F455663
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 501 | 292 | 495 | 382 |
Family's Representative Sequence
| Representative Sequence | 3300005617|Ga0068859_100041778|Ga0068859_1000417783 |
| Length | 452 |
| Sequence | MSILGNISRCEWPSSKRKEENEPWARVPHFCDFLPRRSLLVVFCYGLPFQQSASAARKWIEMNEIAALPQSILPSGIRSRFVRDVNGLKMHILEAGFEAGTGSNGKPLVLLLHGFPELAYSWRKVMLPLAAAGYHVVAPDQRGYGRTTGWDGNFDGNVASFRMLNLVRDTLALVSALGCRTVDGLFGHDAGSHVAAWCSLIRPDVFRSVAMMSAPFGGAPQLPFNTDSDGSQKARDSIHEDLAALKRPRKHYQWYYSTRPANDDMWKCRQGVHAFMRAYYHHKSADWKQNQPFPLKSWTAGELEKMPTYYIMDLDENMAETVAKEMPSASEIAANKWLPDSELALYAEEYGRNGYQGGLQWYRCNTTGANSTELQLFSGRTIDVPSCFIAGKSDWGIYQRPGGDMIAMQKHAVTNMLGCHLVEGAGHWVQQEQPGKVSELLLEFLRHTRSKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 2 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 3 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 4 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 5 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 64 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 109 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 110 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 111 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 165 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 166 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 167 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 168 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 169 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 170 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 171 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 172 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 175 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 179 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 189 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 190 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 191 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 192 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 193 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 194 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 195 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 196 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 197 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 198 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 230 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 231 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 232 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 233 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 234 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 235 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 236 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 256 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 257 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 258 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 259 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 260 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 261 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 270 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 275 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 276 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 277 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 278 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 279 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 280 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 281 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 282 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 283 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 284 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 285 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 287 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 288 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 289 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 292 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.8 |
| Metatranscriptomes | 0 |
| Isolates | 1.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.58 |
| Nodule | 0.4 |
| Rhizoplane | 1.6 |
| Rhizosphere | 81.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000058 | 3300003203 | Bacteria | 50229 |
| 2 | JGI25405J52794_10007987 | 3300003911 | Bacteria | 1965 |
| 3 | Ga0065707_10003366 | 3300005295 | Bacteria | 4393 |
| 4 | Ga0065707_10121253 | 3300005295 | Bacteria | 2114 |
| 5 | Ga0070676_10026301 | 3300005328 | Bacteria | 3294 |
| 6 | Ga0070690_100003927 | 3300005330 | Bacteria | 8203 |
| 7 | Ga0070677_10013826 | 3300005333 | Bacteria | 2832 |
| 8 | Ga0068869_100001195 | 3300005334 | Bacteria | 15252 |
| 9 | Ga0068869_100049375 | 3300005334 | Bacteria | 3045 |
| 10 | Ga0068869_100177068 | 3300005334 | Bacteria | 1670 |
| 11 | Ga0070666_10003619 | 3300005335 | Bacteria | 9369 |
| 12 | Ga0070680_100089070 | 3300005336 | Bacteria | 2554 |
| 13 | Ga0068868_100011557 | 3300005338 | Bacteria | 6431 |
| 14 | Ga0068868_100021668 | 3300005338 | Bacteria | 4841 |
| 15 | Ga0070689_100184107 | 3300005340 | Bacteria | 1698 |
| 16 | Ga0070691_10021482 | 3300005341 | Bacteria | 2987 |
| 17 | Ga0070691_10031683 | 3300005341 | Bacteria | 2481 |
| 18 | Ga0070692_10003405 | 3300005345 | Bacteria | 6448 |
| 19 | Ga0070692_10012980 | 3300005345 | Bacteria | 3873 |
| 20 | Ga0070669_100014354 | 3300005353 | Bacteria | 5637 |
| 21 | Ga0070669_100023153 | 3300005353 | Bacteria | 4446 |
| 22 | Ga0070675_100016931 | 3300005354 | Bacteria | 5789 |
| 23 | Ga0070671_100024353 | 3300005355 | Bacteria | 4955 |
| 24 | Ga0070673_100058159 | 3300005364 | Bacteria | 3056 |
| 25 | Ga0070709_10028368 | 3300005434 | Bacteria | 3337 |
| 26 | Ga0070709_10034439 | 3300005434 | Bacteria | 3070 |
| 27 | Ga0070714_100055371 | 3300005435 | Bacteria | 3389 |
| 28 | Ga0070714_100064531 | 3300005435 | Bacteria | 3152 |
| 29 | Ga0070714_100148537 | 3300005435 | Bacteria | 2110 |
| 30 | Ga0070714_100250738 | 3300005435 | Bacteria | 1637 |
| 31 | Ga0070713_100002801 | 3300005436 | Bacteria | 11398 |
| 32 | Ga0070713_100050811 | 3300005436 | Bacteria | 3426 |
| 33 | Ga0070713_100056034 | 3300005436 | Bacteria | 3278 |
| 34 | Ga0070713_100169604 | 3300005436 | Bacteria | 1954 |
| 35 | Ga0070701_10014671 | 3300005438 | Bacteria | 3598 |
| 36 | Ga0070711_100179781 | 3300005439 | Bacteria | 1619 |
| 37 | Ga0070700_100003099 | 3300005441 | Bacteria | 8522 |
| 38 | Ga0070700_100008396 | 3300005441 | Bacteria | 5625 |
| 39 | Ga0070700_100070856 | 3300005441 | Bacteria | 2224 |
| 40 | Ga0070694_100020570 | 3300005444 | Bacteria | 4209 |
| 41 | Ga0070694_100036434 | 3300005444 | Bacteria | 3259 |
| 42 | Ga0070694_100260925 | 3300005444 | Bacteria | 1314 |
| 43 | Ga0070708_100021532 | 3300005445 | Bacteria | 5452 |
| 44 | Ga0070678_100031048 | 3300005456 | Bacteria | 3680 |
| 45 | Ga0070678_100174417 | 3300005456 | Bacteria | 1754 |
| 46 | Ga0070662_100019056 | 3300005457 | Bacteria | 4653 |
| 47 | Ga0070681_10020967 | 3300005458 | Bacteria | 6547 |
| 48 | Ga0070681_10052162 | 3300005458 | Bacteria | 4079 |
| 49 | Ga0068867_100005100 | 3300005459 | Bacteria | 9283 |
| 50 | Ga0068867_100007205 | 3300005459 | Bacteria | 7862 |
| 51 | Ga0068867_100026669 | 3300005459 | Bacteria | 4149 |
| 52 | Ga0070706_100295150 | 3300005467 | Bacteria | 1513 |
| 53 | Ga0070698_100003223 | 3300005471 | Bacteria | 17975 |
| 54 | Ga0070698_100022570 | 3300005471 | Bacteria | 6582 |
| 55 | Ga0070699_100021812 | 3300005518 | Bacteria | 5520 |
| 56 | Ga0070699_100158141 | 3300005518 | Bacteria | 2005 |
| 57 | Ga0070697_100015876 | 3300005536 | Bacteria | 5916 |
| 58 | Ga0068853_100038928 | 3300005539 | Bacteria | 4053 |
| 59 | Ga0070672_100008668 | 3300005543 | Bacteria | 6972 |
| 60 | Ga0070686_100022109 | 3300005544 | Bacteria | 3785 |
| 61 | Ga0070695_100013074 | 3300005545 | Bacteria | 4987 |
| 62 | Ga0070695_100051908 | 3300005545 | Bacteria | 2633 |
| 63 | Ga0070696_100065169 | 3300005546 | Bacteria | 2553 |
| 64 | Ga0070696_100169321 | 3300005546 | Bacteria | 1614 |
| 65 | Ga0070696_100202890 | 3300005546 | Bacteria | 1481 |
| 66 | Ga0070693_100016380 | 3300005547 | Bacteria | 3836 |
| 67 | Ga0070665_100281470 | 3300005548 | Bacteria | 1665 |
| 68 | Ga0070704_100020278 | 3300005549 | Bacteria | 4284 |
| 69 | Ga0070704_100033403 | 3300005549 | Bacteria | 3478 |
| 70 | Ga0070704_100238825 | 3300005549 | Bacteria | 1486 |
| 71 | Ga0070704_100239765 | 3300005549 | Bacteria | 1483 |
| 72 | Ga0068857_100014788 | 3300005577 | Bacteria | 6809 |
| 73 | Ga0068857_100019680 | 3300005577 | Bacteria | 5930 |
| 74 | Ga0068856_100089186 | 3300005614 | Bacteria | 3066 |
| 75 | Ga0070702_100001167 | 3300005615 | Bacteria | 10571 |
| 76 | Ga0068852_100176150 | 3300005616 | Bacteria | 2008 |
| 77 | Ga0068852_100283758 | 3300005616 | Bacteria | 1597 |
| 78 | Ga0068859_100041778 | 3300005617 | Bacteria | 4605 |
| 79 | Ga0068859_100133541 | 3300005617 | Bacteria | 2554 |
| 80 | Ga0068859_100158028 | 3300005617 | Bacteria | 2345 |
| 81 | Ga0068864_100007047 | 3300005618 | Bacteria | 9229 |
| 82 | Ga0068864_100128738 | 3300005618 | Bacteria | 2271 |
| 83 | Ga0068866_10002399 | 3300005718 | Bacteria | 7756 |
| 84 | Ga0068866_10023305 | 3300005718 | Bacteria | 2878 |
| 85 | Ga0068866_10185289 | 3300005718 | Bacteria | 1232 |
| 86 | Ga0068861_100001889 | 3300005719 | Bacteria | 13486 |
| 87 | Ga0068861_100062769 | 3300005719 | Bacteria | 2854 |
| 88 | Ga0068863_100167799 | 3300005841 | Bacteria | 2105 |
| 89 | Ga0068863_100238704 | 3300005841 | Bacteria | 1754 |
| 90 | Ga0068863_100390603 | 3300005841 | Bacteria | 1360 |
| 91 | Ga0068858_100004481 | 3300005842 | Bacteria | 13691 |
| 92 | Ga0068858_100009495 | 3300005842 | Bacteria | 9281 |
| 93 | Ga0068858_100059318 | 3300005842 | Bacteria | 3537 |
| 94 | Ga0068858_100400559 | 3300005842 | Bacteria | 1319 |
| 95 | Ga0068860_100000313 | 3300005843 | Bacteria | 66545 |
| 96 | Ga0068860_100001386 | 3300005843 | Bacteria | 26300 |
| 97 | Ga0068860_100022843 | 3300005843 | Bacteria | 6049 |
| 98 | Ga0068860_100209283 | 3300005843 | Bacteria | 1892 |
| 99 | Ga0068860_100334697 | 3300005843 | Bacteria | 1487 |
| 100 | Ga0068862_100006449 | 3300005844 | Bacteria | 9748 |
| 101 | Ga0068862_100022960 | 3300005844 | Bacteria | 5224 |
| 102 | Ga0068862_100025183 | 3300005844 | Bacteria | 4995 |
| 103 | Ga0081455_10000451 | 3300005937 | Bacteria | 54150 |
| 104 | Ga0081455_10046474 | 3300005937 | Bacteria | 3765 |
| 105 | Ga0081540_1012873 | 3300005983 | Bacteria | 5471 |
| 106 | Ga0081539_10000825 | 3300005985 | Bacteria | 59902 |
| 107 | Ga0081539_10006413 | 3300005985 | Bacteria | 11301 |
| 108 | Ga0081539_10068231 | 3300005985 | Bacteria | 1920 |
| 109 | Ga0075365_10059380 | 3300006038 | Bacteria | 2549 |
| 110 | Ga0075365_10089653 | 3300006038 | Bacteria | 2094 |
| 111 | Ga0075368_10027596 | 3300006042 | Bacteria | 2191 |
| 112 | Ga0075363_100041743 | 3300006048 | Bacteria | 2420 |
| 113 | Ga0075364_10033775 | 3300006051 | Bacteria | 3296 |
| 114 | Ga0075364_10079093 | 3300006051 | Bacteria | 2172 |
| 115 | Ga0070715_10007955 | 3300006163 | Bacteria | 3674 |
| 116 | Ga0070716_100153519 | 3300006173 | Bacteria | 1484 |
| 117 | Ga0070712_100007322 | 3300006175 | Bacteria | 6888 |
| 118 | Ga0070712_100011749 | 3300006175 | Bacteria | 5565 |
| 119 | Ga0075362_10005399 | 3300006177 | Bacteria | 4673 |
| 120 | Ga0075362_10015806 | 3300006177 | Bacteria | 3077 |
| 121 | Ga0075362_10037140 | 3300006177 | Bacteria | 2134 |
| 122 | Ga0075362_10061775 | 3300006177 | Bacteria | 1696 |
| 123 | Ga0075367_10027695 | 3300006178 | Bacteria | 3226 |
| 124 | Ga0075369_10000203 | 3300006186 | Bacteria | 17437 |
| 125 | Ga0075369_10041196 | 3300006186 | Bacteria | 1977 |
| 126 | Ga0075427_10009740 | 3300006194 | Bacteria | 1432 |
| 127 | Ga0097621_100002301 | 3300006237 | Bacteria | 13083 |
| 128 | Ga0097621_100013606 | 3300006237 | Bacteria | 6070 |
| 129 | Ga0097621_100153503 | 3300006237 | Bacteria | 1975 |
| 130 | Ga0075370_10053310 | 3300006353 | Bacteria | 2295 |
| 131 | Ga0075370_10124178 | 3300006353 | Bacteria | 1504 |
| 132 | Ga0068871_100012897 | 3300006358 | Bacteria | 6189 |
| 133 | Ga0068871_100072402 | 3300006358 | Bacteria | 2838 |
| 134 | Ga0075428_100016657 | 3300006844 | Bacteria | 8117 |
| 135 | Ga0075428_100111069 | 3300006844 | Bacteria | 2987 |
| 136 | Ga0075430_100157470 | 3300006846 | Bacteria | 1890 |
| 137 | Ga0075431_100039880 | 3300006847 | Bacteria | 4838 |
| 138 | Ga0075433_10240602 | 3300006852 | Bacteria | 1607 |
| 139 | Ga0075434_100378848 | 3300006871 | Bacteria | 1436 |
| 140 | Ga0075429_100000151 | 3300006880 | Bacteria | 43094 |
| 141 | Ga0068865_100000472 | 3300006881 | Bacteria | 22488 |
| 142 | Ga0068865_100004561 | 3300006881 | Bacteria | 8358 |
| 143 | Ga0068865_100163761 | 3300006881 | Bacteria | 1699 |
| 144 | Ga0097620_100041779 | 3300006931 | Bacteria | 4605 |
| 145 | Ga0097620_100133536 | 3300006931 | Bacteria | 2554 |
| 146 | Ga0097620_100158035 | 3300006931 | Bacteria | 2345 |
| 147 | Ga0075435_100042169 | 3300007076 | Bacteria | 3650 |
| 148 | Ga0099795_10066988 | 3300007788 | Bacteria | 1346 |
| 149 | Ga0105240_10140606 | 3300009093 | Bacteria | 2886 |
| 150 | Ga0111539_10321175 | 3300009094 | Bacteria | 1802 |
| 151 | Ga0105245_10010186 | 3300009098 | Bacteria | 8185 |
| 152 | Ga0105245_10150395 | 3300009098 | Bacteria | 2201 |
| 153 | Ga0114129_10005868 | 3300009147 | Bacteria | 17387 |
| 154 | Ga0114129_10007243 | 3300009147 | Bacteria | 15794 |
| 155 | Ga0105243_10006693 | 3300009148 | Bacteria | 8897 |
| 156 | Ga0105243_10103162 | 3300009148 | Bacteria | 2371 |
| 157 | Ga0105241_10013313 | 3300009174 | Bacteria | 6029 |
| 158 | Ga0105241_10211803 | 3300009174 | Bacteria | 1624 |
| 159 | Ga0105242_10001815 | 3300009176 | Bacteria | 16772 |
| 160 | Ga0105242_10006305 | 3300009176 | Bacteria | 9138 |
| 161 | Ga0105242_10048360 | 3300009176 | Bacteria | 3457 |
| 162 | Ga0105242_10209935 | 3300009176 | Bacteria | 1735 |
| 163 | Ga0105242_10241072 | 3300009176 | Bacteria | 1625 |
| 164 | Ga0105248_10125514 | 3300009177 | Bacteria | 2896 |
| 165 | Ga0105248_10192203 | 3300009177 | Bacteria | 2300 |
| 166 | Ga0105237_10115208 | 3300009545 | Bacteria | 2681 |
| 167 | Ga0105238_10132272 | 3300009551 | Bacteria | 2473 |
| 168 | Ga0105249_10011488 | 3300009553 | Bacteria | 7778 |
| 169 | Ga0105249_10027333 | 3300009553 | Bacteria | 5147 |
| 170 | Ga0105249_10059545 | 3300009553 | Bacteria | 3502 |
| 171 | Ga0105249_10254007 | 3300009553 | Bacteria | 1744 |
| 172 | Ga0105246_10018942 | 3300011119 | Bacteria | 4391 |
| 173 | Ga0157374_10009574 | 3300013296 | Bacteria | 8321 |
| 174 | Ga0157374_10102862 | 3300013296 | Bacteria | 2740 |
| 175 | Ga0157378_10010502 | 3300013297 | Bacteria | 8091 |
| 176 | Ga0157378_10019923 | 3300013297 | Bacteria | 5898 |
| 177 | Ga0157378_10027251 | 3300013297 | Bacteria | 5043 |
| 178 | Ga0163162_10015589 | 3300013306 | Bacteria | 7427 |
| 179 | Ga0163162_10023144 | 3300013306 | Bacteria | 6128 |
| 180 | Ga0163162_10037972 | 3300013306 | Bacteria | 4807 |
| 181 | Ga0163162_10070977 | 3300013306 | Bacteria | 3535 |
| 182 | Ga0157375_10008755 | 3300013308 | Bacteria | 8867 |
| 183 | Ga0157375_10058170 | 3300013308 | Bacteria | 3824 |
| 184 | Ga0157375_10229291 | 3300013308 | Bacteria | 2016 |
| 185 | Ga0163163_10096046 | 3300014325 | Bacteria | 2984 |
| 186 | Ga0157380_10010371 | 3300014326 | Bacteria | 6701 |
| 187 | Ga0157380_10011956 | 3300014326 | Bacteria | 6280 |
| 188 | Ga0157377_10006406 | 3300014745 | Bacteria | 5612 |
| 189 | Ga0157379_10006093 | 3300014968 | Bacteria | 10385 |
| 190 | Ga0157379_10059456 | 3300014968 | Bacteria | 3417 |
| 191 | Ga0157376_10050960 | 3300014969 | Bacteria | 3436 |
| 192 | Ga0163161_10016276 | 3300017792 | Bacteria | 5191 |
| 193 | Ga0213874_10018287 | 3300021377 | Bacteria | 1892 |
| 194 | Ga0213875_10000142 | 3300021388 | Bacteria | 77423 |
| 195 | Ga0213875_10005326 | 3300021388 | Bacteria | 6918 |
| 196 | Ga0213875_10008093 | 3300021388 | Bacteria | 5401 |
| 197 | Ga0213875_10025079 | 3300021388 | Bacteria | 2842 |
| 198 | Ga0213875_10090362 | 3300021388 | Bacteria | 1428 |
| 199 | Ga0213871_10004269 | 3300021441 | Bacteria | 2846 |
| 200 | Ga0213871_10025622 | 3300021441 | Bacteria | 1503 |
| 201 | Ga0209455_1001457 | 3300025272 | Bacteria | 10642 |
| 202 | Ga0207692_10074710 | 3300025898 | Bacteria | 1796 |
| 203 | Ga0207642_10017333 | 3300025899 | Bacteria | 2737 |
| 204 | Ga0207642_10030768 | 3300025899 | Bacteria | 2240 |
| 205 | Ga0207642_10032089 | 3300025899 | Bacteria | 2208 |
| 206 | Ga0207688_10106974 | 3300025901 | Bacteria | 1621 |
| 207 | Ga0207680_10002188 | 3300025903 | Bacteria | 9160 |
| 208 | Ga0207685_10015454 | 3300025905 | Bacteria | 2418 |
| 209 | Ga0207699_10025430 | 3300025906 | Bacteria | 3250 |
| 210 | Ga0207699_10050228 | 3300025906 | Bacteria | 2458 |
| 211 | Ga0207699_10176891 | 3300025906 | Bacteria | 1432 |
| 212 | Ga0207643_10017180 | 3300025908 | Bacteria | 3952 |
| 213 | Ga0207654_10039369 | 3300025911 | Bacteria | 2658 |
| 214 | Ga0207707_10039135 | 3300025912 | Bacteria | 4145 |
| 215 | Ga0207707_10153199 | 3300025912 | Bacteria | 2015 |
| 216 | Ga0207671_10013702 | 3300025914 | Bacteria | 6441 |
| 217 | Ga0207693_10000731 | 3300025915 | Bacteria | 29597 |
| 218 | Ga0207693_10051739 | 3300025915 | Bacteria | 3222 |
| 219 | Ga0207663_10016954 | 3300025916 | Bacteria | 4050 |
| 220 | Ga0207660_10015559 | 3300025917 | Bacteria | 5022 |
| 221 | Ga0207662_10011885 | 3300025918 | Bacteria | 4839 |
| 222 | Ga0207657_10288496 | 3300025919 | Bacteria | 1302 |
| 223 | Ga0207646_10005709 | 3300025922 | Bacteria | 13053 |
| 224 | Ga0207646_10038818 | 3300025922 | Bacteria | 4286 |
| 225 | Ga0207681_10008173 | 3300025923 | Bacteria | 6398 |
| 226 | Ga0207681_10017575 | 3300025923 | Bacteria | 4493 |
| 227 | Ga0207694_10166316 | 3300025924 | Bacteria | 1784 |
| 228 | Ga0207650_10164278 | 3300025925 | Bacteria | 1761 |
| 229 | Ga0207659_10015574 | 3300025926 | Bacteria | 4931 |
| 230 | Ga0207687_10012803 | 3300025927 | Bacteria | 5482 |
| 231 | Ga0207700_10006286 | 3300025928 | Bacteria | 7168 |
| 232 | Ga0207700_10068288 | 3300025928 | Bacteria | 2724 |
| 233 | Ga0207700_10255619 | 3300025928 | Bacteria | 1498 |
| 234 | Ga0207664_10023830 | 3300025929 | Bacteria | 4593 |
| 235 | Ga0207664_10128778 | 3300025929 | Bacteria | 2128 |
| 236 | Ga0207664_10162079 | 3300025929 | Bacteria | 1908 |
| 237 | Ga0207664_10317095 | 3300025929 | Bacteria | 1375 |
| 238 | Ga0207706_10077963 | 3300025933 | Bacteria | 2914 |
| 239 | Ga0207686_10002624 | 3300025934 | Bacteria | 9757 |
| 240 | Ga0207686_10007535 | 3300025934 | Bacteria | 5859 |
| 241 | Ga0207686_10134370 | 3300025934 | Bacteria | 1701 |
| 242 | Ga0207709_10020293 | 3300025935 | Bacteria | 3747 |
| 243 | Ga0207704_10024120 | 3300025938 | Bacteria | 3292 |
| 244 | Ga0207665_10216522 | 3300025939 | Bacteria | 1402 |
| 245 | Ga0207691_10028481 | 3300025940 | Bacteria | 5231 |
| 246 | Ga0207711_10073488 | 3300025941 | Bacteria | 2972 |
| 247 | Ga0207689_10000764 | 3300025942 | Bacteria | 30878 |
| 248 | Ga0207689_10018757 | 3300025942 | Bacteria | 5834 |
| 249 | Ga0207689_10183536 | 3300025942 | Bacteria | 1725 |
| 250 | Ga0207651_10006357 | 3300025960 | Bacteria | 6175 |
| 251 | Ga0207712_10009102 | 3300025961 | Bacteria | 6280 |
| 252 | Ga0207712_10009110 | 3300025961 | Bacteria | 6279 |
| 253 | Ga0207712_10070376 | 3300025961 | Bacteria | 2513 |
| 254 | Ga0207668_10159998 | 3300025972 | Bacteria | 1754 |
| 255 | Ga0207658_10034297 | 3300025986 | Bacteria | 3627 |
| 256 | Ga0207658_10038501 | 3300025986 | Bacteria | 3445 |
| 257 | Ga0207677_10002924 | 3300026023 | Bacteria | 9022 |
| 258 | Ga0207677_10112075 | 3300026023 | Bacteria | 2034 |
| 259 | Ga0207703_10006634 | 3300026035 | Bacteria | 9235 |
| 260 | Ga0207703_10017073 | 3300026035 | Bacteria | 5660 |
| 261 | Ga0207703_10045431 | 3300026035 | Bacteria | 3533 |
| 262 | Ga0207703_10290056 | 3300026035 | Bacteria | 1489 |
| 263 | Ga0207639_10003184 | 3300026041 | Bacteria | 11034 |
| 264 | Ga0207708_10000350 | 3300026075 | Bacteria | 36165 |
| 265 | Ga0207708_10013010 | 3300026075 | Bacteria | 6208 |
| 266 | Ga0207708_10014041 | 3300026075 | Bacteria | 5984 |
| 267 | Ga0207708_10015435 | 3300026075 | Bacteria | 5729 |
| 268 | Ga0207708_10118214 | 3300026075 | Bacteria | 2064 |
| 269 | Ga0207702_10029793 | 3300026078 | Bacteria | 4543 |
| 270 | Ga0207702_10053924 | 3300026078 | Bacteria | 3405 |
| 271 | Ga0207641_10012029 | 3300026088 | Bacteria | 7100 |
| 272 | Ga0207648_10000730 | 3300026089 | Bacteria | 36815 |
| 273 | Ga0207648_10001237 | 3300026089 | Bacteria | 28700 |
| 274 | Ga0207648_10039687 | 3300026089 | Bacteria | 4138 |
| 275 | Ga0207676_10001503 | 3300026095 | Bacteria | 17221 |
| 276 | Ga0207674_10036532 | 3300026116 | Bacteria | 5116 |
| 277 | Ga0207674_10194140 | 3300026116 | Bacteria | 1980 |
| 278 | Ga0207675_100000407 | 3300026118 | Bacteria | 41288 |
| 279 | Ga0207675_100001346 | 3300026118 | Bacteria | 24652 |
| 280 | Ga0207683_10027278 | 3300026121 | Bacteria | 4935 |
| 281 | Ga0207683_10046223 | 3300026121 | Bacteria | 3809 |
| 282 | Ga0207683_10087355 | 3300026121 | Bacteria | 2773 |
| 283 | Ga0207683_10091832 | 3300026121 | Bacteria | 2705 |
| 284 | Ga0207428_10032808 | 3300027907 | Bacteria | 4270 |
| 285 | Ga0207428_10037743 | 3300027907 | Bacteria | 3929 |
| 286 | Ga0268265_10005960 | 3300028380 | Bacteria | 8298 |
| 287 | Ga0268265_10072200 | 3300028380 | Bacteria | 2691 |
| 288 | Ga0268264_10000356 | 3300028381 | Bacteria | 68810 |
| 289 | Ga0268264_10014230 | 3300028381 | Bacteria | 6542 |
| 290 | Ga0268264_10123268 | 3300028381 | Bacteria | 2287 |
| 291 | Ga0268264_10260031 | 3300028381 | Bacteria | 1616 |
| 292 | Ga0265334_10004817 | 3300028573 | Bacteria | 5931 |
| 293 | Ga0307517_10001421 | 3300028786 | Bacteria | 40285 |
| 294 | Ga0265338_10079084 | 3300028800 | Bacteria | 2769 |
| 295 | Ga0307511_10000851 | 3300030521 | Bacteria | 32500 |
| 296 | Ga0307512_10070975 | 3300030522 | Bacteria | 2589 |
| 297 | Ga0307513_10066845 | 3300031456 | Bacteria | 3775 |
| 298 | Ga0307513_10167661 | 3300031456 | Bacteria | 2078 |
| 299 | Ga0307509_10000577 | 3300031507 | Bacteria | 62808 |
| 300 | Ga0307509_10090777 | 3300031507 | Bacteria | 3129 |
| 301 | Ga0307508_10015555 | 3300031616 | Bacteria | 6931 |
| 302 | Ga0307508_10046506 | 3300031616 | Bacteria | 3874 |
| 303 | Ga0307516_10139534 | 3300031730 | Bacteria | 2195 |
| 304 | Ga0307510_10029719 | 3300033180 | Bacteria | 6213 |
| 305 | Ga0307510_10038105 | 3300033180 | Bacteria | 5319 |
| 306 | Ga0373944_0028237 | 3300035089 | Bacteria | 1669 |
| 307 | Ga0373932_0021898 | 3300035112 | Bacteria | 1692 |
| 308 | Ga0373954_0023472 | 3300035118 | Bacteria | 2805 |
| 309 | Ga0373957_0042354 | 3300035120 | Bacteria | 1718 |
| 310 | Ga0373943_0040716 | 3300035170 | Bacteria | 2244 |
| 311 | Ga0373943_0158283 | 3300035170 | Bacteria | 1231 |
| 312 | Ga0373946_0110645 | 3300035171 | Bacteria | 1243 |
| 313 | Ga0373961_0049954 | 3300035241 | Bacteria | 1238 |
| 314 | Ga0316574_0032652 | 3300035398 | Bacteria | 3164 |
| 315 | Ga0373931_0099728 | 3300035691 | Bacteria | 1632 |
| 316 | Ga0373935_0057807 | 3300035692 | Bacteria | 2475 |
| 317 | Ga0373935_0112390 | 3300035692 | Bacteria | 1809 |
| 318 | Ga0373935_0166581 | 3300035692 | Bacteria | 1505 |
| 319 | Ga0373935_0359414 | 3300035692 | Bacteria | 1039 |
| 320 | Ga0373927_0006414 | 3300035695 | Bacteria | 8017 |
| 321 | Ga0373927_0018488 | 3300035695 | Unclassified | 4580 |
| 322 | Ga0373927_0157624 | 3300035695 | Bacteria | 1487 |
| 323 | Ga0373933_0023555 | 3300035724 | Bacteria | 3519 |
| 324 | Ga0373933_0063090 | 3300035724 | Bacteria | 2239 |
| 325 | Ga0373933_0147125 | 3300035724 | Bacteria | 1490 |
| 326 | Ga0373947_0057500 | 3300035725 | Bacteria | 2354 |
| 327 | Ga0373937_0000638 | 3300036401 | Bacteria | 30717 |
| 328 | Ga0373937_0008736 | 3300036401 | Bacteria | 8794 |
| 329 | Ga0373937_0011341 | 3300036401 | Bacteria | 7819 |
| 330 | Ga0373937_0043537 | 3300036401 | Bacteria | 4099 |
| 331 | Ga0373937_0044524 | 3300036401 | Bacteria | 4054 |
| 332 | Ga0373937_0053855 | 3300036401 | Bacteria | 3690 |
| 333 | Ga0373937_0174427 | 3300036401 | Bacteria | 2018 |
| 334 | Ga0373937_0198363 | 3300036401 | Bacteria | 1886 |
| 335 | Ga0373925_0001876 | 3300037068 | Bacteria | 17464 |
| 336 | Ga0373925_0017714 | 3300037068 | Bacteria | 5168 |
| 337 | Ga0373925_0050850 | 3300037068 | Bacteria | 3092 |
| 338 | Ga0373925_0061328 | 3300037068 | Bacteria | 2825 |
| 339 | Ga0373925_0079034 | 3300037068 | Bacteria | 2498 |
| 340 | Ga0395899_0180156 | 3300037312 | Bacteria | 1484 |
| 341 | Ga0395905_0086452 | 3300037471 | Bacteria | 2939 |
| 342 | Ga0436364_0018110 | 3300037853 | Bacteria | 2598 |
| 343 | Ga0436364_0135272 | 3300037853 | Bacteria | 9918 |
| 344 | Ga0436364_0766585 | 3300037853 | Bacteria | 21589 |
| 345 | Ga0436364_1127111 | 3300037853 | Bacteria | 4770 |
| 346 | Ga0436364_1128085 | 3300037853 | Bacteria | 1693 |
| 347 | Ga0436364_1271676 | 3300037853 | Bacteria | 6329 |
| 348 | Ga0400483_090459 | 3300039062 | Bacteria | 4418 |
| 349 | Ga0400483_176188 | 3300039062 | Bacteria | 10728 |
| 350 | Ga0436365_0085725 | 3300039437 | Bacteria | 7823 |
| 351 | Ga0436365_0118087 | 3300039437 | Bacteria | 14166 |
| 352 | Ga0436365_0776181 | 3300039437 | Bacteria | 2974 |
| 353 | Ga0436365_1598157 | 3300039437 | Bacteria | 2502 |
| 354 | Ga0436365_1850857 | 3300039437 | Bacteria | 1760 |
| 355 | Ga0436361_0930897 | 3300039447 | Bacteria | 3211 |
| 356 | Ga0436361_0935188 | 3300039447 | Bacteria | 4569 |
| 357 | Ga0436363_0537438 | 3300039450 | Bacteria | 3191 |
| 358 | Ga0436362_0329416 | 3300039453 | Bacteria | 4201 |
| 359 | Ga0436362_1127920 | 3300039453 | Bacteria | 4435 |
| 360 | Ga0436362_1222155 | 3300039453 | Bacteria | 2034 |
| 361 | Ga0439465_0028803 | 3300041413 | Bacteria | 1763 |
| 362 | Ga0439465_0029248 | 3300041413 | Bacteria | 1750 |
| 363 | Ga0439441_000035 | 3300042001 | Bacteria | 9994 |
| 364 | Ga0453683_0176282 | 3300044673 | Bacteria | 1355 |
| 365 | Ga0466963_0275811 | 3300044694 | Bacteria | 1181 |
| 366 | Ga0466959_0042292 | 3300045049 | Bacteria | 3361 |
| 367 | Ga0495592_0000142 | 3300046454 | Bacteria | 63571 |
| 368 | Ga0495592_0041123 | 3300046454 | Bacteria | 3465 |
| 369 | Ga0495638_0126601 | 3300046460 | Bacteria | 1505 |
| 370 | Ga0495653_0145315 | 3300046463 | Bacteria | 1663 |
| 371 | Ga0495664_0023853 | 3300046477 | Bacteria | 3552 |
| 372 | Ga0495608_0000890 | 3300046511 | Bacteria | 20925 |
| 373 | Ga0495608_0007116 | 3300046511 | Bacteria | 7914 |
| 374 | Ga0495608_0154560 | 3300046511 | Bacteria | 1461 |
| 375 | Ga0495610_0030843 | 3300046512 | Bacteria | 2803 |
| 376 | Ga0495618_0255463 | 3300046514 | Bacteria | 1098 |
| 377 | Ga0495628_0040199 | 3300046516 | Bacteria | 3738 |
| 378 | Ga0495640_0021402 | 3300046533 | Bacteria | 4746 |
| 379 | Ga0495640_0029322 | 3300046533 | Bacteria | 3952 |
| 380 | Ga0495640_0138882 | 3300046533 | Bacteria | 1567 |
| 381 | Ga0495587_0002800 | 3300046536 | Bacteria | 11657 |
| 382 | Ga0495598_0024323 | 3300046537 | Bacteria | 1641 |
| 383 | Ga0495645_0043278 | 3300046543 | Bacteria | 3284 |
| 384 | Ga0495622_0023739 | 3300046557 | Bacteria | 2861 |
| 385 | Ga0495667_0003101 | 3300046559 | Bacteria | 11146 |
| 386 | Ga0495656_0000565 | 3300046615 | Bacteria | 12114 |
| 387 | Ga0495668_0112399 | 3300046616 | Bacteria | 1490 |
| 388 | Ga0495623_0133341 | 3300046679 | Bacteria | 1485 |
| 389 | Ga0495646_0010269 | 3300046680 | Bacteria | 5955 |
| 390 | Ga0495646_0099587 | 3300046680 | Bacteria | 1668 |
| 391 | Ga0495647_0118146 | 3300046681 | Bacteria | 1113 |
| 392 | Ga0495669_0028068 | 3300046684 | Bacteria | 2463 |
| 393 | Ga0495670_0028413 | 3300046691 | Bacteria | 2773 |
| 394 | Ga0495600_0011797 | 3300046809 | Bacteria | 5456 |
| 395 | Ga0495604_0008196 | 3300047317 | Bacteria | 8267 |
| 396 | Ga0495672_0007685 | 3300047320 | Bacteria | 8079 |
| 397 | Ga0495672_0091983 | 3300047320 | Bacteria | 1664 |
| 398 | Ga0495680_0020559 | 3300047322 | Bacteria | 5549 |
| 399 | Ga0495680_0064403 | 3300047322 | Bacteria | 2811 |
| 400 | Ga0495680_0108992 | 3300047322 | Bacteria | 2054 |
| 401 | Ga0495675_0001936 | 3300047444 | Bacteria | 12346 |
| 402 | Ga0495686_0113816 | 3300047472 | Bacteria | 1620 |
| 403 | Ga0495602_0000557 | 3300048088 | Bacteria | 34744 |
| 404 | Ga0496100_0083424 | 3300048903 | Bacteria | 2164 |
| 405 | Ga0496101_0135893 | 3300048904 | Bacteria | 1871 |
| 406 | Ga0496110_0400695 | 3300048913 | Bacteria | 1251 |
| 407 | Ga0496112_0011155 | 3300048915 | Bacteria | 8193 |
| 408 | Ga0496112_0195578 | 3300048915 | Bacteria | 1983 |
| 409 | Ga0496114_0027502 | 3300048917 | Bacteria | 4660 |
| 410 | Ga0496114_0256291 | 3300048917 | Bacteria | 1540 |
| 411 | Ga0496115_0186537 | 3300048918 | Bacteria | 1714 |
| 412 | Ga0496121_0038053 | 3300048924 | Bacteria | 4267 |
| 413 | Ga0496122_0067613 | 3300048925 | Bacteria | 2572 |
| 414 | Ga0496126_0115554 | 3300048929 | Bacteria | 2333 |
| 415 | Ga0501033_0070818 | 3300049570 | Bacteria | 2561 |
| 416 | Ga0501034_0000730 | 3300049571 | Bacteria | 49754 |
| 417 | Ga0501034_0001037 | 3300049571 | Bacteria | 39713 |
| 418 | Ga0501034_0034649 | 3300049571 | Bacteria | 5119 |
| 419 | Ga0501036_0150121 | 3300049572 | Bacteria | 1966 |
| 420 | Ga0501038_0103602 | 3300049574 | Bacteria | 2366 |
| 421 | Ga0501040_0016282 | 3300049576 | Bacteria | 4919 |
| 422 | Ga0501042_0003628 | 3300049578 | Bacteria | 9736 |
| 423 | Ga0501048_0008044 | 3300049582 | Bacteria | 7987 |
| 424 | Ga0501068_0022447 | 3300049584 | Bacteria | 3691 |
| 425 | Ga0501068_0068705 | 3300049584 | Bacteria | 2159 |
| 426 | Ga0501071_0002972 | 3300049587 | Bacteria | 10479 |
| 427 | Ga0501071_0003547 | 3300049587 | Bacteria | 9766 |
| 428 | Ga0501072_0006277 | 3300049588 | Bacteria | 9052 |
| 429 | Ga0501072_0011670 | 3300049588 | Bacteria | 6712 |
| 430 | Ga0501072_0028452 | 3300049588 | Bacteria | 4364 |
| 431 | Ga0501073_0051600 | 3300049589 | Bacteria | 2881 |
| 432 | Ga0501075_0003556 | 3300049591 | Bacteria | 10433 |
| 433 | Ga0501075_0100872 | 3300049591 | Bacteria | 2192 |
| 434 | Ga0501076_0000337 | 3300049592 | Bacteria | 28949 |
| 435 | Ga0501079_0009980 | 3300049741 | Bacteria | 7208 |
| 436 | Ga0501080_0002713 | 3300049742 | Bacteria | 15518 |
| 437 | Ga0501080_0174359 | 3300049742 | Bacteria | 1982 |
| 438 | Ga0501083_0075814 | 3300049744 | Bacteria | 2233 |
| 439 | Ga0501035_0192439 | 3300049822 | Bacteria | 1753 |
| 440 | Ga0501044_0426645 | 3300049823 | Bacteria | 1235 |
| 441 | Ga0501045_0000120 | 3300049824 | Bacteria | 40494 |
| 442 | nmdc:mga03683_2234_c1 | 3300050489 | Bacteria | 5972 |
| 443 | nmdc:mga03683_28456_c1 | 3300050489 | Bacteria | 2222 |
| 444 | nmdc:mga00v17_109559_c1 | 3300050491 | Bacteria | 1751 |
| 445 | nmdc:mga0yw44_180123_c1 | 3300050492 | Bacteria | 1391 |
| 446 | nmdc:mga0yw44_23017_c1 | 3300050492 | Bacteria | 3505 |
| 447 | nmdc:mga0k408_13218_c1 | 3300050493 | Bacteria | 4524 |
| 448 | nmdc:mga0k408_134050_c1 | 3300050493 | Bacteria | 1471 |
| 449 | nmdc:mga06z11_55144_c1 | 3300050494 | Bacteria | 2051 |
| 450 | nmdc:mga07m45_12489_c1 | 3300050496 | Bacteria | 4490 |
| 451 | nmdc:mga05p37_586347_c1 | 3300050507 | Bacteria | 1261 |
| 452 | nmdc:mga05p37_840_c1 | 3300050507 | Bacteria | 34480 |
| 453 | nmdc:mga09592_5_c1 | 3300050508 | Bacteria | 130353 |
| 454 | nmdc:mga09592_64812_c1 | 3300050508 | Bacteria | 3094 |
| 455 | nmdc:mga0qj67_171685_c1 | 3300050509 | Bacteria | 1761 |
| 456 | nmdc:mga0qj67_329804_c1 | 3300050509 | Bacteria | 1235 |
| 457 | nmdc:mga06r32_50201_c1 | 3300050510 | Bacteria | 3990 |
| 458 | nmdc:mga06r32_9313_c1 | 3300050510 | Bacteria | 8853 |
| 459 | nmdc:mga08y16_200748_c1 | 3300050511 | Bacteria | 2067 |
| 460 | nmdc:mga0n895_68778_c1 | 3300050512 | Bacteria | 3508 |
| 461 | nmdc:mga08x19_339849_c1 | 3300050514 | Bacteria | 1047 |
| 462 | nmdc:mga0a205_185465_c1 | 3300050515 | Unclassified | 1973 |
| 463 | nmdc:mga0a205_68422_c1 | 3300050515 | Bacteria | 3429 |
| 464 | nmdc:mga0a205_69727_c1 | 3300050515 | Bacteria | 3394 |
| 465 | nmdc:mga0sz30_210_c1 | 3300050516 | Bacteria | 21966 |
| 466 | Ga0495601_0001180 | 3300053077 | Bacteria | 14281 |
| 467 | Ga0495601_0029435 | 3300053077 | Bacteria | 3406 |
| 468 | Ga0495601_0039932 | 3300053077 | Bacteria | 2939 |
| 469 | Ga0495601_0077184 | 3300053077 | Bacteria | 2133 |
| 470 | Ga0495612_0004892 | 3300053078 | Bacteria | 5542 |
| 471 | Ga0495595_0031011 | 3300053084 | Bacteria | 2401 |
| 472 | Ga0495619_0008411 | 3300053085 | Bacteria | 6527 |
| 473 | Ga0495619_0126023 | 3300053085 | Bacteria | 1757 |
| 474 | Ga0500644_0061368 | 3300053088 | Bacteria | 1325 |
| 475 | Ga0500646_0005271 | 3300053090 | Bacteria | 3268 |
| 476 | Ga0500572_000152 | 3300053111 | Bacteria | 24027 |
| 477 | Ga0500594_0008657 | 3300053118 | Bacteria | 2324 |
| 478 | Ga0500642_0033511 | 3300053130 | Bacteria | 2165 |
| 479 | Ga0500559_0000014 | 3300053136 | Bacteria | 160139 |
| 480 | Ga0500559_0000230 | 3300053136 | Bacteria | 44504 |
| 481 | Ga0500568_0014695 | 3300053139 | Bacteria | 3526 |
| 482 | Ga0500604_0004171 | 3300053151 | Bacteria | 3850 |
| 483 | Ga0500604_0038454 | 3300053151 | Bacteria | 1436 |
| 484 | Ga0500622_0003526 | 3300053156 | Bacteria | 10376 |
| 485 | Ga0500638_050066 | 3300053162 | Bacteria | 2020 |
| 486 | Ga0500639_003558 | 3300053163 | Bacteria | 7864 |
| 487 | Ga0500636_0115925 | 3300053177 | Bacteria | 1508 |
| 488 | Ga0500645_036029 | 3300053730 | Bacteria | 1473 |
| 489 | Ga0500596_000338 | 3300053735 | Bacteria | 8437 |
| 490 | Ga0500587_002460 | 3300053739 | Bacteria | 2634 |
| 491 | Ga0501084_0000907 | 3300054114 | Bacteria | 22887 |
| 492 | Ga0501084_0030642 | 3300054114 | Bacteria | 4498 |
| 493 | Ga0501082_0001755 | 3300060353 | Bacteria | 19084 |
| 494 | Ga0501082_0124335 | 3300060353 | Bacteria | 2237 |
| 495 | Ga0530510_0017852 | 3300061734 | Bacteria | 5029 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035692 | Ga0373935_0359414 | Ga0373935_0359414_52_999 | 303 |
| 2 | 3300050514 | nmdc:mga08x19_339849_c1 | nmdc:mga08x19_339849_c1_60_1013 | 303 |
| 3 | 3300046514 | Ga0495618_0255463 | Ga0495618_0255463_18_968 | 311 |
| 4 | 3300046616 | Ga0495668_0112399 | Ga0495668_0112399_16_999 | 316 |
| 5 | 3300050509 | nmdc:mga0qj67_329804_c1 | nmdc:mga0qj67_329804_c1_211_1209 | 318 |
| 6 | 3300046681 | Ga0495647_0118146 | Ga0495647_0118146_26_1021 | 325 |
| 7 | 3300049587 | Ga0501071_0002972 | Ga0501071_0002972_5080_6111 | 336 |
| 8 | 3300049588 | Ga0501072_0028452 | Ga0501072_0028452_2464_3495 | 336 |
| 9 | 3300049591 | Ga0501075_0100872 | Ga0501075_0100872_532_1563 | 336 |
| 10 | 3300054114 | Ga0501084_0030642 | Ga0501084_0030642_2829_3860 | 336 |
| 11 | 3300025898 | Ga0207692_10074710 | Ga0207692_100747102 | 337 |
| 12 | 3300025906 | Ga0207699_10025430 | Ga0207699_100254303 | 337 |
| 13 | 3300048918 | Ga0496115_0186537 | Ga0496115_0186537_344_1387 | 337 |
| 14 | 3300005444 | Ga0070694_100020570 | Ga0070694_1000205705 | 341 |
| 15 | 3300005545 | Ga0070695_100051908 | Ga0070695_1000519082 | 341 |
| 16 | 3300005549 | Ga0070704_100033403 | Ga0070704_1000334033 | 341 |
| 17 | 3300025899 | Ga0207642_10017333 | Ga0207642_100173332 | 348 |
| 18 | 3300050515 | nmdc:mga0a205_185465_c1 | nmdc:mga0a205_185465_c1_676_1770 | 348 |
| 19 | 3300053077 | Ga0495601_0077184 | Ga0495601_0077184_1019_2083 | 349 |
| 20 | 3300048917 | Ga0496114_0027502 | Ga0496114_0027502_413_1669 | 350 |
| 21 | 3300039437 | Ga0436365_1598157 | Ga0436365_1598157_368_1534 | 352 |
| 22 | 3300039447 | Ga0436361_0930897 | Ga0436361_0930897_75_1184 | 352 |
| 23 | 3300048924 | Ga0496121_0038053 | Ga0496121_0038053_265_1434 | 353 |
| 24 | 3300046533 | Ga0495640_0138882 | Ga0495640_0138882_453_1532 | 354 |
| 25 | 3300005841 | Ga0068863_100167799 | Ga0068863_1001677993 | 356 |
| 26 | 3300005841 | Ga0068863_100390603 | Ga0068863_1003906032 | 356 |
| 27 | 3300013306 | Ga0163162_10015589 | Ga0163162_100155892 | 356 |
| 28 | 3300035692 | Ga0373935_0166581 | Ga0373935_0166581_33_1118 | 356 |
| 29 | 3300035724 | Ga0373933_0147125 | Ga0373933_0147125_128_1213 | 356 |
| 30 | 3300036401 | Ga0373937_0198363 | Ga0373937_0198363_433_1518 | 356 |
| 31 | 3300037068 | Ga0373925_0017714 | Ga0373925_0017714_2439_3524 | 356 |
| 32 | 3300046511 | Ga0495608_0154560 | Ga0495608_0154560_362_1447 | 356 |
| 33 | 3300047322 | Ga0495680_0108992 | Ga0495680_0108992_412_1497 | 356 |
| 34 | 3300050510 | nmdc:mga06r32_50201_c1 | nmdc:mga06r32_50201_c1_60_1178 | 356 |
| 35 | 3300005617 | Ga0068859_100133541 | Ga0068859_1001335412 | 357 |
| 36 | 3300006931 | Ga0097620_100133536 | Ga0097620_1001335362 | 357 |
| 37 | 3300039447 | Ga0436361_0935188 | Ga0436361_0935188_2916_4082 | 357 |
| 38 | 3300006881 | Ga0068865_100163761 | Ga0068865_1001637612 | 359 |
| 39 | 3300033180 | Ga0307510_10038105 | Ga0307510_100381054 | 359 |
| 40 | 3300039062 | Ga0400483_090459 | Ga0400483_090459_1468_2727 | 359 |
| 41 | 3300039062 | Ga0400483_176188 | Ga0400483_176188_8122_9381 | 359 |
| 42 | 3300042001 | Ga0439441_000035 | Ga0439441_000035_6006_7109 | 359 |
| 43 | 3300049589 | Ga0501073_0051600 | Ga0501073_0051600_940_2142 | 359 |
| 44 | 3300049742 | Ga0501080_0002713 | Ga0501080_0002713_10269_11471 | 359 |
| 45 | 3300060353 | Ga0501082_0124335 | Ga0501082_0124335_419_1621 | 359 |
| 46 | 3300005441 | Ga0070700_100070856 | Ga0070700_1000708561 | 360 |
| 47 | 3300005444 | Ga0070694_100260925 | Ga0070694_1002609251 | 360 |
| 48 | 3300005549 | Ga0070704_100239765 | Ga0070704_1002397651 | 360 |
| 49 | 3300006844 | Ga0075428_100016657 | Ga0075428_1000166574 | 360 |
| 50 | 3300006880 | Ga0075429_100000151 | Ga0075429_10000015113 | 360 |
| 51 | 3300009147 | Ga0114129_10007243 | Ga0114129_1000724312 | 360 |
| 52 | 3300026075 | Ga0207708_10118214 | Ga0207708_101182142 | 360 |
| 53 | 3300027907 | Ga0207428_10032808 | Ga0207428_100328084 | 360 |
| 54 | 3300041413 | Ga0439465_0029248 | Ga0439465_0029248_471_1574 | 360 |
| 55 | 3300046512 | Ga0495610_0030843 | Ga0495610_0030843_650_1792 | 360 |
| 56 | 3300047472 | Ga0495686_0113816 | Ga0495686_0113816_429_1571 | 360 |
| 57 | 3300049571 | Ga0501034_0000730 | Ga0501034_0000730_6708_7868 | 360 |
| 58 | 3300049588 | Ga0501072_0006277 | Ga0501072_0006277_3528_4688 | 360 |
| 59 | 3300050489 | nmdc:mga03683_2234_c1 | nmdc:mga03683_2234_c1_4724_5839 | 360 |
| 60 | 3300050494 | nmdc:mga06z11_55144_c1 | nmdc:mga06z11_55144_c1_214_1329 | 360 |
| 61 | 3300050496 | nmdc:mga07m45_12489_c1 | nmdc:mga07m45_12489_c1_77_1192 | 360 |
| 62 | 3300050507 | nmdc:mga05p37_586347_c1 | nmdc:mga05p37_586347_c1_48_1157 | 360 |
| 63 | 3300050507 | nmdc:mga05p37_840_c1 | nmdc:mga05p37_840_c1_3847_4956 | 360 |
| 64 | 3300050508 | nmdc:mga09592_5_c1 | nmdc:mga09592_5_c1_33117_34226 | 360 |
| 65 | 3300050510 | nmdc:mga06r32_9313_c1 | nmdc:mga06r32_9313_c1_4831_5940 | 360 |
| 66 | 3300050516 | nmdc:mga0sz30_210_c1 | nmdc:mga0sz30_210_c1_12701_13816 | 360 |
| 67 | 3300053088 | Ga0500644_0061368 | Ga0500644_0061368_162_1304 | 360 |
| 68 | 3300053118 | Ga0500594_0008657 | Ga0500594_0008657_334_1476 | 360 |
| 69 | 3300053136 | Ga0500559_0000014 | Ga0500559_0000014_123853_124995 | 360 |
| 70 | 3300053156 | Ga0500622_0003526 | Ga0500622_0003526_2502_3644 | 360 |
| 71 | 3300053177 | Ga0500636_0115925 | Ga0500636_0115925_141_1283 | 360 |
| 72 | 3300053739 | Ga0500587_002460 | Ga0500587_002460_988_2130 | 360 |
| 73 | 3300041413 | Ga0439465_0028803 | Ga0439465_0028803_483_1610 | 361 |
| 74 | 3300009098 | Ga0105245_10150395 | Ga0105245_101503952 | 362 |
| 75 | 3300009176 | Ga0105242_10001815 | Ga0105242_100018155 | 362 |
| 76 | 3300025929 | Ga0207664_10317095 | Ga0207664_103170951 | 362 |
| 77 | 3300025934 | Ga0207686_10002624 | Ga0207686_100026245 | 362 |
| 78 | 3300026116 | Ga0207674_10194140 | Ga0207674_101941402 | 362 |
| 79 | 3300035691 | Ga0373931_0099728 | Ga0373931_0099728_150_1259 | 362 |
| 80 | 3300036401 | Ga0373937_0044524 | Ga0373937_0044524_1789_2913 | 362 |
| 81 | 3300048917 | Ga0496114_0256291 | Ga0496114_0256291_26_1165 | 362 |
| 82 | 3300025922 | Ga0207646_10038818 | Ga0207646_100388183 | 363 |
| 83 | 3300037853 | Ga0436364_1128085 | Ga0436364_1128085_106_1245 | 363 |
| 84 | 3300049574 | Ga0501038_0103602 | Ga0501038_0103602_49_1227 | 363 |
| 85 | 3300006177 | Ga0075362_10061775 | Ga0075362_100617752 | 364 |
| 86 | 3300009551 | Ga0105238_10132272 | Ga0105238_101322722 | 364 |
| 87 | 3300021388 | Ga0213875_10000142 | Ga0213875_1000014221 | 364 |
| 88 | 3300028786 | Ga0307517_10001421 | Ga0307517_1000142127 | 364 |
| 89 | 3300030522 | Ga0307512_10070975 | Ga0307512_100709752 | 364 |
| 90 | 3300036401 | Ga0373937_0174427 | Ga0373937_0174427_30_1160 | 364 |
| 91 | 3300037853 | Ga0436364_0766585 | Ga0436364_0766585_4400_5539 | 364 |
| 92 | 3300037853 | Ga0436364_1127111 | Ga0436364_1127111_3418_4533 | 364 |
| 93 | 3300050489 | nmdc:mga03683_28456_c1 | nmdc:mga03683_28456_c1_964_2079 | 364 |
| 94 | 3300044673 | Ga0453683_0176282 | Ga0453683_0176282_91_1230 | 365 |
| 95 | 3300046454 | Ga0495592_0000142 | Ga0495592_0000142_56717_57859 | 365 |
| 96 | 3300046680 | Ga0495646_0099587 | Ga0495646_0099587_105_1247 | 365 |
| 97 | iso_pu_bacteria | 2874604998 | 2874610184 | 365 |
| 98 | iso_pu_bacteria | 2883577096 | 2883580266 | 365 |
| 99 | iso_pu_bacteria | 2922361189 | 2922366779 | 365 |
| 100 | 3300005439 | Ga0070711_100179781 | Ga0070711_1001797811 | 366 |
| 101 | 3300005445 | Ga0070708_100021532 | Ga0070708_1000215326 | 366 |
| 102 | 3300005518 | Ga0070699_100021812 | Ga0070699_1000218126 | 366 |
| 103 | 3300006163 | Ga0070715_10007955 | Ga0070715_100079552 | 366 |
| 104 | 3300021388 | Ga0213875_10008093 | Ga0213875_100080932 | 366 |
| 105 | 3300025905 | Ga0207685_10015454 | Ga0207685_100154542 | 366 |
| 106 | 3300031507 | Ga0307509_10000577 | Ga0307509_1000057746 | 366 |
| 107 | 3300033180 | Ga0307510_10029719 | Ga0307510_100297196 | 366 |
| 108 | 3300037853 | Ga0436364_1271676 | Ga0436364_1271676_4665_5792 | 366 |
| 109 | iso_pu_bacteria | 2643221651 | 2644291694 | 366 |
| 110 | 3300005435 | Ga0070714_100148537 | Ga0070714_1001485373 | 367 |
| 111 | 3300005458 | Ga0070681_10052162 | Ga0070681_100521625 | 367 |
| 112 | 3300005471 | Ga0070698_100003223 | Ga0070698_10000322313 | 367 |
| 113 | 3300005985 | Ga0081539_10006413 | Ga0081539_100064132 | 367 |
| 114 | 3300006038 | Ga0075365_10059380 | Ga0075365_100593802 | 367 |
| 115 | 3300006042 | Ga0075368_10027596 | Ga0075368_100275962 | 367 |
| 116 | 3300006048 | Ga0075363_100041743 | Ga0075363_1000417432 | 367 |
| 117 | 3300006051 | Ga0075364_10079093 | Ga0075364_100790932 | 367 |
| 118 | 3300006177 | Ga0075362_10005399 | Ga0075362_100053997 | 367 |
| 119 | 3300006177 | Ga0075362_10015806 | Ga0075362_100158063 | 367 |
| 120 | 3300006177 | Ga0075362_10037140 | Ga0075362_100371401 | 367 |
| 121 | 3300006178 | Ga0075367_10027695 | Ga0075367_100276954 | 367 |
| 122 | 3300006186 | Ga0075369_10000203 | Ga0075369_1000020314 | 367 |
| 123 | 3300006186 | Ga0075369_10041196 | Ga0075369_100411962 | 367 |
| 124 | 3300006844 | Ga0075428_100111069 | Ga0075428_1001110692 | 367 |
| 125 | 3300025912 | Ga0207707_10153199 | Ga0207707_101531992 | 367 |
| 126 | 3300025929 | Ga0207664_10128778 | Ga0207664_101287783 | 367 |
| 127 | 3300030521 | Ga0307511_10000851 | Ga0307511_1000085124 | 367 |
| 128 | 3300031456 | Ga0307513_10167661 | Ga0307513_101676611 | 367 |
| 129 | 3300036401 | Ga0373937_0043537 | Ga0373937_0043537_1517_2644 | 367 |
| 130 | 3300037068 | Ga0373925_0061328 | Ga0373925_0061328_1035_2186 | 367 |
| 131 | 3300037312 | Ga0395899_0180156 | Ga0395899_0180156_202_1326 | 367 |
| 132 | 3300039437 | Ga0436365_0776181 | Ga0436365_0776181_1182_2333 | 367 |
| 133 | 3300044694 | Ga0466963_0275811 | Ga0466963_0275811_15_1139 | 367 |
| 134 | 3300046460 | Ga0495638_0126601 | Ga0495638_0126601_115_1263 | 367 |
| 135 | 3300049571 | Ga0501034_0034649 | Ga0501034_0034649_2590_3729 | 367 |
| 136 | 3300050491 | nmdc:mga00v17_109559_c1 | nmdc:mga00v17_109559_c1_304_1452 | 367 |
| 137 | 3300050492 | nmdc:mga0yw44_23017_c1 | nmdc:mga0yw44_23017_c1_1550_2698 | 367 |
| 138 | 3300050493 | nmdc:mga0k408_134050_c1 | nmdc:mga0k408_134050_c1_37_1161 | 367 |
| 139 | 3300053090 | Ga0500646_0005271 | Ga0500646_0005271_1344_2489 | 367 |
| 140 | 3300053130 | Ga0500642_0033511 | Ga0500642_0033511_437_1582 | 367 |
| 141 | 3300053139 | Ga0500568_0014695 | Ga0500568_0014695_1418_2563 | 367 |
| 142 | 3300053151 | Ga0500604_0004171 | Ga0500604_0004171_2303_3448 | 367 |
| 143 | 3300053151 | Ga0500604_0038454 | Ga0500604_0038454_227_1375 | 367 |
| 144 | 3300053730 | Ga0500645_036029 | Ga0500645_036029_61_1206 | 367 |
| 145 | 3300005340 | Ga0070689_100184107 | Ga0070689_1001841072 | 368 |
| 146 | 3300005434 | Ga0070709_10034439 | Ga0070709_100344392 | 368 |
| 147 | 3300005435 | Ga0070714_100064531 | Ga0070714_1000645312 | 368 |
| 148 | 3300005436 | Ga0070713_100002801 | Ga0070713_1000028019 | 368 |
| 149 | 3300005467 | Ga0070706_100295150 | Ga0070706_1002951502 | 368 |
| 150 | 3300005471 | Ga0070698_100022570 | Ga0070698_1000225705 | 368 |
| 151 | 3300005518 | Ga0070699_100158141 | Ga0070699_1001581411 | 368 |
| 152 | 3300005536 | Ga0070697_100015876 | Ga0070697_1000158766 | 368 |
| 153 | 3300005937 | Ga0081455_10046474 | Ga0081455_100464742 | 368 |
| 154 | 3300006175 | Ga0070712_100011749 | Ga0070712_1000117495 | 368 |
| 155 | 3300006353 | Ga0075370_10053310 | Ga0075370_100533102 | 368 |
| 156 | 3300006353 | Ga0075370_10124178 | Ga0075370_101241781 | 368 |
| 157 | 3300009176 | Ga0105242_10048360 | Ga0105242_100483601 | 368 |
| 158 | 3300009177 | Ga0105248_10192203 | Ga0105248_101922033 | 368 |
| 159 | 3300021388 | Ga0213875_10025079 | Ga0213875_100250792 | 368 |
| 160 | 3300028573 | Ga0265334_10004817 | Ga0265334_100048175 | 368 |
| 161 | 3300028800 | Ga0265338_10079084 | Ga0265338_100790842 | 368 |
| 162 | 3300035118 | Ga0373954_0023472 | Ga0373954_0023472_1072_2211 | 368 |
| 163 | 3300035171 | Ga0373946_0110645 | Ga0373946_0110645_83_1222 | 368 |
| 164 | 3300035692 | Ga0373935_0057807 | Ga0373935_0057807_1224_2363 | 368 |
| 165 | 3300035695 | Ga0373927_0157624 | Ga0373927_0157624_178_1317 | 368 |
| 166 | 3300036401 | Ga0373937_0000638 | Ga0373937_0000638_7188_8327 | 368 |
| 167 | 3300036401 | Ga0373937_0011341 | Ga0373937_0011341_4336_5475 | 368 |
| 168 | 3300037068 | Ga0373925_0050850 | Ga0373925_0050850_1559_2698 | 368 |
| 169 | 3300037853 | Ga0436364_0018110 | Ga0436364_0018110_585_1724 | 368 |
| 170 | 3300039437 | Ga0436365_1850857 | Ga0436365_1850857_493_1632 | 368 |
| 171 | 3300045049 | Ga0466959_0042292 | Ga0466959_0042292_1162_2319 | 368 |
| 172 | 3300046454 | Ga0495592_0041123 | Ga0495592_0041123_89_1228 | 368 |
| 173 | 3300046477 | Ga0495664_0023853 | Ga0495664_0023853_1521_2660 | 368 |
| 174 | 3300046511 | Ga0495608_0000890 | Ga0495608_0000890_1782_2921 | 368 |
| 175 | 3300046511 | Ga0495608_0007116 | Ga0495608_0007116_4203_5342 | 368 |
| 176 | 3300046516 | Ga0495628_0040199 | Ga0495628_0040199_559_1698 | 368 |
| 177 | 3300046536 | Ga0495587_0002800 | Ga0495587_0002800_1956_3095 | 368 |
| 178 | 3300046543 | Ga0495645_0043278 | Ga0495645_0043278_696_1835 | 368 |
| 179 | 3300046559 | Ga0495667_0003101 | Ga0495667_0003101_2573_3712 | 368 |
| 180 | 3300046679 | Ga0495623_0133341 | Ga0495623_0133341_333_1472 | 368 |
| 181 | 3300046680 | Ga0495646_0010269 | Ga0495646_0010269_4632_5771 | 368 |
| 182 | 3300046809 | Ga0495600_0011797 | Ga0495600_0011797_142_1281 | 368 |
| 183 | 3300047317 | Ga0495604_0008196 | Ga0495604_0008196_4841_5980 | 368 |
| 184 | 3300047322 | Ga0495680_0020559 | Ga0495680_0020559_467_1606 | 368 |
| 185 | 3300047322 | Ga0495680_0064403 | Ga0495680_0064403_70_1209 | 368 |
| 186 | 3300047444 | Ga0495675_0001936 | Ga0495675_0001936_8946_10085 | 368 |
| 187 | 3300048088 | Ga0495602_0000557 | Ga0495602_0000557_29210_30349 | 368 |
| 188 | 3300048929 | Ga0496126_0115554 | Ga0496126_0115554_806_1945 | 368 |
| 189 | 3300049571 | Ga0501034_0001037 | Ga0501034_0001037_14147_15277 | 368 |
| 190 | 3300049578 | Ga0501042_0003628 | Ga0501042_0003628_2088_3275 | 368 |
| 191 | 3300049582 | Ga0501048_0008044 | Ga0501048_0008044_2617_3804 | 368 |
| 192 | 3300049584 | Ga0501068_0068705 | Ga0501068_0068705_219_1406 | 368 |
| 193 | 3300049587 | Ga0501071_0003547 | Ga0501071_0003547_3398_4585 | 368 |
| 194 | 3300049591 | Ga0501075_0003556 | Ga0501075_0003556_530_1717 | 368 |
| 195 | 3300049592 | Ga0501076_0000337 | Ga0501076_0000337_7229_8416 | 368 |
| 196 | 3300049824 | Ga0501045_0000120 | Ga0501045_0000120_2088_3275 | 368 |
| 197 | 3300050492 | nmdc:mga0yw44_180123_c1 | nmdc:mga0yw44_180123_c1_37_1173 | 368 |
| 198 | 3300050493 | nmdc:mga0k408_13218_c1 | nmdc:mga0k408_13218_c1_562_1728 | 368 |
| 199 | 3300053077 | Ga0495601_0001180 | Ga0495601_0001180_8839_9978 | 368 |
| 200 | 3300053078 | Ga0495612_0004892 | Ga0495612_0004892_4244_5383 | 368 |
| 201 | 3300053084 | Ga0495595_0031011 | Ga0495595_0031011_440_1579 | 368 |
| 202 | 3300053085 | Ga0495619_0008411 | Ga0495619_0008411_4851_5990 | 368 |
| 203 | 3300054114 | Ga0501084_0000907 | Ga0501084_0000907_14457_15644 | 368 |
| 204 | 3300060353 | Ga0501082_0001755 | Ga0501082_0001755_14617_15804 | 368 |
| 205 | 3300061734 | Ga0530510_0017852 | Ga0530510_0017852_3468_4655 | 368 |
| 206 | iso_pu_bacteria | 2929199973 | 2929205239 | 368 |
| 207 | iso_pu_bacteria | 8055909800 | 8055913418 | 368 |
| 208 | 3300003911 | JGI25405J52794_10007987 | JGI25405J52794_100079872 | 369 |
| 209 | 3300005295 | Ga0065707_10003366 | Ga0065707_100033664 | 369 |
| 210 | 3300005334 | Ga0068869_100177068 | Ga0068869_1001770682 | 369 |
| 211 | 3300005341 | Ga0070691_10031683 | Ga0070691_100316831 | 369 |
| 212 | 3300005345 | Ga0070692_10003405 | Ga0070692_100034054 | 369 |
| 213 | 3300005353 | Ga0070669_100014354 | Ga0070669_1000143544 | 369 |
| 214 | 3300005436 | Ga0070713_100169604 | Ga0070713_1001696042 | 369 |
| 215 | 3300005441 | Ga0070700_100008396 | Ga0070700_1000083964 | 369 |
| 216 | 3300005456 | Ga0070678_100031048 | Ga0070678_1000310483 | 369 |
| 217 | 3300005458 | Ga0070681_10020967 | Ga0070681_100209674 | 369 |
| 218 | 3300005459 | Ga0068867_100007205 | Ga0068867_1000072052 | 369 |
| 219 | 3300005539 | Ga0068853_100038928 | Ga0068853_1000389283 | 369 |
| 220 | 3300005543 | Ga0070672_100008668 | Ga0070672_1000086684 | 369 |
| 221 | 3300005546 | Ga0070696_100169321 | Ga0070696_1001693211 | 369 |
| 222 | 3300005549 | Ga0070704_100238825 | Ga0070704_1002388252 | 369 |
| 223 | 3300005577 | Ga0068857_100014788 | Ga0068857_1000147885 | 369 |
| 224 | 3300005616 | Ga0068852_100283758 | Ga0068852_1002837582 | 369 |
| 225 | 3300005718 | Ga0068866_10185289 | Ga0068866_101852891 | 369 |
| 226 | 3300005719 | Ga0068861_100001889 | Ga0068861_1000018893 | 369 |
| 227 | 3300005842 | Ga0068858_100059318 | Ga0068858_1000593183 | 369 |
| 228 | 3300005843 | Ga0068860_100001386 | Ga0068860_10000138615 | 369 |
| 229 | 3300005844 | Ga0068862_100022960 | Ga0068862_1000229602 | 369 |
| 230 | 3300005937 | Ga0081455_10000451 | Ga0081455_1000045116 | 369 |
| 231 | 3300005983 | Ga0081540_1012873 | Ga0081540_10128732 | 369 |
| 232 | 3300006051 | Ga0075364_10033775 | Ga0075364_100337751 | 369 |
| 233 | 3300006173 | Ga0070716_100153519 | Ga0070716_1001535192 | 369 |
| 234 | 3300006237 | Ga0097621_100153503 | Ga0097621_1001535033 | 369 |
| 235 | 3300006846 | Ga0075430_100157470 | Ga0075430_1001574702 | 369 |
| 236 | 3300006847 | Ga0075431_100039880 | Ga0075431_1000398804 | 369 |
| 237 | 3300006852 | Ga0075433_10240602 | Ga0075433_102406022 | 369 |
| 238 | 3300006871 | Ga0075434_100378848 | Ga0075434_1003788482 | 369 |
| 239 | 3300006881 | Ga0068865_100004561 | Ga0068865_1000045612 | 369 |
| 240 | 3300009093 | Ga0105240_10140606 | Ga0105240_101406062 | 369 |
| 241 | 3300009094 | Ga0111539_10321175 | Ga0111539_103211752 | 369 |
| 242 | 3300009148 | Ga0105243_10103162 | Ga0105243_101031621 | 369 |
| 243 | 3300009545 | Ga0105237_10115208 | Ga0105237_101152081 | 369 |
| 244 | 3300009553 | Ga0105249_10011488 | Ga0105249_100114884 | 369 |
| 245 | 3300009553 | Ga0105249_10254007 | Ga0105249_102540072 | 369 |
| 246 | 3300011119 | Ga0105246_10018942 | Ga0105246_100189422 | 369 |
| 247 | 3300013297 | Ga0157378_10010502 | Ga0157378_100105026 | 369 |
| 248 | 3300013306 | Ga0163162_10037972 | Ga0163162_100379723 | 369 |
| 249 | 3300013308 | Ga0157375_10058170 | Ga0157375_100581702 | 369 |
| 250 | 3300014326 | Ga0157380_10010371 | Ga0157380_100103716 | 369 |
| 251 | 3300014745 | Ga0157377_10006406 | Ga0157377_100064064 | 369 |
| 252 | 3300014968 | Ga0157379_10059456 | Ga0157379_100594563 | 369 |
| 253 | 3300021388 | Ga0213875_10090362 | Ga0213875_100903622 | 369 |
| 254 | 3300021441 | Ga0213871_10004269 | Ga0213871_100042693 | 369 |
| 255 | 3300021441 | Ga0213871_10025622 | Ga0213871_100256221 | 369 |
| 256 | 3300025901 | Ga0207688_10106974 | Ga0207688_101069741 | 369 |
| 257 | 3300025906 | Ga0207699_10176891 | Ga0207699_101768911 | 369 |
| 258 | 3300025912 | Ga0207707_10039135 | Ga0207707_100391353 | 369 |
| 259 | 3300025914 | Ga0207671_10013702 | Ga0207671_100137022 | 369 |
| 260 | 3300025915 | Ga0207693_10051739 | Ga0207693_100517393 | 369 |
| 261 | 3300025918 | Ga0207662_10011885 | Ga0207662_100118853 | 369 |
| 262 | 3300025919 | Ga0207657_10288496 | Ga0207657_102884961 | 369 |
| 263 | 3300025923 | Ga0207681_10008173 | Ga0207681_100081733 | 369 |
| 264 | 3300025924 | Ga0207694_10166316 | Ga0207694_101663162 | 369 |
| 265 | 3300025928 | Ga0207700_10255619 | Ga0207700_102556192 | 369 |
| 266 | 3300025929 | Ga0207664_10162079 | Ga0207664_101620792 | 369 |
| 267 | 3300025939 | Ga0207665_10216522 | Ga0207665_102165222 | 369 |
| 268 | 3300025942 | Ga0207689_10183536 | Ga0207689_101835362 | 369 |
| 269 | 3300025961 | Ga0207712_10009102 | Ga0207712_100091023 | 369 |
| 270 | 3300025972 | Ga0207668_10159998 | Ga0207668_101599982 | 369 |
| 271 | 3300025986 | Ga0207658_10034297 | Ga0207658_100342973 | 369 |
| 272 | 3300026035 | Ga0207703_10045431 | Ga0207703_100454312 | 369 |
| 273 | 3300026041 | Ga0207639_10003184 | Ga0207639_100031843 | 369 |
| 274 | 3300026075 | Ga0207708_10013010 | Ga0207708_100130103 | 369 |
| 275 | 3300026075 | Ga0207708_10014041 | Ga0207708_100140412 | 369 |
| 276 | 3300026075 | Ga0207708_10015435 | Ga0207708_100154354 | 369 |
| 277 | 3300026089 | Ga0207648_10001237 | Ga0207648_1000123710 | 369 |
| 278 | 3300026118 | Ga0207675_100001346 | Ga0207675_10000134626 | 369 |
| 279 | 3300026121 | Ga0207683_10027278 | Ga0207683_100272784 | 369 |
| 280 | 3300026121 | Ga0207683_10087355 | Ga0207683_100873553 | 369 |
| 281 | 3300026121 | Ga0207683_10091832 | Ga0207683_100918321 | 369 |
| 282 | 3300027907 | Ga0207428_10037743 | Ga0207428_100377433 | 369 |
| 283 | 3300028380 | Ga0268265_10005960 | Ga0268265_100059605 | 369 |
| 284 | 3300028381 | Ga0268264_10014230 | Ga0268264_100142304 | 369 |
| 285 | 3300035089 | Ga0373944_0028237 | Ga0373944_0028237_30_1184 | 369 |
| 286 | 3300035120 | Ga0373957_0042354 | Ga0373957_0042354_460_1611 | 369 |
| 287 | 3300035170 | Ga0373943_0158283 | Ga0373943_0158283_17_1168 | 369 |
| 288 | 3300035241 | Ga0373961_0049954 | Ga0373961_0049954_34_1185 | 369 |
| 289 | 3300035398 | Ga0316574_0032652 | Ga0316574_0032652_1651_2793 | 369 |
| 290 | 3300035692 | Ga0373935_0112390 | Ga0373935_0112390_296_1447 | 369 |
| 291 | 3300035724 | Ga0373933_0023555 | Ga0373933_0023555_1757_2908 | 369 |
| 292 | 3300036401 | Ga0373937_0053855 | Ga0373937_0053855_2508_3659 | 369 |
| 293 | 3300039450 | Ga0436363_0537438 | Ga0436363_0537438_1338_2504 | 369 |
| 294 | 3300039453 | Ga0436362_1222155 | Ga0436362_1222155_608_1771 | 369 |
| 295 | 3300046463 | Ga0495653_0145315 | Ga0495653_0145315_214_1365 | 369 |
| 296 | 3300046533 | Ga0495640_0021402 | Ga0495640_0021402_2717_3862 | 369 |
| 297 | 3300047320 | Ga0495672_0091983 | Ga0495672_0091983_29_1192 | 369 |
| 298 | 3300048903 | Ga0496100_0083424 | Ga0496100_0083424_502_1662 | 369 |
| 299 | 3300048904 | Ga0496101_0135893 | Ga0496101_0135893_212_1363 | 369 |
| 300 | 3300049570 | Ga0501033_0070818 | Ga0501033_0070818_975_2132 | 369 |
| 301 | 3300049572 | Ga0501036_0150121 | Ga0501036_0150121_275_1414 | 369 |
| 302 | 3300049584 | Ga0501068_0022447 | Ga0501068_0022447_2213_3370 | 369 |
| 303 | 3300049742 | Ga0501080_0174359 | Ga0501080_0174359_660_1817 | 369 |
| 304 | 3300049822 | Ga0501035_0192439 | Ga0501035_0192439_556_1713 | 369 |
| 305 | 3300049823 | Ga0501044_0426645 | Ga0501044_0426645_65_1222 | 369 |
| 306 | 3300050508 | nmdc:mga09592_64812_c1 | nmdc:mga09592_64812_c1_536_1675 | 369 |
| 307 | 3300050509 | nmdc:mga0qj67_171685_c1 | nmdc:mga0qj67_171685_c1_283_1419 | 369 |
| 308 | 3300050515 | nmdc:mga0a205_68422_c1 | nmdc:mga0a205_68422_c1_89_1240 | 369 |
| 309 | 3300050515 | nmdc:mga0a205_69727_c1 | nmdc:mga0a205_69727_c1_1851_2990 | 369 |
| 310 | 3300053077 | Ga0495601_0039932 | Ga0495601_0039932_20_1171 | 369 |
| 311 | 3300053111 | Ga0500572_000152 | Ga0500572_000152_456_1625 | 369 |
| 312 | 3300053136 | Ga0500559_0000230 | Ga0500559_0000230_7605_8774 | 369 |
| 313 | 3300053163 | Ga0500639_003558 | Ga0500639_003558_4716_5885 | 369 |
| 314 | 3300053735 | Ga0500596_000338 | Ga0500596_000338_4149_5318 | 369 |
| 315 | 3300005330 | Ga0070690_100003927 | Ga0070690_1000039276 | 370 |
| 316 | 3300005334 | Ga0068869_100001195 | Ga0068869_1000011955 | 370 |
| 317 | 3300005336 | Ga0070680_100089070 | Ga0070680_1000890702 | 370 |
| 318 | 3300005338 | Ga0068868_100011557 | Ga0068868_1000115576 | 370 |
| 319 | 3300005341 | Ga0070691_10021482 | Ga0070691_100214821 | 370 |
| 320 | 3300005345 | Ga0070692_10012980 | Ga0070692_100129803 | 370 |
| 321 | 3300005434 | Ga0070709_10028368 | Ga0070709_100283682 | 370 |
| 322 | 3300005435 | Ga0070714_100055371 | Ga0070714_1000553713 | 370 |
| 323 | 3300005436 | Ga0070713_100050811 | Ga0070713_1000508114 | 370 |
| 324 | 3300005438 | Ga0070701_10014671 | Ga0070701_100146712 | 370 |
| 325 | 3300005441 | Ga0070700_100003099 | Ga0070700_1000030995 | 370 |
| 326 | 3300005444 | Ga0070694_100036434 | Ga0070694_1000364343 | 370 |
| 327 | 3300005459 | Ga0068867_100005100 | Ga0068867_1000051004 | 370 |
| 328 | 3300005544 | Ga0070686_100022109 | Ga0070686_1000221091 | 370 |
| 329 | 3300005545 | Ga0070695_100013074 | Ga0070695_1000130743 | 370 |
| 330 | 3300005546 | Ga0070696_100065169 | Ga0070696_1000651691 | 370 |
| 331 | 3300005547 | Ga0070693_100016380 | Ga0070693_1000163802 | 370 |
| 332 | 3300005615 | Ga0070702_100001167 | Ga0070702_1000011677 | 370 |
| 333 | 3300005617 | Ga0068859_100041778 | Ga0068859_1000417783 | 370 |
| 334 | 3300005718 | Ga0068866_10002399 | Ga0068866_100023996 | 370 |
| 335 | 3300005718 | Ga0068866_10023305 | Ga0068866_100233055 | 370 |
| 336 | 3300005719 | Ga0068861_100062769 | Ga0068861_1000627693 | 370 |
| 337 | 3300005842 | Ga0068858_100004481 | Ga0068858_10000448110 | 370 |
| 338 | 3300005843 | Ga0068860_100022843 | Ga0068860_1000228436 | 370 |
| 339 | 3300005844 | Ga0068862_100006449 | Ga0068862_1000064495 | 370 |
| 340 | 3300006038 | Ga0075365_10089653 | Ga0075365_100896532 | 370 |
| 341 | 3300006175 | Ga0070712_100007322 | Ga0070712_1000073224 | 370 |
| 342 | 3300006194 | Ga0075427_10009740 | Ga0075427_100097401 | 370 |
| 343 | 3300006237 | Ga0097621_100002301 | Ga0097621_1000023011 | 370 |
| 344 | 3300006358 | Ga0068871_100012897 | Ga0068871_1000128972 | 370 |
| 345 | 3300006881 | Ga0068865_100000472 | Ga0068865_10000047214 | 370 |
| 346 | 3300006931 | Ga0097620_100041779 | Ga0097620_1000417792 | 370 |
| 347 | 3300009098 | Ga0105245_10010186 | Ga0105245_100101863 | 370 |
| 348 | 3300009148 | Ga0105243_10006693 | Ga0105243_100066933 | 370 |
| 349 | 3300009176 | Ga0105242_10006305 | Ga0105242_100063053 | 370 |
| 350 | 3300009553 | Ga0105249_10059545 | Ga0105249_100595452 | 370 |
| 351 | 3300013297 | Ga0157378_10019923 | Ga0157378_100199232 | 370 |
| 352 | 3300013308 | Ga0157375_10229291 | Ga0157375_102292912 | 370 |
| 353 | 3300014326 | Ga0157380_10011956 | Ga0157380_100119564 | 370 |
| 354 | 3300021377 | Ga0213874_10018287 | Ga0213874_100182871 | 370 |
| 355 | 3300025899 | Ga0207642_10030768 | Ga0207642_100307683 | 370 |
| 356 | 3300025899 | Ga0207642_10032089 | Ga0207642_100320893 | 370 |
| 357 | 3300025906 | Ga0207699_10050228 | Ga0207699_100502282 | 370 |
| 358 | 3300025908 | Ga0207643_10017180 | Ga0207643_100171802 | 370 |
| 359 | 3300025915 | Ga0207693_10000731 | Ga0207693_100007319 | 370 |
| 360 | 3300025916 | Ga0207663_10016954 | Ga0207663_100169544 | 370 |
| 361 | 3300025917 | Ga0207660_10015559 | Ga0207660_100155594 | 370 |
| 362 | 3300025927 | Ga0207687_10012803 | Ga0207687_100128033 | 370 |
| 363 | 3300025934 | Ga0207686_10007535 | Ga0207686_100075355 | 370 |
| 364 | 3300025935 | Ga0207709_10020293 | Ga0207709_100202931 | 370 |
| 365 | 3300025938 | Ga0207704_10024120 | Ga0207704_100241202 | 370 |
| 366 | 3300025942 | Ga0207689_10000764 | Ga0207689_1000076410 | 370 |
| 367 | 3300025986 | Ga0207658_10038501 | Ga0207658_100385012 | 370 |
| 368 | 3300026023 | Ga0207677_10112075 | Ga0207677_101120751 | 370 |
| 369 | 3300026035 | Ga0207703_10006634 | Ga0207703_100066344 | 370 |
| 370 | 3300026035 | Ga0207703_10290056 | Ga0207703_102900561 | 370 |
| 371 | 3300026075 | Ga0207708_10000350 | Ga0207708_100003507 | 370 |
| 372 | 3300026089 | Ga0207648_10000730 | Ga0207648_1000073027 | 370 |
| 373 | 3300026118 | Ga0207675_100000407 | Ga0207675_10000040712 | 370 |
| 374 | 3300028380 | Ga0268265_10072200 | Ga0268265_100722002 | 370 |
| 375 | 3300028381 | Ga0268264_10123268 | Ga0268264_101232682 | 370 |
| 376 | 3300035695 | Ga0373927_0018488 | Ga0373927_0018488_876_2150 | 370 |
| 377 | 3300046615 | Ga0495656_0000565 | Ga0495656_0000565_6851_8008 | 370 |
| 378 | 3300046691 | Ga0495670_0028413 | Ga0495670_0028413_1426_2583 | 370 |
| 379 | 3300049588 | Ga0501072_0011670 | Ga0501072_0011670_3316_4491 | 370 |
| 380 | 3300049741 | Ga0501079_0009980 | Ga0501079_0009980_3709_4884 | 370 |
| 381 | 3300005295 | Ga0065707_10121253 | Ga0065707_101212532 | 371 |
| 382 | 3300005549 | Ga0070704_100020278 | Ga0070704_1000202783 | 371 |
| 383 | 3300005577 | Ga0068857_100019680 | Ga0068857_1000196804 | 371 |
| 384 | 3300005617 | Ga0068859_100158028 | Ga0068859_1001580282 | 371 |
| 385 | 3300005618 | Ga0068864_100128738 | Ga0068864_1001287382 | 371 |
| 386 | 3300005842 | Ga0068858_100400559 | Ga0068858_1004005591 | 371 |
| 387 | 3300005843 | Ga0068860_100000313 | Ga0068860_10000031325 | 371 |
| 388 | 3300005843 | Ga0068860_100209283 | Ga0068860_1002092832 | 371 |
| 389 | 3300005843 | Ga0068860_100334697 | Ga0068860_1003346972 | 371 |
| 390 | 3300005844 | Ga0068862_100025183 | Ga0068862_1000251833 | 371 |
| 391 | 3300006931 | Ga0097620_100158035 | Ga0097620_1001580352 | 371 |
| 392 | 3300007076 | Ga0075435_100042169 | Ga0075435_1000421691 | 371 |
| 393 | 3300009147 | Ga0114129_10005868 | Ga0114129_1000586813 | 371 |
| 394 | 3300009174 | Ga0105241_10013313 | Ga0105241_100133131 | 371 |
| 395 | 3300009174 | Ga0105241_10211803 | Ga0105241_102118031 | 371 |
| 396 | 3300009176 | Ga0105242_10209935 | Ga0105242_102099352 | 371 |
| 397 | 3300009176 | Ga0105242_10241072 | Ga0105242_102410722 | 371 |
| 398 | 3300009553 | Ga0105249_10027333 | Ga0105249_100273334 | 371 |
| 399 | 3300013306 | Ga0163162_10070977 | Ga0163162_100709772 | 371 |
| 400 | 3300025272 | Ga0209455_1001457 | Ga0209455_10014579 | 371 |
| 401 | 3300025911 | Ga0207654_10039369 | Ga0207654_100393692 | 371 |
| 402 | 3300025934 | Ga0207686_10134370 | Ga0207686_101343702 | 371 |
| 403 | 3300025961 | Ga0207712_10009110 | Ga0207712_100091102 | 371 |
| 404 | 3300026116 | Ga0207674_10036532 | Ga0207674_100365324 | 371 |
| 405 | 3300028381 | Ga0268264_10000356 | Ga0268264_1000035643 | 371 |
| 406 | 3300028381 | Ga0268264_10260031 | Ga0268264_102600312 | 371 |
| 407 | 3300031507 | Ga0307509_10090777 | Ga0307509_100907772 | 371 |
| 408 | 3300031616 | Ga0307508_10046506 | Ga0307508_100465064 | 371 |
| 409 | 3300035170 | Ga0373943_0040716 | Ga0373943_0040716_893_2050 | 371 |
| 410 | 3300035695 | Ga0373927_0006414 | Ga0373927_0006414_442_1611 | 371 |
| 411 | 3300035724 | Ga0373933_0063090 | Ga0373933_0063090_405_1589 | 371 |
| 412 | 3300035725 | Ga0373947_0057500 | Ga0373947_0057500_121_1278 | 371 |
| 413 | 3300036401 | Ga0373937_0008736 | Ga0373937_0008736_5418_6593 | 371 |
| 414 | 3300037068 | Ga0373925_0001876 | Ga0373925_0001876_11332_12489 | 371 |
| 415 | 3300037068 | Ga0373925_0079034 | Ga0373925_0079034_272_1441 | 371 |
| 416 | 3300046533 | Ga0495640_0029322 | Ga0495640_0029322_296_1480 | 371 |
| 417 | 3300046537 | Ga0495598_0024323 | Ga0495598_0024323_126_1283 | 371 |
| 418 | 3300046557 | Ga0495622_0023739 | Ga0495622_0023739_591_1760 | 371 |
| 419 | 3300046684 | Ga0495669_0028068 | Ga0495669_0028068_415_1572 | 371 |
| 420 | 3300047320 | Ga0495672_0007685 | Ga0495672_0007685_2843_4042 | 371 |
| 421 | 3300048925 | Ga0496122_0067613 | Ga0496122_0067613_673_1932 | 371 |
| 422 | 3300049576 | Ga0501040_0016282 | Ga0501040_0016282_378_1559 | 371 |
| 423 | 3300049744 | Ga0501083_0075814 | Ga0501083_0075814_855_2036 | 371 |
| 424 | 3300050511 | nmdc:mga08y16_200748_c1 | nmdc:mga08y16_200748_c1_509_1666 | 371 |
| 425 | 3300050512 | nmdc:mga0n895_68778_c1 | nmdc:mga0n895_68778_c1_37_1197 | 371 |
| 426 | 3300053077 | Ga0495601_0029435 | Ga0495601_0029435_1754_2938 | 371 |
| 427 | 3300053085 | Ga0495619_0126023 | Ga0495619_0126023_135_1319 | 371 |
| 428 | 3300053162 | Ga0500638_050066 | Ga0500638_050066_35_1231 | 371 |
| 429 | 3300005546 | Ga0070696_100202890 | Ga0070696_1002028901 | 372 |
| 430 | 3300005985 | Ga0081539_10068231 | Ga0081539_100682312 | 372 |
| 431 | 3300013296 | Ga0157374_10102862 | Ga0157374_101028624 | 372 |
| 432 | 3300021388 | Ga0213875_10005326 | Ga0213875_100053266 | 372 |
| 433 | 3300037853 | Ga0436364_0135272 | Ga0436364_0135272_3152_4336 | 372 |
| 434 | 3300039437 | Ga0436365_0085725 | Ga0436365_0085725_6601_7773 | 372 |
| 435 | 3300039437 | Ga0436365_0118087 | Ga0436365_0118087_5573_6757 | 372 |
| 436 | 3300039453 | Ga0436362_0329416 | Ga0436362_0329416_1696_2880 | 372 |
| 437 | 3300005328 | Ga0070676_10026301 | Ga0070676_100263011 | 373 |
| 438 | 3300005333 | Ga0070677_10013826 | Ga0070677_100138261 | 373 |
| 439 | 3300005334 | Ga0068869_100049375 | Ga0068869_1000493751 | 373 |
| 440 | 3300005335 | Ga0070666_10003619 | Ga0070666_100036191 | 373 |
| 441 | 3300005338 | Ga0068868_100021668 | Ga0068868_1000216685 | 373 |
| 442 | 3300005353 | Ga0070669_100023153 | Ga0070669_1000231531 | 373 |
| 443 | 3300005354 | Ga0070675_100016931 | Ga0070675_1000169316 | 373 |
| 444 | 3300005355 | Ga0070671_100024353 | Ga0070671_1000243531 | 373 |
| 445 | 3300005364 | Ga0070673_100058159 | Ga0070673_1000581594 | 373 |
| 446 | 3300005456 | Ga0070678_100174417 | Ga0070678_1001744171 | 373 |
| 447 | 3300005457 | Ga0070662_100019056 | Ga0070662_1000190562 | 373 |
| 448 | 3300005459 | Ga0068867_100026669 | Ga0068867_1000266691 | 373 |
| 449 | 3300005548 | Ga0070665_100281470 | Ga0070665_1002814702 | 373 |
| 450 | 3300005616 | Ga0068852_100176150 | Ga0068852_1001761502 | 373 |
| 451 | 3300005618 | Ga0068864_100007047 | Ga0068864_1000070472 | 373 |
| 452 | 3300005841 | Ga0068863_100238704 | Ga0068863_1002387042 | 373 |
| 453 | 3300005842 | Ga0068858_100009495 | Ga0068858_1000094952 | 373 |
| 454 | 3300006237 | Ga0097621_100013606 | Ga0097621_1000136064 | 373 |
| 455 | 3300006358 | Ga0068871_100072402 | Ga0068871_1000724024 | 373 |
| 456 | 3300009177 | Ga0105248_10125514 | Ga0105248_101255144 | 373 |
| 457 | 3300013296 | Ga0157374_10009574 | Ga0157374_100095741 | 373 |
| 458 | 3300013297 | Ga0157378_10027251 | Ga0157378_100272512 | 373 |
| 459 | 3300013306 | Ga0163162_10023144 | Ga0163162_100231447 | 373 |
| 460 | 3300013308 | Ga0157375_10008755 | Ga0157375_100087551 | 373 |
| 461 | 3300014325 | Ga0163163_10096046 | Ga0163163_100960461 | 373 |
| 462 | 3300014968 | Ga0157379_10006093 | Ga0157379_100060938 | 373 |
| 463 | 3300014969 | Ga0157376_10050960 | Ga0157376_100509601 | 373 |
| 464 | 3300017792 | Ga0163161_10016276 | Ga0163161_100162765 | 373 |
| 465 | 3300025903 | Ga0207680_10002188 | Ga0207680_100021886 | 373 |
| 466 | 3300025923 | Ga0207681_10017575 | Ga0207681_100175755 | 373 |
| 467 | 3300025925 | Ga0207650_10164278 | Ga0207650_101642782 | 373 |
| 468 | 3300025926 | Ga0207659_10015574 | Ga0207659_100155745 | 373 |
| 469 | 3300025933 | Ga0207706_10077963 | Ga0207706_100779633 | 373 |
| 470 | 3300025940 | Ga0207691_10028481 | Ga0207691_100284811 | 373 |
| 471 | 3300025941 | Ga0207711_10073488 | Ga0207711_100734884 | 373 |
| 472 | 3300025942 | Ga0207689_10018757 | Ga0207689_100187573 | 373 |
| 473 | 3300025960 | Ga0207651_10006357 | Ga0207651_100063572 | 373 |
| 474 | 3300025961 | Ga0207712_10070376 | Ga0207712_100703763 | 373 |
| 475 | 3300026023 | Ga0207677_10002924 | Ga0207677_100029249 | 373 |
| 476 | 3300026035 | Ga0207703_10017073 | Ga0207703_100170736 | 373 |
| 477 | 3300026088 | Ga0207641_10012029 | Ga0207641_100120292 | 373 |
| 478 | 3300026089 | Ga0207648_10039687 | Ga0207648_100396875 | 373 |
| 479 | 3300026095 | Ga0207676_10001503 | Ga0207676_100015035 | 373 |
| 480 | 3300026121 | Ga0207683_10046223 | Ga0207683_100462231 | 373 |
| 481 | 3300031456 | Ga0307513_10066845 | Ga0307513_100668453 | 373 |
| 482 | 3300031616 | Ga0307508_10015555 | Ga0307508_100155553 | 373 |
| 483 | 3300031730 | Ga0307516_10139534 | Ga0307516_101395341 | 373 |
| 484 | 3300005435 | Ga0070714_100250738 | Ga0070714_1002507381 | 374 |
| 485 | 3300005436 | Ga0070713_100056034 | Ga0070713_1000560342 | 374 |
| 486 | 3300005614 | Ga0068856_100089186 | Ga0068856_1000891862 | 374 |
| 487 | 3300007788 | Ga0099795_10066988 | Ga0099795_100669881 | 374 |
| 488 | 3300025922 | Ga0207646_10005709 | Ga0207646_100057096 | 374 |
| 489 | 3300025928 | Ga0207700_10006286 | Ga0207700_100062864 | 374 |
| 490 | 3300025928 | Ga0207700_10068288 | Ga0207700_100682882 | 374 |
| 491 | 3300025929 | Ga0207664_10023830 | Ga0207664_100238305 | 374 |
| 492 | 3300026078 | Ga0207702_10029793 | Ga0207702_100297933 | 374 |
| 493 | 3300026078 | Ga0207702_10053924 | Ga0207702_100539242 | 374 |
| 494 | 3300035112 | Ga0373932_0021898 | Ga0373932_0021898_31_1182 | 374 |
| 495 | 3300037471 | Ga0395905_0086452 | Ga0395905_0086452_1389_2552 | 374 |
| 496 | 3300039453 | Ga0436362_1127920 | Ga0436362_1127920_713_1870 | 374 |
| 497 | 3300048913 | Ga0496110_0400695 | Ga0496110_0400695_19_1170 | 374 |
| 498 | 3300048915 | Ga0496112_0011155 | Ga0496112_0011155_2687_3838 | 374 |
| 499 | 3300048915 | Ga0496112_0195578 | Ga0496112_0195578_739_1890 | 374 |
| 500 | 3300003203 | JGI25406J46586_10000058 | JGI25406J46586_1000005827 | 375 |
| 501 | 3300005985 | Ga0081539_10000825 | Ga0081539_1000082529 | 375 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xmd-assembly2.cif.gz_D-3 | crystal structure of epoxide hydrolase vreh1 from vigna radiata | 0.8817 | 13 | 372 |
| 6unw-assembly1.cif.gz_A | epoxide hydrolase from an endophytic streptomyces | 0.8772 | 12 | 370 |
| 8hm5-assembly1.cif.gz_A | epoxide hydrolase from caballeronia sordidicola pamc 26510 | 0.8765 | 14 | 371 |
| 8b6p-assembly2.cif.gz_B | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) | 0.8758 | 15 | 144 |
| 8b6p-assembly1.cif.gz_A | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) | 0.8756 | 16 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0KMM0_1_93_3.40.50.12270 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.93 | 12 | 111 | 3.40.50.12270 |
| af_A0A0R0KMM0_1_93_3.40.50.12270 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9111 | 12 | 111 | 3.40.50.12270 |
| af_Q9NQF3_11_190_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9062 | 16 | 138 | 3.40.50.1820 |
| af_B6SUW2_10_323_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8938 | 15 | 372 | 3.40.50.1820 |
| af_B6SUW2_10_323_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.883 | 15 | 372 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8KN06-F1-model_v4 | Alpha/beta hydrolase | 0.9935 | 168 | 372 |
GO:0016787
|
| AF-A0A4Q4CVM9-F1-model_v4 | Alpha/beta fold hydrolase | 0.9882 | 2 | 370 |
GO:0016787
|
| AF-H0SEL6-F1-model_v4 | Putative epoxide hydrolase (EC 2.7.10.2, EC 3.3.2.9) | 0.9877 | 29 | 371 |
GO:0004715
GO:0033961 |
| AF-A0A349SFC6-F1-model_v4 | Alpha/beta hydrolase | 0.9857 | 176 | 270 |
GO:0016787
|
| AF-A0A2E1TXS4-F1-model_v4 | Alpha/beta hydrolase | 0.9836 | 3 | 372 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar