F455663

General Info

Members Datasets Scaffolds Average Seq Length
501 292 495 382

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100041778|Ga0068859_1000417783
Length 452
Sequence MSILGNISRCEWPSSKRKEENEPWARVPHFCDFLPRRSLLVVFCYGLPFQQSASAARKWIEMNEIAALPQSILPSGIRSRFVRDVNGLKMHILEAGFEAGTGSNGKPLVLLLHGFPELAYSWRKVMLPLAAAGYHVVAPDQRGYGRTTGWDGNFDGNVASFRMLNLVRDTLALVSALGCRTVDGLFGHDAGSHVAAWCSLIRPDVFRSVAMMSAPFGGAPQLPFNTDSDGSQKARDSIHEDLAALKRPRKHYQWYYSTRPANDDMWKCRQGVHAFMRAYYHHKSADWKQNQPFPLKSWTAGELEKMPTYYIMDLDENMAETVAKEMPSASEIAANKWLPDSELALYAEEYGRNGYQGGLQWYRCNTTGANSTELQLFSGRTIDVPSCFIAGKSDWGIYQRPGGDMIAMQKHAVTNMLGCHLVEGAGHWVQQEQPGKVSELLLEFLRHTRSKA

Samples

Sample ID Description Type Environment
1 2643221651 Afipia sp. Root123D2 Isolate Unclassified
2 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
3 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
4 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
5 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
162 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
165 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
189 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
275 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
276 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
277 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
278 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
279 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
280 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
281 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
282 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
283 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
284 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
285 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
286 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
287 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
288 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
292 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.58
Nodule 0.4
Rhizoplane 1.6
Rhizosphere 81.84
Stem 0
Stem Tuber 0
Unclassified 7.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000058 3300003203 Bacteria 50229
2 JGI25405J52794_10007987 3300003911 Bacteria 1965
3 Ga0065707_10003366 3300005295 Bacteria 4393
4 Ga0065707_10121253 3300005295 Bacteria 2114
5 Ga0070676_10026301 3300005328 Bacteria 3294
6 Ga0070690_100003927 3300005330 Bacteria 8203
7 Ga0070677_10013826 3300005333 Bacteria 2832
8 Ga0068869_100001195 3300005334 Bacteria 15252
9 Ga0068869_100049375 3300005334 Bacteria 3045
10 Ga0068869_100177068 3300005334 Bacteria 1670
11 Ga0070666_10003619 3300005335 Bacteria 9369
12 Ga0070680_100089070 3300005336 Bacteria 2554
13 Ga0068868_100011557 3300005338 Bacteria 6431
14 Ga0068868_100021668 3300005338 Bacteria 4841
15 Ga0070689_100184107 3300005340 Bacteria 1698
16 Ga0070691_10021482 3300005341 Bacteria 2987
17 Ga0070691_10031683 3300005341 Bacteria 2481
18 Ga0070692_10003405 3300005345 Bacteria 6448
19 Ga0070692_10012980 3300005345 Bacteria 3873
20 Ga0070669_100014354 3300005353 Bacteria 5637
21 Ga0070669_100023153 3300005353 Bacteria 4446
22 Ga0070675_100016931 3300005354 Bacteria 5789
23 Ga0070671_100024353 3300005355 Bacteria 4955
24 Ga0070673_100058159 3300005364 Bacteria 3056
25 Ga0070709_10028368 3300005434 Bacteria 3337
26 Ga0070709_10034439 3300005434 Bacteria 3070
27 Ga0070714_100055371 3300005435 Bacteria 3389
28 Ga0070714_100064531 3300005435 Bacteria 3152
29 Ga0070714_100148537 3300005435 Bacteria 2110
30 Ga0070714_100250738 3300005435 Bacteria 1637
31 Ga0070713_100002801 3300005436 Bacteria 11398
32 Ga0070713_100050811 3300005436 Bacteria 3426
33 Ga0070713_100056034 3300005436 Bacteria 3278
34 Ga0070713_100169604 3300005436 Bacteria 1954
35 Ga0070701_10014671 3300005438 Bacteria 3598
36 Ga0070711_100179781 3300005439 Bacteria 1619
37 Ga0070700_100003099 3300005441 Bacteria 8522
38 Ga0070700_100008396 3300005441 Bacteria 5625
39 Ga0070700_100070856 3300005441 Bacteria 2224
40 Ga0070694_100020570 3300005444 Bacteria 4209
41 Ga0070694_100036434 3300005444 Bacteria 3259
42 Ga0070694_100260925 3300005444 Bacteria 1314
43 Ga0070708_100021532 3300005445 Bacteria 5452
44 Ga0070678_100031048 3300005456 Bacteria 3680
45 Ga0070678_100174417 3300005456 Bacteria 1754
46 Ga0070662_100019056 3300005457 Bacteria 4653
47 Ga0070681_10020967 3300005458 Bacteria 6547
48 Ga0070681_10052162 3300005458 Bacteria 4079
49 Ga0068867_100005100 3300005459 Bacteria 9283
50 Ga0068867_100007205 3300005459 Bacteria 7862
51 Ga0068867_100026669 3300005459 Bacteria 4149
52 Ga0070706_100295150 3300005467 Bacteria 1513
53 Ga0070698_100003223 3300005471 Bacteria 17975
54 Ga0070698_100022570 3300005471 Bacteria 6582
55 Ga0070699_100021812 3300005518 Bacteria 5520
56 Ga0070699_100158141 3300005518 Bacteria 2005
57 Ga0070697_100015876 3300005536 Bacteria 5916
58 Ga0068853_100038928 3300005539 Bacteria 4053
59 Ga0070672_100008668 3300005543 Bacteria 6972
60 Ga0070686_100022109 3300005544 Bacteria 3785
61 Ga0070695_100013074 3300005545 Bacteria 4987
62 Ga0070695_100051908 3300005545 Bacteria 2633
63 Ga0070696_100065169 3300005546 Bacteria 2553
64 Ga0070696_100169321 3300005546 Bacteria 1614
65 Ga0070696_100202890 3300005546 Bacteria 1481
66 Ga0070693_100016380 3300005547 Bacteria 3836
67 Ga0070665_100281470 3300005548 Bacteria 1665
68 Ga0070704_100020278 3300005549 Bacteria 4284
69 Ga0070704_100033403 3300005549 Bacteria 3478
70 Ga0070704_100238825 3300005549 Bacteria 1486
71 Ga0070704_100239765 3300005549 Bacteria 1483
72 Ga0068857_100014788 3300005577 Bacteria 6809
73 Ga0068857_100019680 3300005577 Bacteria 5930
74 Ga0068856_100089186 3300005614 Bacteria 3066
75 Ga0070702_100001167 3300005615 Bacteria 10571
76 Ga0068852_100176150 3300005616 Bacteria 2008
77 Ga0068852_100283758 3300005616 Bacteria 1597
78 Ga0068859_100041778 3300005617 Bacteria 4605
79 Ga0068859_100133541 3300005617 Bacteria 2554
80 Ga0068859_100158028 3300005617 Bacteria 2345
81 Ga0068864_100007047 3300005618 Bacteria 9229
82 Ga0068864_100128738 3300005618 Bacteria 2271
83 Ga0068866_10002399 3300005718 Bacteria 7756
84 Ga0068866_10023305 3300005718 Bacteria 2878
85 Ga0068866_10185289 3300005718 Bacteria 1232
86 Ga0068861_100001889 3300005719 Bacteria 13486
87 Ga0068861_100062769 3300005719 Bacteria 2854
88 Ga0068863_100167799 3300005841 Bacteria 2105
89 Ga0068863_100238704 3300005841 Bacteria 1754
90 Ga0068863_100390603 3300005841 Bacteria 1360
91 Ga0068858_100004481 3300005842 Bacteria 13691
92 Ga0068858_100009495 3300005842 Bacteria 9281
93 Ga0068858_100059318 3300005842 Bacteria 3537
94 Ga0068858_100400559 3300005842 Bacteria 1319
95 Ga0068860_100000313 3300005843 Bacteria 66545
96 Ga0068860_100001386 3300005843 Bacteria 26300
97 Ga0068860_100022843 3300005843 Bacteria 6049
98 Ga0068860_100209283 3300005843 Bacteria 1892
99 Ga0068860_100334697 3300005843 Bacteria 1487
100 Ga0068862_100006449 3300005844 Bacteria 9748
101 Ga0068862_100022960 3300005844 Bacteria 5224
102 Ga0068862_100025183 3300005844 Bacteria 4995
103 Ga0081455_10000451 3300005937 Bacteria 54150
104 Ga0081455_10046474 3300005937 Bacteria 3765
105 Ga0081540_1012873 3300005983 Bacteria 5471
106 Ga0081539_10000825 3300005985 Bacteria 59902
107 Ga0081539_10006413 3300005985 Bacteria 11301
108 Ga0081539_10068231 3300005985 Bacteria 1920
109 Ga0075365_10059380 3300006038 Bacteria 2549
110 Ga0075365_10089653 3300006038 Bacteria 2094
111 Ga0075368_10027596 3300006042 Bacteria 2191
112 Ga0075363_100041743 3300006048 Bacteria 2420
113 Ga0075364_10033775 3300006051 Bacteria 3296
114 Ga0075364_10079093 3300006051 Bacteria 2172
115 Ga0070715_10007955 3300006163 Bacteria 3674
116 Ga0070716_100153519 3300006173 Bacteria 1484
117 Ga0070712_100007322 3300006175 Bacteria 6888
118 Ga0070712_100011749 3300006175 Bacteria 5565
119 Ga0075362_10005399 3300006177 Bacteria 4673
120 Ga0075362_10015806 3300006177 Bacteria 3077
121 Ga0075362_10037140 3300006177 Bacteria 2134
122 Ga0075362_10061775 3300006177 Bacteria 1696
123 Ga0075367_10027695 3300006178 Bacteria 3226
124 Ga0075369_10000203 3300006186 Bacteria 17437
125 Ga0075369_10041196 3300006186 Bacteria 1977
126 Ga0075427_10009740 3300006194 Bacteria 1432
127 Ga0097621_100002301 3300006237 Bacteria 13083
128 Ga0097621_100013606 3300006237 Bacteria 6070
129 Ga0097621_100153503 3300006237 Bacteria 1975
130 Ga0075370_10053310 3300006353 Bacteria 2295
131 Ga0075370_10124178 3300006353 Bacteria 1504
132 Ga0068871_100012897 3300006358 Bacteria 6189
133 Ga0068871_100072402 3300006358 Bacteria 2838
134 Ga0075428_100016657 3300006844 Bacteria 8117
135 Ga0075428_100111069 3300006844 Bacteria 2987
136 Ga0075430_100157470 3300006846 Bacteria 1890
137 Ga0075431_100039880 3300006847 Bacteria 4838
138 Ga0075433_10240602 3300006852 Bacteria 1607
139 Ga0075434_100378848 3300006871 Bacteria 1436
140 Ga0075429_100000151 3300006880 Bacteria 43094
141 Ga0068865_100000472 3300006881 Bacteria 22488
142 Ga0068865_100004561 3300006881 Bacteria 8358
143 Ga0068865_100163761 3300006881 Bacteria 1699
144 Ga0097620_100041779 3300006931 Bacteria 4605
145 Ga0097620_100133536 3300006931 Bacteria 2554
146 Ga0097620_100158035 3300006931 Bacteria 2345
147 Ga0075435_100042169 3300007076 Bacteria 3650
148 Ga0099795_10066988 3300007788 Bacteria 1346
149 Ga0105240_10140606 3300009093 Bacteria 2886
150 Ga0111539_10321175 3300009094 Bacteria 1802
151 Ga0105245_10010186 3300009098 Bacteria 8185
152 Ga0105245_10150395 3300009098 Bacteria 2201
153 Ga0114129_10005868 3300009147 Bacteria 17387
154 Ga0114129_10007243 3300009147 Bacteria 15794
155 Ga0105243_10006693 3300009148 Bacteria 8897
156 Ga0105243_10103162 3300009148 Bacteria 2371
157 Ga0105241_10013313 3300009174 Bacteria 6029
158 Ga0105241_10211803 3300009174 Bacteria 1624
159 Ga0105242_10001815 3300009176 Bacteria 16772
160 Ga0105242_10006305 3300009176 Bacteria 9138
161 Ga0105242_10048360 3300009176 Bacteria 3457
162 Ga0105242_10209935 3300009176 Bacteria 1735
163 Ga0105242_10241072 3300009176 Bacteria 1625
164 Ga0105248_10125514 3300009177 Bacteria 2896
165 Ga0105248_10192203 3300009177 Bacteria 2300
166 Ga0105237_10115208 3300009545 Bacteria 2681
167 Ga0105238_10132272 3300009551 Bacteria 2473
168 Ga0105249_10011488 3300009553 Bacteria 7778
169 Ga0105249_10027333 3300009553 Bacteria 5147
170 Ga0105249_10059545 3300009553 Bacteria 3502
171 Ga0105249_10254007 3300009553 Bacteria 1744
172 Ga0105246_10018942 3300011119 Bacteria 4391
173 Ga0157374_10009574 3300013296 Bacteria 8321
174 Ga0157374_10102862 3300013296 Bacteria 2740
175 Ga0157378_10010502 3300013297 Bacteria 8091
176 Ga0157378_10019923 3300013297 Bacteria 5898
177 Ga0157378_10027251 3300013297 Bacteria 5043
178 Ga0163162_10015589 3300013306 Bacteria 7427
179 Ga0163162_10023144 3300013306 Bacteria 6128
180 Ga0163162_10037972 3300013306 Bacteria 4807
181 Ga0163162_10070977 3300013306 Bacteria 3535
182 Ga0157375_10008755 3300013308 Bacteria 8867
183 Ga0157375_10058170 3300013308 Bacteria 3824
184 Ga0157375_10229291 3300013308 Bacteria 2016
185 Ga0163163_10096046 3300014325 Bacteria 2984
186 Ga0157380_10010371 3300014326 Bacteria 6701
187 Ga0157380_10011956 3300014326 Bacteria 6280
188 Ga0157377_10006406 3300014745 Bacteria 5612
189 Ga0157379_10006093 3300014968 Bacteria 10385
190 Ga0157379_10059456 3300014968 Bacteria 3417
191 Ga0157376_10050960 3300014969 Bacteria 3436
192 Ga0163161_10016276 3300017792 Bacteria 5191
193 Ga0213874_10018287 3300021377 Bacteria 1892
194 Ga0213875_10000142 3300021388 Bacteria 77423
195 Ga0213875_10005326 3300021388 Bacteria 6918
196 Ga0213875_10008093 3300021388 Bacteria 5401
197 Ga0213875_10025079 3300021388 Bacteria 2842
198 Ga0213875_10090362 3300021388 Bacteria 1428
199 Ga0213871_10004269 3300021441 Bacteria 2846
200 Ga0213871_10025622 3300021441 Bacteria 1503
201 Ga0209455_1001457 3300025272 Bacteria 10642
202 Ga0207692_10074710 3300025898 Bacteria 1796
203 Ga0207642_10017333 3300025899 Bacteria 2737
204 Ga0207642_10030768 3300025899 Bacteria 2240
205 Ga0207642_10032089 3300025899 Bacteria 2208
206 Ga0207688_10106974 3300025901 Bacteria 1621
207 Ga0207680_10002188 3300025903 Bacteria 9160
208 Ga0207685_10015454 3300025905 Bacteria 2418
209 Ga0207699_10025430 3300025906 Bacteria 3250
210 Ga0207699_10050228 3300025906 Bacteria 2458
211 Ga0207699_10176891 3300025906 Bacteria 1432
212 Ga0207643_10017180 3300025908 Bacteria 3952
213 Ga0207654_10039369 3300025911 Bacteria 2658
214 Ga0207707_10039135 3300025912 Bacteria 4145
215 Ga0207707_10153199 3300025912 Bacteria 2015
216 Ga0207671_10013702 3300025914 Bacteria 6441
217 Ga0207693_10000731 3300025915 Bacteria 29597
218 Ga0207693_10051739 3300025915 Bacteria 3222
219 Ga0207663_10016954 3300025916 Bacteria 4050
220 Ga0207660_10015559 3300025917 Bacteria 5022
221 Ga0207662_10011885 3300025918 Bacteria 4839
222 Ga0207657_10288496 3300025919 Bacteria 1302
223 Ga0207646_10005709 3300025922 Bacteria 13053
224 Ga0207646_10038818 3300025922 Bacteria 4286
225 Ga0207681_10008173 3300025923 Bacteria 6398
226 Ga0207681_10017575 3300025923 Bacteria 4493
227 Ga0207694_10166316 3300025924 Bacteria 1784
228 Ga0207650_10164278 3300025925 Bacteria 1761
229 Ga0207659_10015574 3300025926 Bacteria 4931
230 Ga0207687_10012803 3300025927 Bacteria 5482
231 Ga0207700_10006286 3300025928 Bacteria 7168
232 Ga0207700_10068288 3300025928 Bacteria 2724
233 Ga0207700_10255619 3300025928 Bacteria 1498
234 Ga0207664_10023830 3300025929 Bacteria 4593
235 Ga0207664_10128778 3300025929 Bacteria 2128
236 Ga0207664_10162079 3300025929 Bacteria 1908
237 Ga0207664_10317095 3300025929 Bacteria 1375
238 Ga0207706_10077963 3300025933 Bacteria 2914
239 Ga0207686_10002624 3300025934 Bacteria 9757
240 Ga0207686_10007535 3300025934 Bacteria 5859
241 Ga0207686_10134370 3300025934 Bacteria 1701
242 Ga0207709_10020293 3300025935 Bacteria 3747
243 Ga0207704_10024120 3300025938 Bacteria 3292
244 Ga0207665_10216522 3300025939 Bacteria 1402
245 Ga0207691_10028481 3300025940 Bacteria 5231
246 Ga0207711_10073488 3300025941 Bacteria 2972
247 Ga0207689_10000764 3300025942 Bacteria 30878
248 Ga0207689_10018757 3300025942 Bacteria 5834
249 Ga0207689_10183536 3300025942 Bacteria 1725
250 Ga0207651_10006357 3300025960 Bacteria 6175
251 Ga0207712_10009102 3300025961 Bacteria 6280
252 Ga0207712_10009110 3300025961 Bacteria 6279
253 Ga0207712_10070376 3300025961 Bacteria 2513
254 Ga0207668_10159998 3300025972 Bacteria 1754
255 Ga0207658_10034297 3300025986 Bacteria 3627
256 Ga0207658_10038501 3300025986 Bacteria 3445
257 Ga0207677_10002924 3300026023 Bacteria 9022
258 Ga0207677_10112075 3300026023 Bacteria 2034
259 Ga0207703_10006634 3300026035 Bacteria 9235
260 Ga0207703_10017073 3300026035 Bacteria 5660
261 Ga0207703_10045431 3300026035 Bacteria 3533
262 Ga0207703_10290056 3300026035 Bacteria 1489
263 Ga0207639_10003184 3300026041 Bacteria 11034
264 Ga0207708_10000350 3300026075 Bacteria 36165
265 Ga0207708_10013010 3300026075 Bacteria 6208
266 Ga0207708_10014041 3300026075 Bacteria 5984
267 Ga0207708_10015435 3300026075 Bacteria 5729
268 Ga0207708_10118214 3300026075 Bacteria 2064
269 Ga0207702_10029793 3300026078 Bacteria 4543
270 Ga0207702_10053924 3300026078 Bacteria 3405
271 Ga0207641_10012029 3300026088 Bacteria 7100
272 Ga0207648_10000730 3300026089 Bacteria 36815
273 Ga0207648_10001237 3300026089 Bacteria 28700
274 Ga0207648_10039687 3300026089 Bacteria 4138
275 Ga0207676_10001503 3300026095 Bacteria 17221
276 Ga0207674_10036532 3300026116 Bacteria 5116
277 Ga0207674_10194140 3300026116 Bacteria 1980
278 Ga0207675_100000407 3300026118 Bacteria 41288
279 Ga0207675_100001346 3300026118 Bacteria 24652
280 Ga0207683_10027278 3300026121 Bacteria 4935
281 Ga0207683_10046223 3300026121 Bacteria 3809
282 Ga0207683_10087355 3300026121 Bacteria 2773
283 Ga0207683_10091832 3300026121 Bacteria 2705
284 Ga0207428_10032808 3300027907 Bacteria 4270
285 Ga0207428_10037743 3300027907 Bacteria 3929
286 Ga0268265_10005960 3300028380 Bacteria 8298
287 Ga0268265_10072200 3300028380 Bacteria 2691
288 Ga0268264_10000356 3300028381 Bacteria 68810
289 Ga0268264_10014230 3300028381 Bacteria 6542
290 Ga0268264_10123268 3300028381 Bacteria 2287
291 Ga0268264_10260031 3300028381 Bacteria 1616
292 Ga0265334_10004817 3300028573 Bacteria 5931
293 Ga0307517_10001421 3300028786 Bacteria 40285
294 Ga0265338_10079084 3300028800 Bacteria 2769
295 Ga0307511_10000851 3300030521 Bacteria 32500
296 Ga0307512_10070975 3300030522 Bacteria 2589
297 Ga0307513_10066845 3300031456 Bacteria 3775
298 Ga0307513_10167661 3300031456 Bacteria 2078
299 Ga0307509_10000577 3300031507 Bacteria 62808
300 Ga0307509_10090777 3300031507 Bacteria 3129
301 Ga0307508_10015555 3300031616 Bacteria 6931
302 Ga0307508_10046506 3300031616 Bacteria 3874
303 Ga0307516_10139534 3300031730 Bacteria 2195
304 Ga0307510_10029719 3300033180 Bacteria 6213
305 Ga0307510_10038105 3300033180 Bacteria 5319
306 Ga0373944_0028237 3300035089 Bacteria 1669
307 Ga0373932_0021898 3300035112 Bacteria 1692
308 Ga0373954_0023472 3300035118 Bacteria 2805
309 Ga0373957_0042354 3300035120 Bacteria 1718
310 Ga0373943_0040716 3300035170 Bacteria 2244
311 Ga0373943_0158283 3300035170 Bacteria 1231
312 Ga0373946_0110645 3300035171 Bacteria 1243
313 Ga0373961_0049954 3300035241 Bacteria 1238
314 Ga0316574_0032652 3300035398 Bacteria 3164
315 Ga0373931_0099728 3300035691 Bacteria 1632
316 Ga0373935_0057807 3300035692 Bacteria 2475
317 Ga0373935_0112390 3300035692 Bacteria 1809
318 Ga0373935_0166581 3300035692 Bacteria 1505
319 Ga0373935_0359414 3300035692 Bacteria 1039
320 Ga0373927_0006414 3300035695 Bacteria 8017
321 Ga0373927_0018488 3300035695 Unclassified 4580
322 Ga0373927_0157624 3300035695 Bacteria 1487
323 Ga0373933_0023555 3300035724 Bacteria 3519
324 Ga0373933_0063090 3300035724 Bacteria 2239
325 Ga0373933_0147125 3300035724 Bacteria 1490
326 Ga0373947_0057500 3300035725 Bacteria 2354
327 Ga0373937_0000638 3300036401 Bacteria 30717
328 Ga0373937_0008736 3300036401 Bacteria 8794
329 Ga0373937_0011341 3300036401 Bacteria 7819
330 Ga0373937_0043537 3300036401 Bacteria 4099
331 Ga0373937_0044524 3300036401 Bacteria 4054
332 Ga0373937_0053855 3300036401 Bacteria 3690
333 Ga0373937_0174427 3300036401 Bacteria 2018
334 Ga0373937_0198363 3300036401 Bacteria 1886
335 Ga0373925_0001876 3300037068 Bacteria 17464
336 Ga0373925_0017714 3300037068 Bacteria 5168
337 Ga0373925_0050850 3300037068 Bacteria 3092
338 Ga0373925_0061328 3300037068 Bacteria 2825
339 Ga0373925_0079034 3300037068 Bacteria 2498
340 Ga0395899_0180156 3300037312 Bacteria 1484
341 Ga0395905_0086452 3300037471 Bacteria 2939
342 Ga0436364_0018110 3300037853 Bacteria 2598
343 Ga0436364_0135272 3300037853 Bacteria 9918
344 Ga0436364_0766585 3300037853 Bacteria 21589
345 Ga0436364_1127111 3300037853 Bacteria 4770
346 Ga0436364_1128085 3300037853 Bacteria 1693
347 Ga0436364_1271676 3300037853 Bacteria 6329
348 Ga0400483_090459 3300039062 Bacteria 4418
349 Ga0400483_176188 3300039062 Bacteria 10728
350 Ga0436365_0085725 3300039437 Bacteria 7823
351 Ga0436365_0118087 3300039437 Bacteria 14166
352 Ga0436365_0776181 3300039437 Bacteria 2974
353 Ga0436365_1598157 3300039437 Bacteria 2502
354 Ga0436365_1850857 3300039437 Bacteria 1760
355 Ga0436361_0930897 3300039447 Bacteria 3211
356 Ga0436361_0935188 3300039447 Bacteria 4569
357 Ga0436363_0537438 3300039450 Bacteria 3191
358 Ga0436362_0329416 3300039453 Bacteria 4201
359 Ga0436362_1127920 3300039453 Bacteria 4435
360 Ga0436362_1222155 3300039453 Bacteria 2034
361 Ga0439465_0028803 3300041413 Bacteria 1763
362 Ga0439465_0029248 3300041413 Bacteria 1750
363 Ga0439441_000035 3300042001 Bacteria 9994
364 Ga0453683_0176282 3300044673 Bacteria 1355
365 Ga0466963_0275811 3300044694 Bacteria 1181
366 Ga0466959_0042292 3300045049 Bacteria 3361
367 Ga0495592_0000142 3300046454 Bacteria 63571
368 Ga0495592_0041123 3300046454 Bacteria 3465
369 Ga0495638_0126601 3300046460 Bacteria 1505
370 Ga0495653_0145315 3300046463 Bacteria 1663
371 Ga0495664_0023853 3300046477 Bacteria 3552
372 Ga0495608_0000890 3300046511 Bacteria 20925
373 Ga0495608_0007116 3300046511 Bacteria 7914
374 Ga0495608_0154560 3300046511 Bacteria 1461
375 Ga0495610_0030843 3300046512 Bacteria 2803
376 Ga0495618_0255463 3300046514 Bacteria 1098
377 Ga0495628_0040199 3300046516 Bacteria 3738
378 Ga0495640_0021402 3300046533 Bacteria 4746
379 Ga0495640_0029322 3300046533 Bacteria 3952
380 Ga0495640_0138882 3300046533 Bacteria 1567
381 Ga0495587_0002800 3300046536 Bacteria 11657
382 Ga0495598_0024323 3300046537 Bacteria 1641
383 Ga0495645_0043278 3300046543 Bacteria 3284
384 Ga0495622_0023739 3300046557 Bacteria 2861
385 Ga0495667_0003101 3300046559 Bacteria 11146
386 Ga0495656_0000565 3300046615 Bacteria 12114
387 Ga0495668_0112399 3300046616 Bacteria 1490
388 Ga0495623_0133341 3300046679 Bacteria 1485
389 Ga0495646_0010269 3300046680 Bacteria 5955
390 Ga0495646_0099587 3300046680 Bacteria 1668
391 Ga0495647_0118146 3300046681 Bacteria 1113
392 Ga0495669_0028068 3300046684 Bacteria 2463
393 Ga0495670_0028413 3300046691 Bacteria 2773
394 Ga0495600_0011797 3300046809 Bacteria 5456
395 Ga0495604_0008196 3300047317 Bacteria 8267
396 Ga0495672_0007685 3300047320 Bacteria 8079
397 Ga0495672_0091983 3300047320 Bacteria 1664
398 Ga0495680_0020559 3300047322 Bacteria 5549
399 Ga0495680_0064403 3300047322 Bacteria 2811
400 Ga0495680_0108992 3300047322 Bacteria 2054
401 Ga0495675_0001936 3300047444 Bacteria 12346
402 Ga0495686_0113816 3300047472 Bacteria 1620
403 Ga0495602_0000557 3300048088 Bacteria 34744
404 Ga0496100_0083424 3300048903 Bacteria 2164
405 Ga0496101_0135893 3300048904 Bacteria 1871
406 Ga0496110_0400695 3300048913 Bacteria 1251
407 Ga0496112_0011155 3300048915 Bacteria 8193
408 Ga0496112_0195578 3300048915 Bacteria 1983
409 Ga0496114_0027502 3300048917 Bacteria 4660
410 Ga0496114_0256291 3300048917 Bacteria 1540
411 Ga0496115_0186537 3300048918 Bacteria 1714
412 Ga0496121_0038053 3300048924 Bacteria 4267
413 Ga0496122_0067613 3300048925 Bacteria 2572
414 Ga0496126_0115554 3300048929 Bacteria 2333
415 Ga0501033_0070818 3300049570 Bacteria 2561
416 Ga0501034_0000730 3300049571 Bacteria 49754
417 Ga0501034_0001037 3300049571 Bacteria 39713
418 Ga0501034_0034649 3300049571 Bacteria 5119
419 Ga0501036_0150121 3300049572 Bacteria 1966
420 Ga0501038_0103602 3300049574 Bacteria 2366
421 Ga0501040_0016282 3300049576 Bacteria 4919
422 Ga0501042_0003628 3300049578 Bacteria 9736
423 Ga0501048_0008044 3300049582 Bacteria 7987
424 Ga0501068_0022447 3300049584 Bacteria 3691
425 Ga0501068_0068705 3300049584 Bacteria 2159
426 Ga0501071_0002972 3300049587 Bacteria 10479
427 Ga0501071_0003547 3300049587 Bacteria 9766
428 Ga0501072_0006277 3300049588 Bacteria 9052
429 Ga0501072_0011670 3300049588 Bacteria 6712
430 Ga0501072_0028452 3300049588 Bacteria 4364
431 Ga0501073_0051600 3300049589 Bacteria 2881
432 Ga0501075_0003556 3300049591 Bacteria 10433
433 Ga0501075_0100872 3300049591 Bacteria 2192
434 Ga0501076_0000337 3300049592 Bacteria 28949
435 Ga0501079_0009980 3300049741 Bacteria 7208
436 Ga0501080_0002713 3300049742 Bacteria 15518
437 Ga0501080_0174359 3300049742 Bacteria 1982
438 Ga0501083_0075814 3300049744 Bacteria 2233
439 Ga0501035_0192439 3300049822 Bacteria 1753
440 Ga0501044_0426645 3300049823 Bacteria 1235
441 Ga0501045_0000120 3300049824 Bacteria 40494
442 nmdc:mga03683_2234_c1 3300050489 Bacteria 5972
443 nmdc:mga03683_28456_c1 3300050489 Bacteria 2222
444 nmdc:mga00v17_109559_c1 3300050491 Bacteria 1751
445 nmdc:mga0yw44_180123_c1 3300050492 Bacteria 1391
446 nmdc:mga0yw44_23017_c1 3300050492 Bacteria 3505
447 nmdc:mga0k408_13218_c1 3300050493 Bacteria 4524
448 nmdc:mga0k408_134050_c1 3300050493 Bacteria 1471
449 nmdc:mga06z11_55144_c1 3300050494 Bacteria 2051
450 nmdc:mga07m45_12489_c1 3300050496 Bacteria 4490
451 nmdc:mga05p37_586347_c1 3300050507 Bacteria 1261
452 nmdc:mga05p37_840_c1 3300050507 Bacteria 34480
453 nmdc:mga09592_5_c1 3300050508 Bacteria 130353
454 nmdc:mga09592_64812_c1 3300050508 Bacteria 3094
455 nmdc:mga0qj67_171685_c1 3300050509 Bacteria 1761
456 nmdc:mga0qj67_329804_c1 3300050509 Bacteria 1235
457 nmdc:mga06r32_50201_c1 3300050510 Bacteria 3990
458 nmdc:mga06r32_9313_c1 3300050510 Bacteria 8853
459 nmdc:mga08y16_200748_c1 3300050511 Bacteria 2067
460 nmdc:mga0n895_68778_c1 3300050512 Bacteria 3508
461 nmdc:mga08x19_339849_c1 3300050514 Bacteria 1047
462 nmdc:mga0a205_185465_c1 3300050515 Unclassified 1973
463 nmdc:mga0a205_68422_c1 3300050515 Bacteria 3429
464 nmdc:mga0a205_69727_c1 3300050515 Bacteria 3394
465 nmdc:mga0sz30_210_c1 3300050516 Bacteria 21966
466 Ga0495601_0001180 3300053077 Bacteria 14281
467 Ga0495601_0029435 3300053077 Bacteria 3406
468 Ga0495601_0039932 3300053077 Bacteria 2939
469 Ga0495601_0077184 3300053077 Bacteria 2133
470 Ga0495612_0004892 3300053078 Bacteria 5542
471 Ga0495595_0031011 3300053084 Bacteria 2401
472 Ga0495619_0008411 3300053085 Bacteria 6527
473 Ga0495619_0126023 3300053085 Bacteria 1757
474 Ga0500644_0061368 3300053088 Bacteria 1325
475 Ga0500646_0005271 3300053090 Bacteria 3268
476 Ga0500572_000152 3300053111 Bacteria 24027
477 Ga0500594_0008657 3300053118 Bacteria 2324
478 Ga0500642_0033511 3300053130 Bacteria 2165
479 Ga0500559_0000014 3300053136 Bacteria 160139
480 Ga0500559_0000230 3300053136 Bacteria 44504
481 Ga0500568_0014695 3300053139 Bacteria 3526
482 Ga0500604_0004171 3300053151 Bacteria 3850
483 Ga0500604_0038454 3300053151 Bacteria 1436
484 Ga0500622_0003526 3300053156 Bacteria 10376
485 Ga0500638_050066 3300053162 Bacteria 2020
486 Ga0500639_003558 3300053163 Bacteria 7864
487 Ga0500636_0115925 3300053177 Bacteria 1508
488 Ga0500645_036029 3300053730 Bacteria 1473
489 Ga0500596_000338 3300053735 Bacteria 8437
490 Ga0500587_002460 3300053739 Bacteria 2634
491 Ga0501084_0000907 3300054114 Bacteria 22887
492 Ga0501084_0030642 3300054114 Bacteria 4498
493 Ga0501082_0001755 3300060353 Bacteria 19084
494 Ga0501082_0124335 3300060353 Bacteria 2237
495 Ga0530510_0017852 3300061734 Bacteria 5029

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0359414 Ga0373935_0359414_52_999 303
2 3300050514 nmdc:mga08x19_339849_c1 nmdc:mga08x19_339849_c1_60_1013 303
3 3300046514 Ga0495618_0255463 Ga0495618_0255463_18_968 311
4 3300046616 Ga0495668_0112399 Ga0495668_0112399_16_999 316
5 3300050509 nmdc:mga0qj67_329804_c1 nmdc:mga0qj67_329804_c1_211_1209 318
6 3300046681 Ga0495647_0118146 Ga0495647_0118146_26_1021 325
7 3300049587 Ga0501071_0002972 Ga0501071_0002972_5080_6111 336
8 3300049588 Ga0501072_0028452 Ga0501072_0028452_2464_3495 336
9 3300049591 Ga0501075_0100872 Ga0501075_0100872_532_1563 336
10 3300054114 Ga0501084_0030642 Ga0501084_0030642_2829_3860 336
11 3300025898 Ga0207692_10074710 Ga0207692_100747102 337
12 3300025906 Ga0207699_10025430 Ga0207699_100254303 337
13 3300048918 Ga0496115_0186537 Ga0496115_0186537_344_1387 337
14 3300005444 Ga0070694_100020570 Ga0070694_1000205705 341
15 3300005545 Ga0070695_100051908 Ga0070695_1000519082 341
16 3300005549 Ga0070704_100033403 Ga0070704_1000334033 341
17 3300025899 Ga0207642_10017333 Ga0207642_100173332 348
18 3300050515 nmdc:mga0a205_185465_c1 nmdc:mga0a205_185465_c1_676_1770 348
19 3300053077 Ga0495601_0077184 Ga0495601_0077184_1019_2083 349
20 3300048917 Ga0496114_0027502 Ga0496114_0027502_413_1669 350
21 3300039437 Ga0436365_1598157 Ga0436365_1598157_368_1534 352
22 3300039447 Ga0436361_0930897 Ga0436361_0930897_75_1184 352
23 3300048924 Ga0496121_0038053 Ga0496121_0038053_265_1434 353
24 3300046533 Ga0495640_0138882 Ga0495640_0138882_453_1532 354
25 3300005841 Ga0068863_100167799 Ga0068863_1001677993 356
26 3300005841 Ga0068863_100390603 Ga0068863_1003906032 356
27 3300013306 Ga0163162_10015589 Ga0163162_100155892 356
28 3300035692 Ga0373935_0166581 Ga0373935_0166581_33_1118 356
29 3300035724 Ga0373933_0147125 Ga0373933_0147125_128_1213 356
30 3300036401 Ga0373937_0198363 Ga0373937_0198363_433_1518 356
31 3300037068 Ga0373925_0017714 Ga0373925_0017714_2439_3524 356
32 3300046511 Ga0495608_0154560 Ga0495608_0154560_362_1447 356
33 3300047322 Ga0495680_0108992 Ga0495680_0108992_412_1497 356
34 3300050510 nmdc:mga06r32_50201_c1 nmdc:mga06r32_50201_c1_60_1178 356
35 3300005617 Ga0068859_100133541 Ga0068859_1001335412 357
36 3300006931 Ga0097620_100133536 Ga0097620_1001335362 357
37 3300039447 Ga0436361_0935188 Ga0436361_0935188_2916_4082 357
38 3300006881 Ga0068865_100163761 Ga0068865_1001637612 359
39 3300033180 Ga0307510_10038105 Ga0307510_100381054 359
40 3300039062 Ga0400483_090459 Ga0400483_090459_1468_2727 359
41 3300039062 Ga0400483_176188 Ga0400483_176188_8122_9381 359
42 3300042001 Ga0439441_000035 Ga0439441_000035_6006_7109 359
43 3300049589 Ga0501073_0051600 Ga0501073_0051600_940_2142 359
44 3300049742 Ga0501080_0002713 Ga0501080_0002713_10269_11471 359
45 3300060353 Ga0501082_0124335 Ga0501082_0124335_419_1621 359
46 3300005441 Ga0070700_100070856 Ga0070700_1000708561 360
47 3300005444 Ga0070694_100260925 Ga0070694_1002609251 360
48 3300005549 Ga0070704_100239765 Ga0070704_1002397651 360
49 3300006844 Ga0075428_100016657 Ga0075428_1000166574 360
50 3300006880 Ga0075429_100000151 Ga0075429_10000015113 360
51 3300009147 Ga0114129_10007243 Ga0114129_1000724312 360
52 3300026075 Ga0207708_10118214 Ga0207708_101182142 360
53 3300027907 Ga0207428_10032808 Ga0207428_100328084 360
54 3300041413 Ga0439465_0029248 Ga0439465_0029248_471_1574 360
55 3300046512 Ga0495610_0030843 Ga0495610_0030843_650_1792 360
56 3300047472 Ga0495686_0113816 Ga0495686_0113816_429_1571 360
57 3300049571 Ga0501034_0000730 Ga0501034_0000730_6708_7868 360
58 3300049588 Ga0501072_0006277 Ga0501072_0006277_3528_4688 360
59 3300050489 nmdc:mga03683_2234_c1 nmdc:mga03683_2234_c1_4724_5839 360
60 3300050494 nmdc:mga06z11_55144_c1 nmdc:mga06z11_55144_c1_214_1329 360
61 3300050496 nmdc:mga07m45_12489_c1 nmdc:mga07m45_12489_c1_77_1192 360
62 3300050507 nmdc:mga05p37_586347_c1 nmdc:mga05p37_586347_c1_48_1157 360
63 3300050507 nmdc:mga05p37_840_c1 nmdc:mga05p37_840_c1_3847_4956 360
64 3300050508 nmdc:mga09592_5_c1 nmdc:mga09592_5_c1_33117_34226 360
65 3300050510 nmdc:mga06r32_9313_c1 nmdc:mga06r32_9313_c1_4831_5940 360
66 3300050516 nmdc:mga0sz30_210_c1 nmdc:mga0sz30_210_c1_12701_13816 360
67 3300053088 Ga0500644_0061368 Ga0500644_0061368_162_1304 360
68 3300053118 Ga0500594_0008657 Ga0500594_0008657_334_1476 360
69 3300053136 Ga0500559_0000014 Ga0500559_0000014_123853_124995 360
70 3300053156 Ga0500622_0003526 Ga0500622_0003526_2502_3644 360
71 3300053177 Ga0500636_0115925 Ga0500636_0115925_141_1283 360
72 3300053739 Ga0500587_002460 Ga0500587_002460_988_2130 360
73 3300041413 Ga0439465_0028803 Ga0439465_0028803_483_1610 361
74 3300009098 Ga0105245_10150395 Ga0105245_101503952 362
75 3300009176 Ga0105242_10001815 Ga0105242_100018155 362
76 3300025929 Ga0207664_10317095 Ga0207664_103170951 362
77 3300025934 Ga0207686_10002624 Ga0207686_100026245 362
78 3300026116 Ga0207674_10194140 Ga0207674_101941402 362
79 3300035691 Ga0373931_0099728 Ga0373931_0099728_150_1259 362
80 3300036401 Ga0373937_0044524 Ga0373937_0044524_1789_2913 362
81 3300048917 Ga0496114_0256291 Ga0496114_0256291_26_1165 362
82 3300025922 Ga0207646_10038818 Ga0207646_100388183 363
83 3300037853 Ga0436364_1128085 Ga0436364_1128085_106_1245 363
84 3300049574 Ga0501038_0103602 Ga0501038_0103602_49_1227 363
85 3300006177 Ga0075362_10061775 Ga0075362_100617752 364
86 3300009551 Ga0105238_10132272 Ga0105238_101322722 364
87 3300021388 Ga0213875_10000142 Ga0213875_1000014221 364
88 3300028786 Ga0307517_10001421 Ga0307517_1000142127 364
89 3300030522 Ga0307512_10070975 Ga0307512_100709752 364
90 3300036401 Ga0373937_0174427 Ga0373937_0174427_30_1160 364
91 3300037853 Ga0436364_0766585 Ga0436364_0766585_4400_5539 364
92 3300037853 Ga0436364_1127111 Ga0436364_1127111_3418_4533 364
93 3300050489 nmdc:mga03683_28456_c1 nmdc:mga03683_28456_c1_964_2079 364
94 3300044673 Ga0453683_0176282 Ga0453683_0176282_91_1230 365
95 3300046454 Ga0495592_0000142 Ga0495592_0000142_56717_57859 365
96 3300046680 Ga0495646_0099587 Ga0495646_0099587_105_1247 365
97 iso_pu_bacteria 2874604998 2874610184 365
98 iso_pu_bacteria 2883577096 2883580266 365
99 iso_pu_bacteria 2922361189 2922366779 365
100 3300005439 Ga0070711_100179781 Ga0070711_1001797811 366
101 3300005445 Ga0070708_100021532 Ga0070708_1000215326 366
102 3300005518 Ga0070699_100021812 Ga0070699_1000218126 366
103 3300006163 Ga0070715_10007955 Ga0070715_100079552 366
104 3300021388 Ga0213875_10008093 Ga0213875_100080932 366
105 3300025905 Ga0207685_10015454 Ga0207685_100154542 366
106 3300031507 Ga0307509_10000577 Ga0307509_1000057746 366
107 3300033180 Ga0307510_10029719 Ga0307510_100297196 366
108 3300037853 Ga0436364_1271676 Ga0436364_1271676_4665_5792 366
109 iso_pu_bacteria 2643221651 2644291694 366
110 3300005435 Ga0070714_100148537 Ga0070714_1001485373 367
111 3300005458 Ga0070681_10052162 Ga0070681_100521625 367
112 3300005471 Ga0070698_100003223 Ga0070698_10000322313 367
113 3300005985 Ga0081539_10006413 Ga0081539_100064132 367
114 3300006038 Ga0075365_10059380 Ga0075365_100593802 367
115 3300006042 Ga0075368_10027596 Ga0075368_100275962 367
116 3300006048 Ga0075363_100041743 Ga0075363_1000417432 367
117 3300006051 Ga0075364_10079093 Ga0075364_100790932 367
118 3300006177 Ga0075362_10005399 Ga0075362_100053997 367
119 3300006177 Ga0075362_10015806 Ga0075362_100158063 367
120 3300006177 Ga0075362_10037140 Ga0075362_100371401 367
121 3300006178 Ga0075367_10027695 Ga0075367_100276954 367
122 3300006186 Ga0075369_10000203 Ga0075369_1000020314 367
123 3300006186 Ga0075369_10041196 Ga0075369_100411962 367
124 3300006844 Ga0075428_100111069 Ga0075428_1001110692 367
125 3300025912 Ga0207707_10153199 Ga0207707_101531992 367
126 3300025929 Ga0207664_10128778 Ga0207664_101287783 367
127 3300030521 Ga0307511_10000851 Ga0307511_1000085124 367
128 3300031456 Ga0307513_10167661 Ga0307513_101676611 367
129 3300036401 Ga0373937_0043537 Ga0373937_0043537_1517_2644 367
130 3300037068 Ga0373925_0061328 Ga0373925_0061328_1035_2186 367
131 3300037312 Ga0395899_0180156 Ga0395899_0180156_202_1326 367
132 3300039437 Ga0436365_0776181 Ga0436365_0776181_1182_2333 367
133 3300044694 Ga0466963_0275811 Ga0466963_0275811_15_1139 367
134 3300046460 Ga0495638_0126601 Ga0495638_0126601_115_1263 367
135 3300049571 Ga0501034_0034649 Ga0501034_0034649_2590_3729 367
136 3300050491 nmdc:mga00v17_109559_c1 nmdc:mga00v17_109559_c1_304_1452 367
137 3300050492 nmdc:mga0yw44_23017_c1 nmdc:mga0yw44_23017_c1_1550_2698 367
138 3300050493 nmdc:mga0k408_134050_c1 nmdc:mga0k408_134050_c1_37_1161 367
139 3300053090 Ga0500646_0005271 Ga0500646_0005271_1344_2489 367
140 3300053130 Ga0500642_0033511 Ga0500642_0033511_437_1582 367
141 3300053139 Ga0500568_0014695 Ga0500568_0014695_1418_2563 367
142 3300053151 Ga0500604_0004171 Ga0500604_0004171_2303_3448 367
143 3300053151 Ga0500604_0038454 Ga0500604_0038454_227_1375 367
144 3300053730 Ga0500645_036029 Ga0500645_036029_61_1206 367
145 3300005340 Ga0070689_100184107 Ga0070689_1001841072 368
146 3300005434 Ga0070709_10034439 Ga0070709_100344392 368
147 3300005435 Ga0070714_100064531 Ga0070714_1000645312 368
148 3300005436 Ga0070713_100002801 Ga0070713_1000028019 368
149 3300005467 Ga0070706_100295150 Ga0070706_1002951502 368
150 3300005471 Ga0070698_100022570 Ga0070698_1000225705 368
151 3300005518 Ga0070699_100158141 Ga0070699_1001581411 368
152 3300005536 Ga0070697_100015876 Ga0070697_1000158766 368
153 3300005937 Ga0081455_10046474 Ga0081455_100464742 368
154 3300006175 Ga0070712_100011749 Ga0070712_1000117495 368
155 3300006353 Ga0075370_10053310 Ga0075370_100533102 368
156 3300006353 Ga0075370_10124178 Ga0075370_101241781 368
157 3300009176 Ga0105242_10048360 Ga0105242_100483601 368
158 3300009177 Ga0105248_10192203 Ga0105248_101922033 368
159 3300021388 Ga0213875_10025079 Ga0213875_100250792 368
160 3300028573 Ga0265334_10004817 Ga0265334_100048175 368
161 3300028800 Ga0265338_10079084 Ga0265338_100790842 368
162 3300035118 Ga0373954_0023472 Ga0373954_0023472_1072_2211 368
163 3300035171 Ga0373946_0110645 Ga0373946_0110645_83_1222 368
164 3300035692 Ga0373935_0057807 Ga0373935_0057807_1224_2363 368
165 3300035695 Ga0373927_0157624 Ga0373927_0157624_178_1317 368
166 3300036401 Ga0373937_0000638 Ga0373937_0000638_7188_8327 368
167 3300036401 Ga0373937_0011341 Ga0373937_0011341_4336_5475 368
168 3300037068 Ga0373925_0050850 Ga0373925_0050850_1559_2698 368
169 3300037853 Ga0436364_0018110 Ga0436364_0018110_585_1724 368
170 3300039437 Ga0436365_1850857 Ga0436365_1850857_493_1632 368
171 3300045049 Ga0466959_0042292 Ga0466959_0042292_1162_2319 368
172 3300046454 Ga0495592_0041123 Ga0495592_0041123_89_1228 368
173 3300046477 Ga0495664_0023853 Ga0495664_0023853_1521_2660 368
174 3300046511 Ga0495608_0000890 Ga0495608_0000890_1782_2921 368
175 3300046511 Ga0495608_0007116 Ga0495608_0007116_4203_5342 368
176 3300046516 Ga0495628_0040199 Ga0495628_0040199_559_1698 368
177 3300046536 Ga0495587_0002800 Ga0495587_0002800_1956_3095 368
178 3300046543 Ga0495645_0043278 Ga0495645_0043278_696_1835 368
179 3300046559 Ga0495667_0003101 Ga0495667_0003101_2573_3712 368
180 3300046679 Ga0495623_0133341 Ga0495623_0133341_333_1472 368
181 3300046680 Ga0495646_0010269 Ga0495646_0010269_4632_5771 368
182 3300046809 Ga0495600_0011797 Ga0495600_0011797_142_1281 368
183 3300047317 Ga0495604_0008196 Ga0495604_0008196_4841_5980 368
184 3300047322 Ga0495680_0020559 Ga0495680_0020559_467_1606 368
185 3300047322 Ga0495680_0064403 Ga0495680_0064403_70_1209 368
186 3300047444 Ga0495675_0001936 Ga0495675_0001936_8946_10085 368
187 3300048088 Ga0495602_0000557 Ga0495602_0000557_29210_30349 368
188 3300048929 Ga0496126_0115554 Ga0496126_0115554_806_1945 368
189 3300049571 Ga0501034_0001037 Ga0501034_0001037_14147_15277 368
190 3300049578 Ga0501042_0003628 Ga0501042_0003628_2088_3275 368
191 3300049582 Ga0501048_0008044 Ga0501048_0008044_2617_3804 368
192 3300049584 Ga0501068_0068705 Ga0501068_0068705_219_1406 368
193 3300049587 Ga0501071_0003547 Ga0501071_0003547_3398_4585 368
194 3300049591 Ga0501075_0003556 Ga0501075_0003556_530_1717 368
195 3300049592 Ga0501076_0000337 Ga0501076_0000337_7229_8416 368
196 3300049824 Ga0501045_0000120 Ga0501045_0000120_2088_3275 368
197 3300050492 nmdc:mga0yw44_180123_c1 nmdc:mga0yw44_180123_c1_37_1173 368
198 3300050493 nmdc:mga0k408_13218_c1 nmdc:mga0k408_13218_c1_562_1728 368
199 3300053077 Ga0495601_0001180 Ga0495601_0001180_8839_9978 368
200 3300053078 Ga0495612_0004892 Ga0495612_0004892_4244_5383 368
201 3300053084 Ga0495595_0031011 Ga0495595_0031011_440_1579 368
202 3300053085 Ga0495619_0008411 Ga0495619_0008411_4851_5990 368
203 3300054114 Ga0501084_0000907 Ga0501084_0000907_14457_15644 368
204 3300060353 Ga0501082_0001755 Ga0501082_0001755_14617_15804 368
205 3300061734 Ga0530510_0017852 Ga0530510_0017852_3468_4655 368
206 iso_pu_bacteria 2929199973 2929205239 368
207 iso_pu_bacteria 8055909800 8055913418 368
208 3300003911 JGI25405J52794_10007987 JGI25405J52794_100079872 369
209 3300005295 Ga0065707_10003366 Ga0065707_100033664 369
210 3300005334 Ga0068869_100177068 Ga0068869_1001770682 369
211 3300005341 Ga0070691_10031683 Ga0070691_100316831 369
212 3300005345 Ga0070692_10003405 Ga0070692_100034054 369
213 3300005353 Ga0070669_100014354 Ga0070669_1000143544 369
214 3300005436 Ga0070713_100169604 Ga0070713_1001696042 369
215 3300005441 Ga0070700_100008396 Ga0070700_1000083964 369
216 3300005456 Ga0070678_100031048 Ga0070678_1000310483 369
217 3300005458 Ga0070681_10020967 Ga0070681_100209674 369
218 3300005459 Ga0068867_100007205 Ga0068867_1000072052 369
219 3300005539 Ga0068853_100038928 Ga0068853_1000389283 369
220 3300005543 Ga0070672_100008668 Ga0070672_1000086684 369
221 3300005546 Ga0070696_100169321 Ga0070696_1001693211 369
222 3300005549 Ga0070704_100238825 Ga0070704_1002388252 369
223 3300005577 Ga0068857_100014788 Ga0068857_1000147885 369
224 3300005616 Ga0068852_100283758 Ga0068852_1002837582 369
225 3300005718 Ga0068866_10185289 Ga0068866_101852891 369
226 3300005719 Ga0068861_100001889 Ga0068861_1000018893 369
227 3300005842 Ga0068858_100059318 Ga0068858_1000593183 369
228 3300005843 Ga0068860_100001386 Ga0068860_10000138615 369
229 3300005844 Ga0068862_100022960 Ga0068862_1000229602 369
230 3300005937 Ga0081455_10000451 Ga0081455_1000045116 369
231 3300005983 Ga0081540_1012873 Ga0081540_10128732 369
232 3300006051 Ga0075364_10033775 Ga0075364_100337751 369
233 3300006173 Ga0070716_100153519 Ga0070716_1001535192 369
234 3300006237 Ga0097621_100153503 Ga0097621_1001535033 369
235 3300006846 Ga0075430_100157470 Ga0075430_1001574702 369
236 3300006847 Ga0075431_100039880 Ga0075431_1000398804 369
237 3300006852 Ga0075433_10240602 Ga0075433_102406022 369
238 3300006871 Ga0075434_100378848 Ga0075434_1003788482 369
239 3300006881 Ga0068865_100004561 Ga0068865_1000045612 369
240 3300009093 Ga0105240_10140606 Ga0105240_101406062 369
241 3300009094 Ga0111539_10321175 Ga0111539_103211752 369
242 3300009148 Ga0105243_10103162 Ga0105243_101031621 369
243 3300009545 Ga0105237_10115208 Ga0105237_101152081 369
244 3300009553 Ga0105249_10011488 Ga0105249_100114884 369
245 3300009553 Ga0105249_10254007 Ga0105249_102540072 369
246 3300011119 Ga0105246_10018942 Ga0105246_100189422 369
247 3300013297 Ga0157378_10010502 Ga0157378_100105026 369
248 3300013306 Ga0163162_10037972 Ga0163162_100379723 369
249 3300013308 Ga0157375_10058170 Ga0157375_100581702 369
250 3300014326 Ga0157380_10010371 Ga0157380_100103716 369
251 3300014745 Ga0157377_10006406 Ga0157377_100064064 369
252 3300014968 Ga0157379_10059456 Ga0157379_100594563 369
253 3300021388 Ga0213875_10090362 Ga0213875_100903622 369
254 3300021441 Ga0213871_10004269 Ga0213871_100042693 369
255 3300021441 Ga0213871_10025622 Ga0213871_100256221 369
256 3300025901 Ga0207688_10106974 Ga0207688_101069741 369
257 3300025906 Ga0207699_10176891 Ga0207699_101768911 369
258 3300025912 Ga0207707_10039135 Ga0207707_100391353 369
259 3300025914 Ga0207671_10013702 Ga0207671_100137022 369
260 3300025915 Ga0207693_10051739 Ga0207693_100517393 369
261 3300025918 Ga0207662_10011885 Ga0207662_100118853 369
262 3300025919 Ga0207657_10288496 Ga0207657_102884961 369
263 3300025923 Ga0207681_10008173 Ga0207681_100081733 369
264 3300025924 Ga0207694_10166316 Ga0207694_101663162 369
265 3300025928 Ga0207700_10255619 Ga0207700_102556192 369
266 3300025929 Ga0207664_10162079 Ga0207664_101620792 369
267 3300025939 Ga0207665_10216522 Ga0207665_102165222 369
268 3300025942 Ga0207689_10183536 Ga0207689_101835362 369
269 3300025961 Ga0207712_10009102 Ga0207712_100091023 369
270 3300025972 Ga0207668_10159998 Ga0207668_101599982 369
271 3300025986 Ga0207658_10034297 Ga0207658_100342973 369
272 3300026035 Ga0207703_10045431 Ga0207703_100454312 369
273 3300026041 Ga0207639_10003184 Ga0207639_100031843 369
274 3300026075 Ga0207708_10013010 Ga0207708_100130103 369
275 3300026075 Ga0207708_10014041 Ga0207708_100140412 369
276 3300026075 Ga0207708_10015435 Ga0207708_100154354 369
277 3300026089 Ga0207648_10001237 Ga0207648_1000123710 369
278 3300026118 Ga0207675_100001346 Ga0207675_10000134626 369
279 3300026121 Ga0207683_10027278 Ga0207683_100272784 369
280 3300026121 Ga0207683_10087355 Ga0207683_100873553 369
281 3300026121 Ga0207683_10091832 Ga0207683_100918321 369
282 3300027907 Ga0207428_10037743 Ga0207428_100377433 369
283 3300028380 Ga0268265_10005960 Ga0268265_100059605 369
284 3300028381 Ga0268264_10014230 Ga0268264_100142304 369
285 3300035089 Ga0373944_0028237 Ga0373944_0028237_30_1184 369
286 3300035120 Ga0373957_0042354 Ga0373957_0042354_460_1611 369
287 3300035170 Ga0373943_0158283 Ga0373943_0158283_17_1168 369
288 3300035241 Ga0373961_0049954 Ga0373961_0049954_34_1185 369
289 3300035398 Ga0316574_0032652 Ga0316574_0032652_1651_2793 369
290 3300035692 Ga0373935_0112390 Ga0373935_0112390_296_1447 369
291 3300035724 Ga0373933_0023555 Ga0373933_0023555_1757_2908 369
292 3300036401 Ga0373937_0053855 Ga0373937_0053855_2508_3659 369
293 3300039450 Ga0436363_0537438 Ga0436363_0537438_1338_2504 369
294 3300039453 Ga0436362_1222155 Ga0436362_1222155_608_1771 369
295 3300046463 Ga0495653_0145315 Ga0495653_0145315_214_1365 369
296 3300046533 Ga0495640_0021402 Ga0495640_0021402_2717_3862 369
297 3300047320 Ga0495672_0091983 Ga0495672_0091983_29_1192 369
298 3300048903 Ga0496100_0083424 Ga0496100_0083424_502_1662 369
299 3300048904 Ga0496101_0135893 Ga0496101_0135893_212_1363 369
300 3300049570 Ga0501033_0070818 Ga0501033_0070818_975_2132 369
301 3300049572 Ga0501036_0150121 Ga0501036_0150121_275_1414 369
302 3300049584 Ga0501068_0022447 Ga0501068_0022447_2213_3370 369
303 3300049742 Ga0501080_0174359 Ga0501080_0174359_660_1817 369
304 3300049822 Ga0501035_0192439 Ga0501035_0192439_556_1713 369
305 3300049823 Ga0501044_0426645 Ga0501044_0426645_65_1222 369
306 3300050508 nmdc:mga09592_64812_c1 nmdc:mga09592_64812_c1_536_1675 369
307 3300050509 nmdc:mga0qj67_171685_c1 nmdc:mga0qj67_171685_c1_283_1419 369
308 3300050515 nmdc:mga0a205_68422_c1 nmdc:mga0a205_68422_c1_89_1240 369
309 3300050515 nmdc:mga0a205_69727_c1 nmdc:mga0a205_69727_c1_1851_2990 369
310 3300053077 Ga0495601_0039932 Ga0495601_0039932_20_1171 369
311 3300053111 Ga0500572_000152 Ga0500572_000152_456_1625 369
312 3300053136 Ga0500559_0000230 Ga0500559_0000230_7605_8774 369
313 3300053163 Ga0500639_003558 Ga0500639_003558_4716_5885 369
314 3300053735 Ga0500596_000338 Ga0500596_000338_4149_5318 369
315 3300005330 Ga0070690_100003927 Ga0070690_1000039276 370
316 3300005334 Ga0068869_100001195 Ga0068869_1000011955 370
317 3300005336 Ga0070680_100089070 Ga0070680_1000890702 370
318 3300005338 Ga0068868_100011557 Ga0068868_1000115576 370
319 3300005341 Ga0070691_10021482 Ga0070691_100214821 370
320 3300005345 Ga0070692_10012980 Ga0070692_100129803 370
321 3300005434 Ga0070709_10028368 Ga0070709_100283682 370
322 3300005435 Ga0070714_100055371 Ga0070714_1000553713 370
323 3300005436 Ga0070713_100050811 Ga0070713_1000508114 370
324 3300005438 Ga0070701_10014671 Ga0070701_100146712 370
325 3300005441 Ga0070700_100003099 Ga0070700_1000030995 370
326 3300005444 Ga0070694_100036434 Ga0070694_1000364343 370
327 3300005459 Ga0068867_100005100 Ga0068867_1000051004 370
328 3300005544 Ga0070686_100022109 Ga0070686_1000221091 370
329 3300005545 Ga0070695_100013074 Ga0070695_1000130743 370
330 3300005546 Ga0070696_100065169 Ga0070696_1000651691 370
331 3300005547 Ga0070693_100016380 Ga0070693_1000163802 370
332 3300005615 Ga0070702_100001167 Ga0070702_1000011677 370
333 3300005617 Ga0068859_100041778 Ga0068859_1000417783 370
334 3300005718 Ga0068866_10002399 Ga0068866_100023996 370
335 3300005718 Ga0068866_10023305 Ga0068866_100233055 370
336 3300005719 Ga0068861_100062769 Ga0068861_1000627693 370
337 3300005842 Ga0068858_100004481 Ga0068858_10000448110 370
338 3300005843 Ga0068860_100022843 Ga0068860_1000228436 370
339 3300005844 Ga0068862_100006449 Ga0068862_1000064495 370
340 3300006038 Ga0075365_10089653 Ga0075365_100896532 370
341 3300006175 Ga0070712_100007322 Ga0070712_1000073224 370
342 3300006194 Ga0075427_10009740 Ga0075427_100097401 370
343 3300006237 Ga0097621_100002301 Ga0097621_1000023011 370
344 3300006358 Ga0068871_100012897 Ga0068871_1000128972 370
345 3300006881 Ga0068865_100000472 Ga0068865_10000047214 370
346 3300006931 Ga0097620_100041779 Ga0097620_1000417792 370
347 3300009098 Ga0105245_10010186 Ga0105245_100101863 370
348 3300009148 Ga0105243_10006693 Ga0105243_100066933 370
349 3300009176 Ga0105242_10006305 Ga0105242_100063053 370
350 3300009553 Ga0105249_10059545 Ga0105249_100595452 370
351 3300013297 Ga0157378_10019923 Ga0157378_100199232 370
352 3300013308 Ga0157375_10229291 Ga0157375_102292912 370
353 3300014326 Ga0157380_10011956 Ga0157380_100119564 370
354 3300021377 Ga0213874_10018287 Ga0213874_100182871 370
355 3300025899 Ga0207642_10030768 Ga0207642_100307683 370
356 3300025899 Ga0207642_10032089 Ga0207642_100320893 370
357 3300025906 Ga0207699_10050228 Ga0207699_100502282 370
358 3300025908 Ga0207643_10017180 Ga0207643_100171802 370
359 3300025915 Ga0207693_10000731 Ga0207693_100007319 370
360 3300025916 Ga0207663_10016954 Ga0207663_100169544 370
361 3300025917 Ga0207660_10015559 Ga0207660_100155594 370
362 3300025927 Ga0207687_10012803 Ga0207687_100128033 370
363 3300025934 Ga0207686_10007535 Ga0207686_100075355 370
364 3300025935 Ga0207709_10020293 Ga0207709_100202931 370
365 3300025938 Ga0207704_10024120 Ga0207704_100241202 370
366 3300025942 Ga0207689_10000764 Ga0207689_1000076410 370
367 3300025986 Ga0207658_10038501 Ga0207658_100385012 370
368 3300026023 Ga0207677_10112075 Ga0207677_101120751 370
369 3300026035 Ga0207703_10006634 Ga0207703_100066344 370
370 3300026035 Ga0207703_10290056 Ga0207703_102900561 370
371 3300026075 Ga0207708_10000350 Ga0207708_100003507 370
372 3300026089 Ga0207648_10000730 Ga0207648_1000073027 370
373 3300026118 Ga0207675_100000407 Ga0207675_10000040712 370
374 3300028380 Ga0268265_10072200 Ga0268265_100722002 370
375 3300028381 Ga0268264_10123268 Ga0268264_101232682 370
376 3300035695 Ga0373927_0018488 Ga0373927_0018488_876_2150 370
377 3300046615 Ga0495656_0000565 Ga0495656_0000565_6851_8008 370
378 3300046691 Ga0495670_0028413 Ga0495670_0028413_1426_2583 370
379 3300049588 Ga0501072_0011670 Ga0501072_0011670_3316_4491 370
380 3300049741 Ga0501079_0009980 Ga0501079_0009980_3709_4884 370
381 3300005295 Ga0065707_10121253 Ga0065707_101212532 371
382 3300005549 Ga0070704_100020278 Ga0070704_1000202783 371
383 3300005577 Ga0068857_100019680 Ga0068857_1000196804 371
384 3300005617 Ga0068859_100158028 Ga0068859_1001580282 371
385 3300005618 Ga0068864_100128738 Ga0068864_1001287382 371
386 3300005842 Ga0068858_100400559 Ga0068858_1004005591 371
387 3300005843 Ga0068860_100000313 Ga0068860_10000031325 371
388 3300005843 Ga0068860_100209283 Ga0068860_1002092832 371
389 3300005843 Ga0068860_100334697 Ga0068860_1003346972 371
390 3300005844 Ga0068862_100025183 Ga0068862_1000251833 371
391 3300006931 Ga0097620_100158035 Ga0097620_1001580352 371
392 3300007076 Ga0075435_100042169 Ga0075435_1000421691 371
393 3300009147 Ga0114129_10005868 Ga0114129_1000586813 371
394 3300009174 Ga0105241_10013313 Ga0105241_100133131 371
395 3300009174 Ga0105241_10211803 Ga0105241_102118031 371
396 3300009176 Ga0105242_10209935 Ga0105242_102099352 371
397 3300009176 Ga0105242_10241072 Ga0105242_102410722 371
398 3300009553 Ga0105249_10027333 Ga0105249_100273334 371
399 3300013306 Ga0163162_10070977 Ga0163162_100709772 371
400 3300025272 Ga0209455_1001457 Ga0209455_10014579 371
401 3300025911 Ga0207654_10039369 Ga0207654_100393692 371
402 3300025934 Ga0207686_10134370 Ga0207686_101343702 371
403 3300025961 Ga0207712_10009110 Ga0207712_100091102 371
404 3300026116 Ga0207674_10036532 Ga0207674_100365324 371
405 3300028381 Ga0268264_10000356 Ga0268264_1000035643 371
406 3300028381 Ga0268264_10260031 Ga0268264_102600312 371
407 3300031507 Ga0307509_10090777 Ga0307509_100907772 371
408 3300031616 Ga0307508_10046506 Ga0307508_100465064 371
409 3300035170 Ga0373943_0040716 Ga0373943_0040716_893_2050 371
410 3300035695 Ga0373927_0006414 Ga0373927_0006414_442_1611 371
411 3300035724 Ga0373933_0063090 Ga0373933_0063090_405_1589 371
412 3300035725 Ga0373947_0057500 Ga0373947_0057500_121_1278 371
413 3300036401 Ga0373937_0008736 Ga0373937_0008736_5418_6593 371
414 3300037068 Ga0373925_0001876 Ga0373925_0001876_11332_12489 371
415 3300037068 Ga0373925_0079034 Ga0373925_0079034_272_1441 371
416 3300046533 Ga0495640_0029322 Ga0495640_0029322_296_1480 371
417 3300046537 Ga0495598_0024323 Ga0495598_0024323_126_1283 371
418 3300046557 Ga0495622_0023739 Ga0495622_0023739_591_1760 371
419 3300046684 Ga0495669_0028068 Ga0495669_0028068_415_1572 371
420 3300047320 Ga0495672_0007685 Ga0495672_0007685_2843_4042 371
421 3300048925 Ga0496122_0067613 Ga0496122_0067613_673_1932 371
422 3300049576 Ga0501040_0016282 Ga0501040_0016282_378_1559 371
423 3300049744 Ga0501083_0075814 Ga0501083_0075814_855_2036 371
424 3300050511 nmdc:mga08y16_200748_c1 nmdc:mga08y16_200748_c1_509_1666 371
425 3300050512 nmdc:mga0n895_68778_c1 nmdc:mga0n895_68778_c1_37_1197 371
426 3300053077 Ga0495601_0029435 Ga0495601_0029435_1754_2938 371
427 3300053085 Ga0495619_0126023 Ga0495619_0126023_135_1319 371
428 3300053162 Ga0500638_050066 Ga0500638_050066_35_1231 371
429 3300005546 Ga0070696_100202890 Ga0070696_1002028901 372
430 3300005985 Ga0081539_10068231 Ga0081539_100682312 372
431 3300013296 Ga0157374_10102862 Ga0157374_101028624 372
432 3300021388 Ga0213875_10005326 Ga0213875_100053266 372
433 3300037853 Ga0436364_0135272 Ga0436364_0135272_3152_4336 372
434 3300039437 Ga0436365_0085725 Ga0436365_0085725_6601_7773 372
435 3300039437 Ga0436365_0118087 Ga0436365_0118087_5573_6757 372
436 3300039453 Ga0436362_0329416 Ga0436362_0329416_1696_2880 372
437 3300005328 Ga0070676_10026301 Ga0070676_100263011 373
438 3300005333 Ga0070677_10013826 Ga0070677_100138261 373
439 3300005334 Ga0068869_100049375 Ga0068869_1000493751 373
440 3300005335 Ga0070666_10003619 Ga0070666_100036191 373
441 3300005338 Ga0068868_100021668 Ga0068868_1000216685 373
442 3300005353 Ga0070669_100023153 Ga0070669_1000231531 373
443 3300005354 Ga0070675_100016931 Ga0070675_1000169316 373
444 3300005355 Ga0070671_100024353 Ga0070671_1000243531 373
445 3300005364 Ga0070673_100058159 Ga0070673_1000581594 373
446 3300005456 Ga0070678_100174417 Ga0070678_1001744171 373
447 3300005457 Ga0070662_100019056 Ga0070662_1000190562 373
448 3300005459 Ga0068867_100026669 Ga0068867_1000266691 373
449 3300005548 Ga0070665_100281470 Ga0070665_1002814702 373
450 3300005616 Ga0068852_100176150 Ga0068852_1001761502 373
451 3300005618 Ga0068864_100007047 Ga0068864_1000070472 373
452 3300005841 Ga0068863_100238704 Ga0068863_1002387042 373
453 3300005842 Ga0068858_100009495 Ga0068858_1000094952 373
454 3300006237 Ga0097621_100013606 Ga0097621_1000136064 373
455 3300006358 Ga0068871_100072402 Ga0068871_1000724024 373
456 3300009177 Ga0105248_10125514 Ga0105248_101255144 373
457 3300013296 Ga0157374_10009574 Ga0157374_100095741 373
458 3300013297 Ga0157378_10027251 Ga0157378_100272512 373
459 3300013306 Ga0163162_10023144 Ga0163162_100231447 373
460 3300013308 Ga0157375_10008755 Ga0157375_100087551 373
461 3300014325 Ga0163163_10096046 Ga0163163_100960461 373
462 3300014968 Ga0157379_10006093 Ga0157379_100060938 373
463 3300014969 Ga0157376_10050960 Ga0157376_100509601 373
464 3300017792 Ga0163161_10016276 Ga0163161_100162765 373
465 3300025903 Ga0207680_10002188 Ga0207680_100021886 373
466 3300025923 Ga0207681_10017575 Ga0207681_100175755 373
467 3300025925 Ga0207650_10164278 Ga0207650_101642782 373
468 3300025926 Ga0207659_10015574 Ga0207659_100155745 373
469 3300025933 Ga0207706_10077963 Ga0207706_100779633 373
470 3300025940 Ga0207691_10028481 Ga0207691_100284811 373
471 3300025941 Ga0207711_10073488 Ga0207711_100734884 373
472 3300025942 Ga0207689_10018757 Ga0207689_100187573 373
473 3300025960 Ga0207651_10006357 Ga0207651_100063572 373
474 3300025961 Ga0207712_10070376 Ga0207712_100703763 373
475 3300026023 Ga0207677_10002924 Ga0207677_100029249 373
476 3300026035 Ga0207703_10017073 Ga0207703_100170736 373
477 3300026088 Ga0207641_10012029 Ga0207641_100120292 373
478 3300026089 Ga0207648_10039687 Ga0207648_100396875 373
479 3300026095 Ga0207676_10001503 Ga0207676_100015035 373
480 3300026121 Ga0207683_10046223 Ga0207683_100462231 373
481 3300031456 Ga0307513_10066845 Ga0307513_100668453 373
482 3300031616 Ga0307508_10015555 Ga0307508_100155553 373
483 3300031730 Ga0307516_10139534 Ga0307516_101395341 373
484 3300005435 Ga0070714_100250738 Ga0070714_1002507381 374
485 3300005436 Ga0070713_100056034 Ga0070713_1000560342 374
486 3300005614 Ga0068856_100089186 Ga0068856_1000891862 374
487 3300007788 Ga0099795_10066988 Ga0099795_100669881 374
488 3300025922 Ga0207646_10005709 Ga0207646_100057096 374
489 3300025928 Ga0207700_10006286 Ga0207700_100062864 374
490 3300025928 Ga0207700_10068288 Ga0207700_100682882 374
491 3300025929 Ga0207664_10023830 Ga0207664_100238305 374
492 3300026078 Ga0207702_10029793 Ga0207702_100297933 374
493 3300026078 Ga0207702_10053924 Ga0207702_100539242 374
494 3300035112 Ga0373932_0021898 Ga0373932_0021898_31_1182 374
495 3300037471 Ga0395905_0086452 Ga0395905_0086452_1389_2552 374
496 3300039453 Ga0436362_1127920 Ga0436362_1127920_713_1870 374
497 3300048913 Ga0496110_0400695 Ga0496110_0400695_19_1170 374
498 3300048915 Ga0496112_0011155 Ga0496112_0011155_2687_3838 374
499 3300048915 Ga0496112_0195578 Ga0496112_0195578_739_1890 374
500 3300003203 JGI25406J46586_10000058 JGI25406J46586_1000005827 375
501 3300005985 Ga0081539_10000825 Ga0081539_1000082529 375

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

103

279

0.8

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

107

434

0.72

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

109

440

0.52

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xmd-assembly2.cif.gz_D-3 crystal structure of epoxide hydrolase vreh1 from vigna radiata 0.8817 13 372
6unw-assembly1.cif.gz_A epoxide hydrolase from an endophytic streptomyces 0.8772 12 370
8hm5-assembly1.cif.gz_A epoxide hydrolase from caballeronia sordidicola pamc 26510 0.8765 14 371
8b6p-assembly2.cif.gz_B x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8758 15 144
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8756 16 144
ID Description Score Start End Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.93 12 111 3.40.50.12270
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9111 12 111 3.40.50.12270
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9062 16 138 3.40.50.1820
af_B6SUW2_10_323_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8938 15 372 3.40.50.1820
af_B6SUW2_10_323_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.883 15 372 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V8KN06-F1-model_v4 Alpha/beta hydrolase 0.9935 168 372 GO:0016787
AF-A0A4Q4CVM9-F1-model_v4 Alpha/beta fold hydrolase 0.9882 2 370 GO:0016787
AF-H0SEL6-F1-model_v4 Putative epoxide hydrolase (EC 2.7.10.2, EC 3.3.2.9) 0.9877 29 371 GO:0004715
GO:0033961
AF-A0A349SFC6-F1-model_v4 Alpha/beta hydrolase 0.9857 176 270 GO:0016787
AF-A0A2E1TXS4-F1-model_v4 Alpha/beta hydrolase 0.9836 3 372 GO:0016787

Feature Viewer

pLDDT pTM Quality
95.22 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map