
| 187 | 3300025911 | Ga0207654_10072813 | Ga0207654_100728133 | 187 |
| 188 | 3300025912 | Ga0207707_10356000 | Ga0207707_103560002 | 187 |
| 189 | 3300025913 | Ga0207695_10011192 | Ga0207695_100111924 | 187 |
| 190 | 3300025919 | Ga0207657_10011306 | Ga0207657_1001130610 | 187 |
| 191 | 3300025920 | Ga0207649_10013560 | Ga0207649_100135605 | 187 |
| 192 | 3300025921 | Ga0207652_10050287 | Ga0207652_100502873 | 187 |
| 193 | 3300025924 | Ga0207694_10001424 | Ga0207694_1000142421 | 187 |
| 194 | 3300025929 | Ga0207664_10023189 | Ga0207664_100231895 | 187 |
| 195 | 3300025932 | Ga0207690_10057213 | Ga0207690_100572135 | 187 |
| 196 | 3300025945 | Ga0207679_10008926 | Ga0207679_100089263 | 187 |
| 197 | 3300025949 | Ga0207667_10005999 | Ga0207667_1000599911 | 187 |
| 198 | 3300025981 | Ga0207640_10058917 | Ga0207640_100589171 | 187 |
| 199 | 3300026041 | Ga0207639_10032204 | Ga0207639_100322045 | 187 |
| 200 | 3300026067 | Ga0207678_10234638 | Ga0207678_102346382 | 187 |
| 201 | 3300026078 | Ga0207702_10014826 | Ga0207702_100148264 | 187 |
| 202 | 3300026116 | Ga0207674_10000053 | Ga0207674_1000005382 | 187 |
| 203 | 3300026142 | Ga0207698_10007275 | Ga0207698_100072757 | 187 |
| 204 | 3300049581 | Ga0501047_0013788 | Ga0501047_0013788_4718_5281 | 187 |
| 205 | 3300049581 | Ga0501047_0502873 | Ga0501047_0502873_124_774 | 187 |
| 206 | 3300049589 | Ga0501073_0072199 | Ga0501073_0072199_1706_2290 | 187 |
| 207 | 3300049823 | Ga0501044_0456979 | Ga0501044_0456979_172_822 | 187 |
| 208 | 3300053096 | Ga0500641_0031597 | Ga0500641_0031597_367_930 | 187 |
| 209 | 3300060353 | Ga0501082_0018071 | Ga0501082_0018071_4840_5424 | 187 |
| 210 | 3300003316 | rootH1_10103122 | rootH1_101031221 | 188 |
| 211 | 3300003781 | Ga0055536_1010582 | Ga0055536_10105822 | 188 |
| 212 | 3300003791 | Ga0055530_10004289 | Ga0055530_100042899 | 188 |
| 213 | 3300003791 | Ga0055530_10009753 | Ga0055530_100097532 | 188 |
| 214 | 3300003794 | Ga0055531_10004154 | Ga0055531_1000415410 | 188 |
| 215 | 3300005334 | Ga0068869_100985720 | Ga0068869_1009857201 | 188 |
| 216 | 3300005344 | Ga0070661_100000003 | Ga0070661_10000000312 | 188 |
| 217 | 3300005345 | Ga0070692_10000239 | Ga0070692_100002394 | 188 |
| 218 | 3300005347 | Ga0070668_100385830 | Ga0070668_1003858301 | 188 |
| 219 | 3300005354 | Ga0070675_100013425 | Ga0070675_1000134254 | 188 |
| 220 | 3300005435 | Ga0070714_100049547 | Ga0070714_1000495473 | 188 |
| 221 | 3300005436 | Ga0070713_100078371 | Ga0070713_1000783714 | 188 |
| 222 | 3300005437 | Ga0070710_10123373 | Ga0070710_101233731 | 188 |
| 223 | 3300005439 | Ga0070711_100055689 | Ga0070711_1000556893 | 188 |
| 224 | 3300005543 | Ga0070672_100149828 | Ga0070672_1001498283 | 188 |
| 225 | 3300005548 | Ga0070665_100124205 | Ga0070665_1001242054 | 188 |
| 226 | 3300005616 | Ga0068852_100083796 | Ga0068852_1000837963 | 188 |
| 227 | 3300006186 | Ga0075369_10046071 | Ga0075369_100460714 | 188 |
| 228 | 3300013296 | Ga0157374_10476176 | Ga0157374_104761762 | 188 |
| 229 | 3300017792 | Ga0163161_10228117 | Ga0163161_102281172 | 188 |
| 230 | 3300020081 | Ga0206354_10571180 | Ga0206354_105711803 | 188 |
| 231 | 3300020082 | Ga0206353_10114243 | Ga0206353_101142433 | 188 |
| 232 | 3300025292 | Ga0209676_1000243 | Ga0209676_100024335 | 188 |
| 233 | 3300025292 | Ga0209676_1001364 | Ga0209676_100136416 | 188 |
| 234 | 3300025298 | Ga0209050_1000244 | Ga0209050_100024435 | 188 |
| 235 | 3300025298 | Ga0209050_1001551 | Ga0209050_100155115 | 188 |
| 236 | 3300025299 | Ga0209256_1015389 | Ga0209256_10153894 | 188 |
| 237 | 3300025303 | Ga0209051_1007439 | Ga0209051_10074393 | 188 |
| 238 | 3300025304 | Ga0209257_1000140 | Ga0209257_100014089 | 188 |
| 239 | 3300025304 | Ga0209257_1033032 | Ga0209257_10330322 | 188 |
| 240 | 3300025898 | Ga0207692_10091514 | Ga0207692_100915142 | 188 |
| 241 | 3300025906 | Ga0207699_10033715 | Ga0207699_100337154 | 188 |
| 242 | 3300025920 | Ga0207649_10000027 | Ga0207649_1000002765 | 188 |
| 243 | 3300025926 | Ga0207659_10003798 | Ga0207659_100037986 | 188 |
| 244 | 3300025929 | Ga0207664_10433876 | Ga0207664_104338763 | 188 |
| 245 | 3300025944 | Ga0207661_10087963 | Ga0207661_100879633 | 188 |
| 246 | 3300026041 | Ga0207639_10020975 | Ga0207639_100209752 | 188 |
| 247 | 3300026142 | Ga0207698_10595607 | Ga0207698_105956072 | 188 |
| 248 | 3300028800 | Ga0265338_10372959 | Ga0265338_103729592 | 188 |
| 249 | 3300031731 | Ga0307405_10928640 | Ga0307405_109286402 | 188 |
| 250 | 3300031995 | Ga0307409_101018679 | Ga0307409_1010186791 | 188 |
| 251 | 3300032002 | Ga0307416_101164776 | Ga0307416_1011647762 | 188 |
| 252 | 3300032004 | Ga0307414_10374754 | Ga0307414_103747541 | 188 |
| 253 | 3300032126 | Ga0307415_100383883 | Ga0307415_1003838832 | 188 |
| 254 | 3300035111 | Ga0373923_0007488 | Ga0373923_0007488_1392_1967 | 188 |
| 255 | 3300035113 | Ga0373936_0068954 | Ga0373936_0068954_650_1225 | 188 |
| 256 | 3300035117 | Ga0373953_0100950 | Ga0373953_0100950_253_828 | 188 |
| 257 | 3300035118 | Ga0373954_0195921 | Ga0373954_0195921_144_719 | 188 |
| 258 | 3300035119 | Ga0373956_0029317 | Ga0373956_0029317_256_831 | 188 |
| 259 | 3300035410 | Ga0373924_0044729 | Ga0373924_0044729_886_1461 | 188 |
| 260 | 3300035724 | Ga0373933_0032853 | Ga0373933_0032853_1361_1936 | 188 |
| 261 | 3300036401 | Ga0373937_0018996 | Ga0373937_0018996_3379_3954 | 188 |
| 262 | 3300037068 | Ga0373925_0108098 | Ga0373925_0108098_1352_1927 | 188 |
| 263 | 3300039437 | Ga0436365_1142461 | Ga0436365_1142461_262_828 | 188 |
| 264 | 3300046462 | Ga0495651_0016247 | Ga0495651_0016247_1638_2213 | 188 |
| 265 | 3300046476 | Ga0495662_0278388 | Ga0495662_0278388_67_642 | 188 |
| 266 | 3300046511 | Ga0495608_0095061 | Ga0495608_0095061_1314_1889 | 188 |
| 267 | 3300046522 | Ga0495643_0219444 | Ga0495643_0219444_248_829 | 188 |
| 268 | 3300046529 | Ga0495652_0116448 | Ga0495652_0116448_1040_1612 | 188 |
| 269 | 3300046542 | Ga0495597_0014687 | Ga0495597_0014687_2498_3079 | 188 |
| 270 | 3300046559 | Ga0495667_0035038 | Ga0495667_0035038_1287_1862 | 188 |
| 271 | 3300046689 | Ga0495613_0002574 | Ga0495613_0002574_6934_7506 | 188 |
| 272 | 3300047317 | Ga0495604_0095896 | Ga0495604_0095896_95_670 | 188 |
| 273 | 3300047322 | Ga0495680_0467800 | Ga0495680_0467800_145_720 | 188 |
| 274 | 3300047444 | Ga0495675_0298456 | Ga0495675_0298456_222_797 | 188 |
| 275 | 3300048088 | Ga0495602_0337395 | Ga0495602_0337395_396_971 | 188 |
| 276 | 3300048909 | Ga0496106_0336944 | Ga0496106_0336944_404_997 | 188 |
| 277 | 3300048910 | Ga0496107_0051128 | Ga0496107_0051128_1240_1833 | 188 |
| 278 | 3300048927 | Ga0496124_0019330 | Ga0496124_0019330_1828_2409 | 188 |
| 279 | 3300049571 | Ga0501034_0783681 | Ga0501034_0783681_121_687 | 188 |
| 280 | 3300050493 | nmdc:mga0k408_35954_c1 | nmdc:mga0k408_35954_c1_2048_2629 | 188 |
| 281 | 3300050496 | nmdc:mga07m45_487304_c1 | nmdc:mga07m45_487304_c1_91_672 | 188 |
| 282 | 3300053078 | Ga0495612_0186223 | Ga0495612_0186223_202_777 | 188 |
| 283 | 3300053085 | Ga0495619_0135182 | Ga0495619_0135182_1064_1639 | 188 |
| 284 | 3300053087 | Ga0500643_031319 | Ga0500643_031319_984_1571 | 188 |
| 285 | 3300053122 | Ga0500608_000030 | Ga0500608_000030_61668_62276 | 188 |
| 286 | 3300053136 | Ga0500559_0003848 | Ga0500559_0003848_3864_4472 | 188 |
| 287 | 3300053139 | Ga0500568_0001380 | Ga0500568_0001380_4681_5247 | 188 |
| 288 | 3300053151 | Ga0500604_0000001 | Ga0500604_0000001_159724_160290 | 188 |
| 289 | 3300053153 | Ga0500616_0000070 | Ga0500616_0000070_215432_215998 | 188 |
| 290 | 3300053739 | Ga0500587_024849 | Ga0500587_024849_92_658 | 188 |
| 291 | iso_pu_bacteria | 2643221640 | 2644224591 | 188 |
| 292 | iso_pu_bacteria | 2643221642 | 2644234474 | 188 |
| 293 | iso_pu_bacteria | 2857504554 | 2857504850 | 188 |
| 294 | 3300005518 | Ga0070699_100087578 | Ga0070699_1000875781 | 189 |
| 295 | 3300005546 | Ga0070696_100022243 | Ga0070696_1000222435 | 189 |
| 296 | 3300006852 | Ga0075433_10183812 | Ga0075433_101838122 | 189 |
| 297 | 3300009093 | Ga0105240_10365567 | Ga0105240_103655672 | 189 |
| 298 | 3300009094 | Ga0111539_10028255 | Ga0111539_100282553 | 189 |
| 299 | 3300009147 | Ga0114129_10204402 | Ga0114129_102044023 | 189 |
| 300 | 3300009147 | Ga0114129_10709329 | Ga0114129_107093292 | 189 |
| 301 | 3300009551 | Ga0105238_10480091 | Ga0105238_104800912 | 189 |
| 302 | 3300014326 | Ga0157380_10009778 | Ga0157380_100097785 | 189 |
| 303 | 3300026118 | Ga0207675_100014967 | Ga0207675_1000149674 | 189 |
| 304 | 3300027907 | Ga0207428_10000208 | Ga0207428_100002085 | 189 |
| 305 | 3300028380 | Ga0268265_10245555 | Ga0268265_102455553 | 189 |
| 306 | 3300028794 | Ga0307515_10045998 | Ga0307515_100459988 | 189 |
| 307 | 3300031824 | Ga0307413_10029578 | Ga0307413_100295782 | 189 |
| 308 | 3300031995 | Ga0307409_100006166 | Ga0307409_1000061665 | 189 |
| 309 | 3300032002 | Ga0307416_100795163 | Ga0307416_1007951632 | 189 |
| 310 | 3300032005 | Ga0307411_10124102 | Ga0307411_101241022 | 189 |
| 311 | 3300032126 | Ga0307415_100379456 | Ga0307415_1003794562 | 189 |
| 312 | 3300038443 | Ga0395901_1099174 | Ga0395901_1099174_47_640 | 189 |
| 313 | 3300046457 | Ga0495590_0006148 | Ga0495590_0006148_659_1255 | 189 |
| 314 | 3300046512 | Ga0495610_0001911 | Ga0495610_0001911_17202_17798 | 189 |
| 315 | 3300046518 | Ga0495631_0006778 | Ga0495631_0006778_2670_3269 | 189 |
| 316 | 3300046520 | Ga0495637_0059996 | Ga0495637_0059996_600_1199 | 189 |
| 317 | 3300046616 | Ga0495668_0031091 | Ga0495668_0031091_1998_2594 | 189 |
| 318 | 3300047472 | Ga0495686_0003559 | Ga0495686_0003559_12645_13244 | 189 |
| 319 | 3300048928 | Ga0496125_0127786 | Ga0496125_0127786_821_1441 | 189 |
| 320 | 3300048929 | Ga0496126_0518415 | Ga0496126_0518415_215_835 | 189 |
| 321 | 3300049459 | Ga0495678_001026 | Ga0495678_001026_15979_16575 | 189 |
| 322 | 3300050511 | nmdc:mga08y16_35_c1 | nmdc:mga08y16_35_c1_154996_155589 | 189 |
| 323 | 3300053086 | Ga0500578_0000004 | Ga0500578_0000004_25246_25842 | 189 |
| 324 | 3300053088 | Ga0500644_0010227 | Ga0500644_0010227_853_1452 | 189 |
| 325 | 3300053108 | Ga0500562_002291 | Ga0500562_002291_3115_3711 | 189 |
| 326 | 3300053118 | Ga0500594_0000109 | Ga0500594_0000109_146_742 | 189 |
| 327 | 3300053156 | Ga0500622_0001704 | Ga0500622_0001704_2632_3231 | 189 |
| 328 | 3300059421 | Ga0590071_010336 | Ga0590071_010336_373_966 | 189 |
| 329 | 3300059424 | Ga0590075_037595 | Ga0590075_037595_147_740 | 189 |
| 330 | iso_pu_bacteria | 2791355048 | 2792461092 | 189 |
| 331 | iso_pu_bacteria | 2843744320 | 2843749377 | 189 |
| 332 | iso_pu_bacteria | 2849560528 | 2849562648 | 189 |
| 333 | iso_pu_bacteria | 2849573788 | 2849576963 | 189 |
| 334 | iso_pu_bacteria | 2851153111 | 2851156073 | 189 |
| 335 | iso_pu_bacteria | 2928531327 | 2928532898 | 189 |
| 336 | 3300001915 | JGI24741J21665_1001634 | JGI24741J21665_10016342 | 190 |
| 337 | 3300001979 | JGI24740J21852_10008431 | JGI24740J21852_100084314 | 190 |
| 338 | 3300001989 | JGI24739J22299_10013084 | JGI24739J22299_100130842 | 190 |
| 339 | 3300001990 | JGI24737J22298_10001465 | JGI24737J22298_100014658 | 190 |
| 340 | 3300002067 | JGI24735J21928_10001446 | JGI24735J21928_100014462 | 190 |
| 341 | 3300005327 | Ga0070658_10374550 | Ga0070658_103745502 | 190 |
| 342 | 3300005336 | Ga0070680_100270310 | Ga0070680_1002703102 | 190 |
| 343 | 3300005344 | Ga0070661_100069184 | Ga0070661_1000691842 | 190 |
| 344 | 3300005347 | Ga0070668_100118592 | Ga0070668_1001185923 | 190 |
| 345 | 3300005353 | Ga0070669_100256703 | Ga0070669_1002567032 | 190 |
| 346 | 3300005353 | Ga0070669_100257865 | Ga0070669_1002578652 | 190 |
| 347 | 3300005355 | Ga0070671_100256929 | Ga0070671_1002569292 | 190 |
| 348 | 3300005364 | Ga0070673_100449758 | Ga0070673_1004497582 | 190 |
| 349 | 3300005367 | Ga0070667_100488585 | Ga0070667_1004885852 | 190 |
| 350 | 3300005435 | Ga0070714_100163889 | Ga0070714_1001638892 | 190 |
| 351 | 3300005436 | Ga0070713_100281729 | Ga0070713_1002817293 | 190 |
| 352 | 3300005437 | Ga0070710_10127750 | Ga0070710_101277502 | 190 |
| 353 | 3300005445 | Ga0070708_100385287 | Ga0070708_1003852872 | 190 |
| 354 | 3300005455 | Ga0070663_100012402 | Ga0070663_1000124025 | 190 |
| 355 | 3300005548 | Ga0070665_100124502 | Ga0070665_1001245021 | 190 |
| 356 | 3300005564 | Ga0070664_100083231 | Ga0070664_1000832313 | 190 |
| 357 | 3300005564 | Ga0070664_100226662 | Ga0070664_1002266622 | 190 |
| 358 | 3300005577 | Ga0068857_100676244 | Ga0068857_1006762442 | 190 |
| 359 | 3300005614 | Ga0068856_100430051 | Ga0068856_1004300512 | 190 |
| 360 | 3300005618 | Ga0068864_100049637 | Ga0068864_1000496375 | 190 |
| 361 | 3300005841 | Ga0068863_100362810 | Ga0068863_1003628103 | 190 |
| 362 | 3300006028 | Ga0070717_10446966 | Ga0070717_104469661 | 190 |
| 363 | 3300006173 | Ga0070716_100136574 | Ga0070716_1001365742 | 190 |
| 364 | 3300006353 | Ga0075370_10007752 | Ga0075370_100077522 | 190 |
| 365 | 3300009011 | Ga0105251_10003145 | Ga0105251_100031459 | 190 |
| 366 | 3300009092 | Ga0105250_10108305 | Ga0105250_101083051 | 190 |
| 367 | 3300009093 | Ga0105240_10238459 | Ga0105240_102384593 | 190 |
| 368 | 3300009174 | Ga0105241_10037937 | Ga0105241_100379374 | 190 |
| 369 | 3300009177 | Ga0105248_10065793 | Ga0105248_100657936 | 190 |
| 370 | 3300009545 | Ga0105237_10010720 | Ga0105237_100107205 | 190 |
| 371 | 3300010375 | Ga0105239_10536770 | Ga0105239_105367702 | 190 |
| 372 | 3300010375 | Ga0105239_11832096 | Ga0105239_118320962 | 190 |
| 373 | 3300013100 | Ga0157373_10175019 | Ga0157373_101750192 | 190 |
| 374 | 3300013104 | Ga0157370_10008878 | Ga0157370_1000887811 | 190 |
| 375 | 3300013104 | Ga0157370_10467583 | Ga0157370_104675832 | 190 |
| 376 | 3300013296 | Ga0157374_10668299 | Ga0157374_106682992 | 190 |
| 377 | 3300014325 | Ga0163163_10062375 | Ga0163163_100623755 | 190 |
| 378 | 3300017792 | Ga0163161_10414479 | Ga0163161_104144792 | 190 |
| 379 | 3300021361 | Ga0213872_10013257 | Ga0213872_100132572 | 190 |
| 380 | 3300021361 | Ga0213872_10028746 | Ga0213872_100287462 | 190 |
| 381 | 3300025735 | Ga0207713_1024953 | Ga0207713_10249532 | 190 |
| 382 | 3300025898 | Ga0207692_10233576 | Ga0207692_102335762 | 190 |
| 383 | 3300025904 | Ga0207647_10009795 | Ga0207647_100097957 | 190 |
| 384 | 3300025906 | Ga0207699_10234911 | Ga0207699_102349112 | 190 |
| 385 | 3300025909 | Ga0207705_10179691 | Ga0207705_101796912 | 190 |
| 386 | 3300025909 | Ga0207705_10191496 | Ga0207705_101914962 | 190 |
| 387 | 3300025911 | Ga0207654_10016559 | Ga0207654_100165592 | 190 |
| 388 | 3300025912 | Ga0207707_10443838 | Ga0207707_104438382 | 190 |
| 389 | 3300025913 | Ga0207695_10064545 | Ga0207695_100645455 | 190 |
| 390 | 3300025914 | Ga0207671_10008001 | Ga0207671_1000800113 | 190 |
| 391 | 3300025914 | Ga0207671_10410931 | Ga0207671_104109312 | 190 |
| 392 | 3300025915 | Ga0207693_10003277 | Ga0207693_1000327710 | 190 |
| 393 | 3300025916 | Ga0207663_10017893 | Ga0207663_100178932 | 190 |
| 394 | 3300025919 | Ga0207657_10064057 | Ga0207657_100640572 | 190 |
| 395 | 3300025920 | Ga0207649_10022394 | Ga0207649_100223943 | 190 |
| 396 | 3300025920 | Ga0207649_10689543 | Ga0207649_106895431 | 190 |
| 397 | 3300025925 | Ga0207650_10165711 | Ga0207650_101657112 | 190 |
| 398 | 3300025928 | Ga0207700_10171922 | Ga0207700_101719221 | 190 |
| 399 | 3300025929 | Ga0207664_10058674 | Ga0207664_100586742 | 190 |
| 400 | 3300025932 | Ga0207690_10306496 | Ga0207690_103064963 | 190 |
| 401 | 3300025933 | Ga0207706_10010045 | Ga0207706_100100459 | 190 |
| 402 | 3300025941 | Ga0207711_10276624 | Ga0207711_102766243 | 190 |
| 403 | 3300025945 | Ga0207679_10366122 | Ga0207679_103661222 | 190 |
| 404 | 3300025960 | Ga0207651_10232052 | Ga0207651_102320522 | 190 |
| 405 | 3300025961 | Ga0207712_10101875 | Ga0207712_101018752 | 190 |
| 406 | 3300026041 | Ga0207639_10001044 | Ga0207639_1000104412 | 190 |
| 407 | 3300026067 | Ga0207678_10008945 | Ga0207678_100089452 | 190 |
| 408 | 3300026078 | Ga0207702_10005099 | Ga0207702_100050992 | 190 |
| 409 | 3300026088 | Ga0207641_10507707 | Ga0207641_105077072 | 190 |
| 410 | 3300026088 | Ga0207641_10881642 | Ga0207641_108816422 | 190 |
| 411 | 3300026089 | Ga0207648_10995945 | Ga0207648_109959451 | 190 |
| 412 | 3300026095 | Ga0207676_10125694 | Ga0207676_101256942 | 190 |
| 413 | 3300026121 | Ga0207683_10883269 | Ga0207683_108832692 | 190 |
| 414 | 3300026142 | Ga0207698_10000279 | Ga0207698_100002793 | 190 |
| 415 | 3300027866 | Ga0209813_10000240 | Ga0209813_1000024011 | 190 |
| 416 | 3300028379 | Ga0268266_10022326 | Ga0268266_100223268 | 190 |
| 417 | 3300028577 | Ga0265318_10042759 | Ga0265318_100427592 | 190 |
| 418 | 3300031250 | Ga0265331_10000641 | Ga0265331_1000064128 | 190 |
| 419 | 3300031548 | Ga0307408_100165099 | Ga0307408_1001650991 | 190 |
| 420 | 3300031595 | Ga0265313_10110726 | Ga0265313_101107262 | 190 |
| 421 | 3300031711 | Ga0265314_10384477 | Ga0265314_103844772 | 190 |
| 422 | 3300031911 | Ga0307412_10000991 | Ga0307412_1000099118 | 190 |
| 423 | 3300032002 | Ga0307416_100283338 | Ga0307416_1002833383 | 190 |
| 424 | 3300032004 | Ga0307414_10690160 | Ga0307414_106901602 | 190 |
| 425 | 3300039438 | Ga0436360_0394921 | Ga0436360_0394921_2420_3010 | 190 |
| 426 | 3300039447 | Ga0436361_0558812 | Ga0436361_0558812_517_1110 | 190 |
| 427 | 3300039447 | Ga0436361_0796148 | Ga0436361_0796148_505_1101 | 190 |
| 428 | 3300039447 | Ga0436361_0807596 | Ga0436361_0807596_1314_1907 | 190 |
| 429 | 3300039447 | Ga0436361_1115951 | Ga0436361_1115951_1538_2119 | 190 |
| 430 | 3300044719 | Ga0466971_0160381 | Ga0466971_0160381_399_977 | 190 |
| 431 | 3300045836 | Ga0466958_0002177 | Ga0466958_0002177_1478_2056 | 190 |
| 432 | 3300046452 | Ga0495617_001529 | Ga0495617_001529_2103_2678 | 190 |
| 433 | 3300046453 | Ga0495627_000225 | Ga0495627_000225_22435_23010 | 190 |
| 434 | 3300046453 | Ga0495627_000324 | Ga0495627_000324_20894_21466 | 190 |
| 435 | 3300046460 | Ga0495638_0000012 | Ga0495638_0000012_112029_112628 | 190 |
| 436 | 3300046471 | Ga0495650_0003357 | Ga0495650_0003357_8933_9505 | 190 |
| 437 | 3300046474 | Ga0495605_0238071 | Ga0495605_0238071_171_761 | 190 |
| 438 | 3300046491 | Ga0495584_0062213 | Ga0495584_0062213_525_1100 | 190 |
| 439 | 3300046506 | Ga0495583_0001198 | Ga0495583_0001198_14046_14645 | 190 |
| 440 | 3300046512 | Ga0495610_0000085 | Ga0495610_0000085_2469_3044 | 190 |
| 441 | 3300046512 | Ga0495610_0084972 | Ga0495610_0084972_138_710 | 190 |
| 442 | 3300046518 | Ga0495631_0144026 | Ga0495631_0144026_301_876 | 190 |
| 443 | 3300046519 | Ga0495632_0000013 | Ga0495632_0000013_142287_142862 | 190 |
| 444 | 3300046519 | Ga0495632_0000612 | Ga0495632_0000612_7130_7729 | 190 |
| 445 | 3300046520 | Ga0495637_0000100 | Ga0495637_0000100_25856_26431 | 190 |
| 446 | 3300046520 | Ga0495637_0004041 | Ga0495637_0004041_6826_7401 | 190 |
| 447 | 3300046522 | Ga0495643_0000010 | Ga0495643_0000010_280716_281291 | 190 |
| 448 | 3300046524 | Ga0495648_0000038 | Ga0495648_0000038_78985_79584 | 190 |
| 449 | 3300046524 | Ga0495648_0000933 | Ga0495648_0000933_15963_16535 | 190 |
| 450 | 3300046524 | Ga0495648_0013969 | Ga0495648_0013969_4022_4594 | 190 |
| 451 | 3300046525 | Ga0495663_0000004 | Ga0495663_0000004_249551_250126 | 190 |
| 452 | 3300046528 | Ga0495642_0051532 | Ga0495642_0051532_146_733 | 190 |
| 453 | 3300046528 | Ga0495642_0136290 | Ga0495642_0136290_169_759 | 190 |
| 454 | 3300046542 | Ga0495597_0030655 | Ga0495597_0030655_14_604 | 190 |
| 455 | 3300046558 | Ga0495633_0000092 | Ga0495633_0000092_117955_118527 | 190 |
| 456 | 3300046558 | Ga0495633_0001757 | Ga0495633_0001757_1309_1884 | 190 |
| 457 | 3300046558 | Ga0495633_0005139 | Ga0495633_0005139_2156_2755 | 190 |
| 458 | 3300046558 | Ga0495633_0024664 | Ga0495633_0024664_1398_1973 | 190 |
| 459 | 3300046684 | Ga0495669_0000042 | Ga0495669_0000042_78638_79228 | 190 |
| 460 | 3300046684 | Ga0495669_0321320 | Ga0495669_0321320_23_610 | 190 |
| 461 | 3300046692 | Ga0495671_0000014 | Ga0495671_0000014_280716_281291 | 190 |
| 462 | 3300046692 | Ga0495671_0000034 | Ga0495671_0000034_78407_79006 | 190 |
| 463 | 3300046692 | Ga0495671_0044633 | Ga0495671_0044633_1285_1860 | 190 |
| 464 | 3300047320 | Ga0495672_0019590 | Ga0495672_0019590_3022_3609 | 190 |
| 465 | 3300047445 | Ga0495677_0152105 | Ga0495677_0152105_260_847 | 190 |
| 466 | 3300047469 | Ga0495673_0000013 | Ga0495673_0000013_151108_151707 | 190 |
| 467 | 3300047469 | Ga0495673_0008628 | Ga0495673_0008628_2913_3485 | 190 |
| 468 | 3300047470 | Ga0495681_0000013 | Ga0495681_0000013_5512_6087 | 190 |
| 469 | 3300047470 | Ga0495681_0000725 | Ga0495681_0000725_8463_9038 | 190 |
| 470 | 3300047472 | Ga0495686_0043333 | Ga0495686_0043333_536_1111 | 190 |
| 471 | 3300047472 | Ga0495686_0084335 | Ga0495686_0084335_1207_1779 | 190 |
| 472 | 3300048906 | Ga0496103_0264954 | Ga0496103_0264954_174_761 | 190 |
| 473 | 3300048911 | Ga0496108_0003651 | Ga0496108_0003651_7901_8473 | 190 |
| 474 | 3300048911 | Ga0496108_0121547 | Ga0496108_0121547_1637_2224 | 190 |
| 475 | 3300048912 | Ga0496109_0038403 | Ga0496109_0038403_2760_3347 | 190 |
| 476 | 3300048913 | Ga0496110_0063103 | Ga0496110_0063103_1307_1879 | 190 |
| 477 | 3300048913 | Ga0496110_0237350 | Ga0496110_0237350_702_1289 | 190 |
| 478 | 3300048915 | Ga0496112_0506307 | Ga0496112_0506307_421_993 | 190 |
| 479 | 3300048916 | Ga0496113_0211684 | Ga0496113_0211684_736_1323 | 190 |
| 480 | 3300048919 | Ga0496116_0171870 | Ga0496116_0171870_488_1060 | 190 |
| 481 | 3300048924 | Ga0496121_0002040 | Ga0496121_0002040_21106_21678 | 190 |
| 482 | 3300048925 | Ga0496122_0009972 | Ga0496122_0009972_7006_7578 | 190 |
| 483 | 3300048926 | Ga0496123_0007161 | Ga0496123_0007161_8820_9392 | 190 |
| 484 | 3300048927 | Ga0496124_0025313 | Ga0496124_0025313_2676_3248 | 190 |
| 485 | 3300048927 | Ga0496124_0072512 | Ga0496124_0072512_920_1492 | 190 |
| 486 | 3300048928 | Ga0496125_0004828 | Ga0496125_0004828_530_1102 | 190 |
| 487 | 3300048928 | Ga0496125_0036346 | Ga0496125_0036346_1697_2269 | 190 |
| 488 | 3300048929 | Ga0496126_0033919 | Ga0496126_0033919_3828_4400 | 190 |
| 489 | 3300049571 | Ga0501034_0311610 | Ga0501034_0311610_49_627 | 190 |
| 490 | 3300049663 | Ga0501223_000008 | Ga0501223_000008_31549_32121 | 190 |
| 491 | 3300049676 | Ga0501246_000753 | Ga0501246_000753_843_1415 | 190 |
| 492 | 3300049705 | Ga0501225_0000046 | Ga0501225_0000046_29851_30423 | 190 |
| 493 | 3300049705 | Ga0501225_0019747 | Ga0501225_0019747_447_1019 | 190 |
| 494 | 3300049823 | Ga0501044_0118917 | Ga0501044_0118917_1392_1973 | 190 |
| 495 | 3300053087 | Ga0500643_019285 | Ga0500643_019285_745_1320 | 190 |
| 496 | 3300053108 | Ga0500562_001202 | Ga0500562_001202_622_1209 | 190 |
| 497 | 3300053156 | Ga0500622_0057238 | Ga0500622_0057238_699_1280 | 190 |
| 498 | 3300061719 | Ga0466962_0378169 | Ga0466962_0378169_99_677 | 190 |
| 499 | iso_pu_bacteria | 2522572158 | 2523105851 | 190 |
| 500 | iso_pu_bacteria | 2597490356 | 2599104485 | 190 |
| 501 | iso_pu_bacteria | 2846952575 | 2846956798 | 190 |
| 502 | iso_pu_bacteria | 2848858292 | 2848862481 | 190 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4heb-assembly1.cif.gz_A | the crystal structure of maf protein of bacillus subtilis | 0.9695 | 1 | 184 |
| 1exc-assembly1.cif.gz_A | crystal structure of b. subtilis maf protein complexed with d-(utp) | 0.9643 | 2 | 184 |
| 4heb-assembly1.cif.gz_A | the crystal structure of maf protein of bacillus subtilis | 0.9592 | 1 | 184 |
| 4heb-assembly1.cif.gz_B | the crystal structure of maf protein of bacillus subtilis | 0.956 | 2 | 188 |
| 4lu1-assembly1.cif.gz_B | crystal structure of the uncharacterized maf protein ycef from e. coli, mutant d69a | 0.9439 | 2 | 187 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hebA00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9695 | 1 | 184 | 3.90.950.10 |
| 4hebA00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9592 | 1 | 184 | 3.90.950.10 |
| 4lu1B00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9439 | 2 | 187 | 3.90.950.10 |
| 4p0uA00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9386 | 3 | 188 | 3.90.950.10 |
| 4p0uA00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9289 | 3 | 188 | 3.90.950.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A5VDT8-F1-model_v4 | deleted | 0.9954 | 3 | 190 |
|
| AF-A0A7L9RSW7-F1-model_v4 | Nucleoside triphosphate pyrophosphatase (EC 3.6.1.9) (Nucleotide pyrophosphatase) (Nucleotide PPase) | 0.9933 | 2 | 187 |
GO:0005737
GO:0009117 GO:0047429 |
| AF-A0A838VA29-F1-model_v4 | dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) | 0.9932 | 2 | 190 |
GO:0005737
GO:0009117 GO:0047429 |
| AF-A0A843RJH7-F1-model_v4 | dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) | 0.9923 | 2 | 188 |
GO:0005737
GO:0009117 GO:0047429 |
| AF-A0A1Z8Q2P4-F1-model_v4 | dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) | 0.9918 | 2 | 187 |
GO:0005737
GO:0009117 GO:0036218 GO:0036221 GO:0106379 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar