F455547

General Info

Members Datasets Scaffolds Average Seq Length
500 210 1000 284

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_10010733|Ga0207681_100107333
Length 320
Sequence MAGRSAASTTPALPVLQLLKSYSDLEELIMFMKQTKVWLILTIALSLLALASACSKAPEGNENATPSAATGKTPPTDGGTVSGTIAFNGAAPAPKKIDTSADPVCGQKNPNLSTEDNVVTNGKLANVFVYIKDGAASDGTKIDGYAWPAATAAVTLDQNGCHYRPHVLGVMVNQDIEIKNSDPTQHNIHFTPKSNPDWNQSQPNGAPPLMHKLKQSEVLVPVKCNQHPWMKSYIGVLKHPLFAVSAEDGTFTIKGVPPGTYTVAAWHEGGATGTEKTMQVTVAASGTAKADFAFGEAATASGNPGLKMMPAIEFPMLGRH

Samples

Sample ID Description Type Environment
1 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
176 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
177 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
178 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
182 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
183 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
184 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
185 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
186 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
187 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
188 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
189 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
190 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
191 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
192 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
193 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
196 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.8
Metatranscriptomes 2.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.2
Rhizosphere 98.6
Stem 0
Stem Tuber 0
Unclassified 28.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207681_10010733 3300025923 Bacteria 5621
2 MBSR1b_contig_13230442 2162886012 Unclassified 1455
3 MBSR1b_contig_5585598 2162886012 Unclassified 1451
4 JGI24751J29686_10000042 3300002459 Bacteria 78338
5 JGI24751J29686_10000072 3300002459 Bacteria 57601
6 JGI25406J46586_10003950 3300003203 Bacteria 6935
7 Ga0058861_10601031 3300004800 Unclassified 1071
8 Ga0058862_10696024 3300004803 Unclassified 1039
9 Ga0065714_10002183 3300005288 Bacteria 378167
10 Ga0065712_10000030 3300005290 Bacteria 237869
11 Ga0065712_10027130 3300005290 Unclassified 1177
12 Ga0065712_10032655 3300005290 Bacteria 1953
13 Ga0065712_10163135 3300005290 Bacteria 1289
14 Ga0065715_10090591 3300005293 Bacteria 6693
15 Ga0065715_10093031 3300005293 Bacteria 4834
16 Ga0065715_10122716 3300005293 Bacteria 2197
17 Ga0065715_10141244 3300005293 Unclassified 1851
18 Ga0065715_10281115 3300005293 Bacteria 1058
19 Ga0065707_10004418 3300005295 Bacteria 6113
20 Ga0065707_10098245 3300005295 Bacteria 3100
21 Ga0065707_10101375 3300005295 Bacteria 2858
22 Ga0065707_10140069 3300005295 Bacteria 1785
23 Ga0070676_10025103 3300005328 Bacteria 3366
24 Ga0070676_10214528 3300005328 Unclassified 1268
25 Ga0070690_100007607 3300005330 Bacteria 6206
26 Ga0070690_100062142 3300005330 Bacteria 2408
27 Ga0070670_100000378 3300005331 Bacteria 37152
28 Ga0070670_100070237 3300005331 Unclassified 3006
29 Ga0070670_100098389 3300005331 Bacteria 2517
30 Ga0070670_100102790 3300005331 Unclassified 2461
31 Ga0070670_100135072 3300005331 Bacteria 2131
32 Ga0070670_100147960 3300005331 Bacteria 2032
33 Ga0070670_100230599 3300005331 Bacteria 1611
34 Ga0068869_100167206 3300005334 Bacteria 1716
35 Ga0070680_100039502 3300005336 Bacteria 3819
36 Ga0070680_100117339 3300005336 Unclassified 2219
37 Ga0070680_100187257 3300005336 Bacteria 1744
38 Ga0070682_100000229 3300005337 Bacteria 40502
39 Ga0068868_100151597 3300005338 Bacteria 1909
40 Ga0068868_100192731 3300005338 Unclassified 1695
41 Ga0070689_100000230 3300005340 Bacteria 33566
42 Ga0070689_100181028 3300005340 Unclassified 1712
43 Ga0070687_100061732 3300005343 Unclassified 1981
44 Ga0070661_100069591 3300005344 Unclassified 2588
45 Ga0070692_10034123 3300005345 Bacteria 2567
46 Ga0070692_10037316 3300005345 Bacteria 2470
47 Ga0070669_100027301 3300005353 Unclassified 4108
48 Ga0070669_100042195 3300005353 Bacteria 3319
49 Ga0070669_100050624 3300005353 Unclassified 3035
50 Ga0070669_100095421 3300005353 Unclassified 2236
51 Ga0070669_100200644 3300005353 Unclassified 1569
52 Ga0070675_100280695 3300005354 Bacteria 1463
53 Ga0070675_100401056 3300005354 Viruses 1223
54 Ga0070671_100022346 3300005355 Bacteria 5165
55 Ga0070671_100094581 3300005355 Bacteria 2505
56 Ga0070671_100233867 3300005355 Unclassified 1560
57 Ga0070674_100140330 3300005356 Bacteria 1813
58 Ga0070673_100033645 3300005364 Bacteria 3873
59 Ga0070688_100250560 3300005365 Unclassified 1261
60 Ga0070659_100002188 3300005366 Bacteria 13915
61 Ga0070709_10190774 3300005434 Bacteria 1445
62 Ga0070701_10009268 3300005438 Bacteria 4305
63 Ga0070701_10045073 3300005438 Bacteria 2261
64 Ga0070705_100034745 3300005440 Bacteria 2821
65 Ga0070705_100056831 3300005440 Bacteria 2306
66 Ga0070705_100339882 3300005440 Bacteria 1091
67 Ga0070705_100386319 3300005440 Unclassified 1032
68 Ga0070700_100000223 3300005441 Bacteria 31575
69 Ga0070700_100003166 3300005441 Bacteria 8456
70 Ga0070700_100031710 3300005441 Bacteria 3169
71 Ga0070700_100056102 3300005441 Unclassified 2468
72 Ga0070700_100121675 3300005441 Bacteria 1750
73 Ga0070694_100039127 3300005444 Bacteria 3155
74 Ga0070694_100084205 3300005444 Bacteria 2218
75 Ga0070694_100110492 3300005444 Unclassified 1958
76 Ga0070694_100195248 3300005444 Bacteria 1506
77 Ga0070708_100007334 3300005445 Bacteria 8821
78 Ga0070708_100259362 3300005445 Bacteria 1634
79 Ga0070662_100057246 3300005457 Bacteria 2832
80 Ga0070681_10000254 3300005458 Bacteria 42307
81 Ga0070681_10001421 3300005458 Bacteria 21057
82 Ga0070681_10009428 3300005458 Bacteria 9607
83 Ga0070681_10029276 3300005458 Bacteria 5530
84 Ga0068867_100079556 3300005459 Unclassified 2467
85 Ga0070685_10036917 3300005466 Unclassified 2764
86 Ga0070706_100000002 3300005467 Bacteria 326510
87 Ga0070706_100005583 3300005467 Bacteria 11964
88 Ga0070706_100069340 3300005467 Unclassified 3261
89 Ga0070706_100078447 3300005467 Unclassified 3058
90 Ga0070706_100135199 3300005467 Unclassified 2301
91 Ga0070707_100224231 3300005468 Bacteria 1830
92 Ga0070707_100281054 3300005468 Bacteria 1617
93 Ga0070698_100002576 3300005471 Bacteria 19968
94 Ga0070698_100025735 3300005471 Bacteria 6130
95 Ga0070698_100744740 3300005471 Unclassified 923
96 Ga0070699_100000464 3300005518 Bacteria 38764
97 Ga0070699_100006252 3300005518 Bacteria 10388
98 Ga0070699_100012447 3300005518 Bacteria 7340
99 Ga0070699_100573395 3300005518 Unclassified 1028
100 Ga0070679_100000029 3300005530 Bacteria 108401
101 Ga0070679_100001933 3300005530 Bacteria 18613
102 Ga0070679_100202586 3300005530 Unclassified 1950
103 Ga0070684_100093872 3300005535 Unclassified 2672
104 Ga0070697_100000046 3300005536 Bacteria 91230
105 Ga0070697_100009642 3300005536 Bacteria 7542
106 Ga0070697_100060226 3300005536 Bacteria 3094
107 Ga0070697_100439327 3300005536 Unclassified 1135
108 Ga0068853_100051383 3300005539 Unclassified 3547
109 Ga0068853_100057957 3300005539 Bacteria 3343
110 Ga0068853_100109336 3300005539 Bacteria 2453
111 Ga0068853_100274175 3300005539 Bacteria 1554
112 Ga0068853_100430386 3300005539 Bacteria 1239
113 Ga0070686_100007128 3300005544 Bacteria 6232
114 Ga0070686_100202944 3300005544 Bacteria 1422
115 Ga0070686_100287212 3300005544 Unclassified 1215
116 Ga0070695_100023529 3300005545 Unclassified 3787
117 Ga0070695_100065536 3300005545 Bacteria 2365
118 Ga0070695_100117210 3300005545 Bacteria 1817
119 Ga0070695_100263466 3300005545 Bacteria 1260
120 Ga0070696_100013867 3300005546 Bacteria 5411
121 Ga0070696_100097095 3300005546 Bacteria 2106
122 Ga0070693_100050208 3300005547 Bacteria 2383
123 Ga0070693_100097989 3300005547 Bacteria 1781
124 Ga0070693_100122842 3300005547 Unclassified 1613
125 Ga0070693_100203015 3300005547 Unclassified 1289
126 Ga0070693_100219191 3300005547 Unclassified 1246
127 Ga0070704_100111219 3300005549 Bacteria 2085
128 Ga0070704_100168710 3300005549 Unclassified 1738
129 Ga0070704_100197724 3300005549 Bacteria 1621
130 Ga0070704_100427208 3300005549 Bacteria 1136
131 Ga0068855_100212708 3300005563 Unclassified 2172
132 Ga0070664_100002876 3300005564 Bacteria 13949
133 Ga0070664_100364397 3300005564 Unclassified 1317
134 Ga0070664_100492132 3300005564 Unclassified 1130
135 Ga0068857_100004039 3300005577 Bacteria 12354
136 Ga0068857_100182771 3300005577 Bacteria 1908
137 Ga0068857_100208802 3300005577 Unclassified 1781
138 Ga0068857_100225573 3300005577 Unclassified 1712
139 Ga0068856_100007675 3300005614 Bacteria 10524
140 Ga0070702_100001920 3300005615 Bacteria 8733
141 Ga0070702_100040594 3300005615 Bacteria 2604
142 Ga0070702_100051198 3300005615 Bacteria 2363
143 Ga0068852_100130838 3300005616 Bacteria 2311
144 Ga0068859_100023678 3300005617 Bacteria 6163
145 Ga0068859_100028014 3300005617 Bacteria 5649
146 Ga0068859_100033697 3300005617 Bacteria 5142
147 Ga0068859_100039736 3300005617 Unclassified 4721
148 Ga0068859_100048635 3300005617 Bacteria 4259
149 Ga0068859_100049231 3300005617 Bacteria 4232
150 Ga0068859_100104122 3300005617 Unclassified 2897
151 Ga0068859_100154099 3300005617 Bacteria 2374
152 Ga0068859_100179545 3300005617 Unclassified 2199
153 Ga0068859_100260789 3300005617 Bacteria 1824
154 Ga0068859_100796700 3300005617 Unclassified 1033
155 Ga0068864_100030760 3300005618 Bacteria 4552
156 Ga0068864_100031789 3300005618 Bacteria 4479
157 Ga0068864_100059269 3300005618 Bacteria 3311
158 Ga0068864_100081094 3300005618 Bacteria 2844
159 Ga0068864_100099609 3300005618 Bacteria 2575
160 Ga0068864_100121480 3300005618 Unclassified 2336
161 Ga0068864_100364225 3300005618 Unclassified 1367
162 Ga0068861_100039809 3300005719 Bacteria 3511
163 Ga0068861_100049600 3300005719 Unclassified 3179
164 Ga0068861_100116294 3300005719 Bacteria 2150
165 Ga0068861_100194509 3300005719 Bacteria 1698
166 Ga0068870_10027655 3300005840 Bacteria 2839
167 Ga0068863_100094435 3300005841 Bacteria 2838
168 Ga0068863_100200079 3300005841 Viruses 1921
169 Ga0068863_100233570 3300005841 Unclassified 1774
170 Ga0068863_100306212 3300005841 Unclassified 1542
171 Ga0068858_100120767 3300005842 Bacteria 2450
172 Ga0068858_100188647 3300005842 Bacteria 1948
173 Ga0068858_100573897 3300005842 Unclassified 1093
174 Ga0068860_100026324 3300005843 Bacteria 5608
175 Ga0068860_100071526 3300005843 Bacteria 3296
176 Ga0068860_100113002 3300005843 Bacteria 2596
177 Ga0068860_100646748 3300005843 Bacteria 1065
178 Ga0068862_100019704 3300005844 Bacteria 5632
179 Ga0068862_100040897 3300005844 Unclassified 3943
180 Ga0068862_100056760 3300005844 Bacteria 3355
181 Ga0068862_100119924 3300005844 Bacteria 2317
182 Ga0068862_100512936 3300005844 Bacteria 1140
183 Ga0081539_10000912 3300005985 Bacteria 55918
184 Ga0081539_10004405 3300005985 Bacteria 15600
185 Ga0097621_100016197 3300006237 Bacteria 5630
186 Ga0097621_100029825 3300006237 Bacteria 4311
187 Ga0068871_100011544 3300006358 Bacteria 6480
188 Ga0068871_100180569 3300006358 Bacteria 1813
189 Ga0075430_100461547 3300006846 Unclassified 1048
190 Ga0075431_100240263 3300006847 Bacteria 1843
191 Ga0075433_10080485 3300006852 Bacteria 2872
192 Ga0075433_10246822 3300006852 Unclassified 1584
193 Ga0075433_10486834 3300006852 Unclassified 1086
194 Ga0075434_100028100 3300006871 Bacteria 5524
195 Ga0075434_100222866 3300006871 Bacteria 1906
196 Ga0075434_100730103 3300006871 Unclassified 1008
197 Ga0068865_100161185 3300006881 Unclassified 1711
198 Ga0097620_100023678 3300006931 Bacteria 6163
199 Ga0097620_100028014 3300006931 Bacteria 5649
200 Ga0097620_100033695 3300006931 Bacteria 5142
201 Ga0097620_100039733 3300006931 Unclassified 4721
202 Ga0097620_100048635 3300006931 Bacteria 4259
203 Ga0097620_100049231 3300006931 Bacteria 4232
204 Ga0097620_100104114 3300006931 Unclassified 2897
205 Ga0097620_100154095 3300006931 Bacteria 2374
206 Ga0097620_100179551 3300006931 Unclassified 2199
207 Ga0097620_100245817 3300006931 Bacteria 1879
208 Ga0097620_100260797 3300006931 Bacteria 1824
209 Ga0097620_100353022 3300006931 Bacteria 1565
210 Ga0097620_100796801 3300006931 Unclassified 1033
211 Ga0075435_100002588 3300007076 Bacteria 12066
212 Ga0105251_10084144 3300009011 Bacteria 1468
213 Ga0105250_10111538 3300009092 Bacteria 1120
214 Ga0105240_10106148 3300009093 Bacteria 3407
215 Ga0111539_10011846 3300009094 Bacteria 10932
216 Ga0111539_10567244 3300009094 Bacteria 1322
217 Ga0105247_10026906 3300009101 Bacteria 3477
218 Ga0114129_10011179 3300009147 Bacteria 12798
219 Ga0114129_10015823 3300009147 Bacteria 10726
220 Ga0114129_10026044 3300009147 Bacteria 8281
221 Ga0114129_10121430 3300009147 Unclassified 3595
222 Ga0114129_10139556 3300009147 Bacteria 3323
223 Ga0114129_10208345 3300009147 Unclassified 2644
224 Ga0114129_10404602 3300009147 Archaea 1798
225 Ga0114129_10916142 3300009147 Bacteria 1110
226 Ga0105243_10010807 3300009148 Bacteria 6908
227 Ga0105243_10022385 3300009148 Unclassified 4803
228 Ga0105243_10115826 3300009148 Bacteria 2251
229 Ga0105243_10414324 3300009148 Bacteria 1255
230 Ga0105241_10035409 3300009174 Bacteria 3755
231 Ga0105241_10317719 3300009174 Unclassified 1342
232 Ga0105241_10413319 3300009174 Unclassified 1186
233 Ga0105242_10103152 3300009176 Bacteria 2419
234 Ga0105242_10103242 3300009176 Unclassified 2418
235 Ga0105248_10014444 3300009177 Bacteria 8692
236 Ga0105248_10016168 3300009177 Bacteria 8210
237 Ga0105248_10018079 3300009177 Bacteria 7783
238 Ga0105248_10040218 3300009177 Bacteria 5241
239 Ga0105248_10050311 3300009177 Unclassified 4673
240 Ga0105248_10103005 3300009177 Bacteria 3217
241 Ga0105248_10178538 3300009177 Bacteria 2393
242 Ga0105248_10221970 3300009177 Unclassified 2128
243 Ga0105237_10047720 3300009545 Bacteria 4305
244 Ga0105238_10215308 3300009551 Bacteria 1897
245 Ga0105249_10016835 3300009553 Bacteria 6487
246 Ga0105249_10049249 3300009553 Unclassified 3842
247 Ga0105249_10089651 3300009553 Unclassified 2874
248 Ga0105249_10133418 3300009553 Unclassified 2373
249 Ga0105239_10387764 3300010375 Bacteria 1580
250 Ga0105239_10410209 3300010375 Unclassified 1534
251 Ga0105239_10420591 3300010375 Bacteria 1514
252 Ga0105246_10016323 3300011119 Bacteria 4701
253 Ga0105246_10171806 3300011119 Bacteria 1661
254 Ga0105246_10334970 3300011119 Bacteria 1234
255 Ga0157373_10035111 3300013100 Bacteria 3601
256 Ga0157373_10087490 3300013100 Bacteria 2195
257 Ga0157373_10168529 3300013100 Bacteria 1541
258 Ga0157373_10183754 3300013100 Bacteria 1473
259 Ga0157373_10282744 3300013100 Unclassified 1176
260 Ga0157371_10179213 3300013102 Bacteria 1515
261 Ga0157371_10370536 3300013102 Bacteria 1045
262 Ga0157374_10047998 3300013296 Bacteria 3961
263 Ga0157378_10016727 3300013297 Bacteria 6427
264 Ga0157378_10026685 3300013297 Bacteria 5092
265 Ga0157378_10278829 3300013297 Unclassified 1610
266 Ga0157378_10375635 3300013297 Unclassified 1395
267 Ga0157378_10422059 3300013297 Bacteria 1318
268 Ga0163162_10001550 3300013306 Bacteria 21473
269 Ga0163162_10016789 3300013306 Bacteria 7157
270 Ga0163162_10031436 3300013306 Bacteria 5266
271 Ga0163162_10085701 3300013306 Bacteria 3227
272 Ga0163162_10244023 3300013306 Bacteria 1928
273 Ga0157372_10018421 3300013307 Bacteria 7505
274 Ga0157372_10230911 3300013307 Unclassified 2145
275 Ga0157372_10545992 3300013307 Bacteria 1351
276 Ga0157372_10828289 3300013307 Bacteria 1074
277 Ga0157375_10027382 3300013308 Bacteria 5327
278 Ga0157375_10046558 3300013308 Bacteria 4230
279 Ga0157375_10130798 3300013308 Bacteria 2629
280 Ga0157375_10222500 3300013308 Bacteria 2046
281 Ga0157375_10241456 3300013308 Bacteria 1966
282 Ga0163163_10000217 3300014325 Bacteria 59759
283 Ga0163163_10008018 3300014325 Bacteria 9350
284 Ga0163163_10031400 3300014325 Bacteria 5126
285 Ga0163163_10044720 3300014325 Unclassified 4345
286 Ga0163163_10080262 3300014325 Bacteria 3262
287 Ga0163163_10086284 3300014325 Unclassified 3148
288 Ga0163163_10089499 3300014325 Bacteria 3090
289 Ga0163163_10178661 3300014325 Bacteria 2169
290 Ga0157380_10006613 3300014326 Bacteria 8177
291 Ga0157380_10020590 3300014326 Bacteria 4933
292 Ga0157380_10025179 3300014326 Unclassified 4509
293 Ga0157380_10066659 3300014326 Bacteria 2896
294 Ga0157380_10121669 3300014326 Unclassified 2212
295 Ga0157380_10162347 3300014326 Bacteria 1943
296 Ga0157377_10057660 3300014745 Bacteria 2209
297 Ga0157377_10100443 3300014745 Bacteria 1723
298 Ga0157377_10128390 3300014745 Viruses 1545
299 Ga0157376_10135717 3300014969 Bacteria 2201
300 Ga0163161_10038461 3300017792 Bacteria 3431
301 Ga0163161_10129032 3300017792 Bacteria 1906
302 Ga0207697_10015587 3300025315 Unclassified 3138
303 Ga0207710_10129974 3300025900 Unclassified 1209
304 Ga0207680_10278315 3300025903 Unclassified 1162
305 Ga0207647_10071198 3300025904 Unclassified 2098
306 Ga0207645_10013930 3300025907 Bacteria 5392
307 Ga0207643_10001030 3300025908 Bacteria 16553
308 Ga0207643_10030846 3300025908 Bacteria 2986
309 Ga0207684_10000076 3300025910 Bacteria 183107
310 Ga0207684_10018499 3300025910 Bacteria 5965
311 Ga0207684_10087782 3300025910 Unclassified 2650
312 Ga0207654_10239955 3300025911 Bacteria 1211
313 Ga0207707_10000060 3300025912 Bacteria 108561
314 Ga0207707_10002592 3300025912 Bacteria 16195
315 Ga0207707_10097220 3300025912 Unclassified 2573
316 Ga0207695_10184604 3300025913 Bacteria 2005
317 Ga0207671_10103162 3300025914 Bacteria 2163
318 Ga0207660_10005767 3300025917 Bacteria 8035
319 Ga0207660_10010919 3300025917 Bacteria 5904
320 Ga0207660_10152450 3300025917 Bacteria 1777
321 Ga0207660_10190337 3300025917 Bacteria 1597
322 Ga0207660_10228498 3300025917 Bacteria 1462
323 Ga0207662_10147691 3300025918 Unclassified 1493
324 Ga0207662_10170751 3300025918 Bacteria 1394
325 Ga0207649_10034592 3300025920 Bacteria 3029
326 Ga0207652_10000073 3300025921 Bacteria 108588
327 Ga0207652_10009816 3300025921 Bacteria 7705
328 Ga0207652_10206820 3300025921 Unclassified 1767
329 Ga0207646_10056415 3300025922 Unclassified 3511
330 Ga0207646_10062326 3300025922 Bacteria 3329
331 Ga0207681_10030458 3300025923 Unclassified 3518
332 Ga0207681_10236719 3300025923 Unclassified 1419
333 Ga0207694_10131013 3300025924 Bacteria 2010
334 Ga0207650_10000027 3300025925 Bacteria 257466
335 Ga0207650_10107090 3300025925 Bacteria 2159
336 Ga0207650_10185989 3300025925 Unclassified 1657
337 Ga0207659_10190333 3300025926 Unclassified 1632
338 Ga0207659_10196889 3300025926 Bacteria 1607
339 Ga0207687_10130277 3300025927 Bacteria 1895
340 Ga0207644_10003808 3300025931 Bacteria 9768
341 Ga0207690_10000867 3300025932 Bacteria 19319
342 Ga0207706_10070899 3300025933 Bacteria 3065
343 Ga0207706_10148299 3300025933 Bacteria 2064
344 Ga0207686_10172860 3300025934 Unclassified 1525
345 Ga0207709_10002017 3300025935 Bacteria 13174
346 Ga0207709_10050310 3300025935 Bacteria 2548
347 Ga0207670_10001735 3300025936 Bacteria 11380
348 Ga0207670_10359081 3300025936 Unclassified 1156
349 Ga0207704_10121157 3300025938 Unclassified 1791
350 Ga0207691_10000985 3300025940 Bacteria 28294
351 Ga0207691_10226971 3300025940 Bacteria 1618
352 Ga0207711_10032312 3300025941 Unclassified 4425
353 Ga0207711_10040484 3300025941 Bacteria 3965
354 Ga0207711_10112335 3300025941 Bacteria 2424
355 Ga0207711_10251298 3300025941 Bacteria 1624
356 Ga0207711_10405921 3300025941 Unclassified 1266
357 Ga0207689_10009827 3300025942 Bacteria 8245
358 Ga0207689_10108386 3300025942 Bacteria 2282
359 Ga0207689_10250656 3300025942 Bacteria 1464
360 Ga0207679_10004633 3300025945 Bacteria 8559
361 Ga0207679_10426754 3300025945 Unclassified 1171
362 Ga0207679_10436981 3300025945 Unclassified 1158
363 Ga0207712_10011369 3300025961 Bacteria 5672
364 Ga0207712_10022833 3300025961 Unclassified 4124
365 Ga0207668_10428948 3300025972 Bacteria 1124
366 Ga0207703_10087750 3300026035 Bacteria 2609
367 Ga0207703_10176053 3300026035 Unclassified 1885
368 Ga0207639_10053739 3300026041 Bacteria 3075
369 Ga0207639_10108793 3300026041 Unclassified 2254
370 Ga0207708_10000028 3300026075 Bacteria 164263
371 Ga0207708_10007648 3300026075 Bacteria 7995
372 Ga0207708_10014390 3300026075 Bacteria 5920
373 Ga0207702_10030541 3300026078 Unclassified 4490
374 Ga0207641_10207641 3300026088 Bacteria 1809
375 Ga0207641_10225630 3300026088 Unclassified 1739
376 Ga0207648_10066564 3300026089 Bacteria 3142
377 Ga0207648_10075968 3300026089 Bacteria 2928
378 Ga0207648_10244046 3300026089 Bacteria 1600
379 Ga0207648_10267515 3300026089 Bacteria 1526
380 Ga0207648_10441739 3300026089 Bacteria 1183
381 Ga0207676_10004479 3300026095 Bacteria 9875
382 Ga0207676_10012322 3300026095 Bacteria 6123
383 Ga0207676_10057902 3300026095 Unclassified 3054
384 Ga0207676_10065666 3300026095 Bacteria 2890
385 Ga0207676_10208356 3300026095 Bacteria 1732
386 Ga0207676_10330874 3300026095 Unclassified 1402
387 Ga0207676_10604955 3300026095 Unclassified 1053
388 Ga0207676_10628132 3300026095 Unclassified 1034
389 Ga0207674_10001414 3300026116 Bacteria 30996
390 Ga0207674_10144343 3300026116 Bacteria 2339
391 Ga0207674_10257585 3300026116 Unclassified 1692
392 Ga0207674_10328076 3300026116 Unclassified 1480
393 Ga0207674_10378109 3300026116 Bacteria 1369
394 Ga0207674_10528247 3300026116 Bacteria 1140
395 Ga0207674_10550440 3300026116 Bacteria 1115
396 Ga0207675_100004372 3300026118 Bacteria 13658
397 Ga0207675_100050503 3300026118 Unclassified 3880
398 Ga0207675_100065265 3300026118 Bacteria 3402
399 Ga0207675_100101941 3300026118 Unclassified 2705
400 Ga0207675_100120875 3300026118 Bacteria 2478
401 Ga0207675_100159636 3300026118 Bacteria 2150
402 Ga0207675_100364423 3300026118 Bacteria 1418
403 Ga0207675_100706807 3300026118 Bacteria 1017
404 Ga0207428_10034992 3300027907 Bacteria 4109
405 Ga0207428_10339483 3300027907 Bacteria 1107
406 Ga0268265_10066201 3300028380 Unclassified 2792
407 Ga0268265_10067152 3300028380 Bacteria 2775
408 Ga0268265_10394528 3300028380 Bacteria 1277
409 Ga0268265_10480905 3300028380 Viruses 1166
410 Ga0268264_10057070 3300028381 Bacteria 3265
411 Ga0268264_10079992 3300028381 Bacteria 2790
412 Ga0268264_10080661 3300028381 Bacteria 2779
413 Ga0268264_10319243 3300028381 Bacteria 1468
414 Ga0307513_10356418 3300031456 Bacteria 1209
415 Ga0307408_100017117 3300031548 Unclassified 4849
416 Ga0307408_100093320 3300031548 Bacteria 2277
417 Ga0307406_10074015 3300031901 Bacteria 2241
418 Ga0307407_10171880 3300031903 Bacteria 1428
419 Ga0307412_10294149 3300031911 Bacteria 1280
420 Ga0307416_100019959 3300032002 Bacteria 4768
421 Ga0307416_100087315 3300032002 Bacteria 2662
422 Ga0307416_100170710 3300032002 Bacteria 2024
423 Ga0307414_10081609 3300032004 Bacteria 2368
424 Ga0307415_100082915 3300032126 Bacteria 2295
425 Ga0307415_100109713 3300032126 Bacteria 2045
426 Ga0373940_0015989 3300035088 Bacteria 1854
427 Ga0373951_0000553 3300035091 Bacteria 10451
428 Ga0373941_0004706 3300035115 Bacteria 3173
429 Ga0373942_0014234 3300035207 Bacteria 1923
430 Ga0373937_0034398 3300036401 Unclassified 4610
431 Ga0395900_0087547 3300037418 Bacteria 3201
432 Ga0395900_0294993 3300037418 Bacteria 1609
433 Ga0395898_0094155 3300037466 Bacteria 2879
434 Ga0395901_0219391 3300038443 Bacteria 1988
435 Ga0395901_0265261 3300038443 Unclassified 1787
436 Ga0242420_021338 3300038996 Unclassified 1159
437 Ga0451576_0488202 3300045051 Bacteria 1294
438 Ga0495610_0121017 3300046512 Bacteria 1147
439 Ga0495663_0000173 3300046525 Bacteria 26057
440 Ga0495621_0000023 3300046539 Bacteria 28394
441 Ga0496102_0100610 3300048905 Unclassified 2685
442 Ga0496104_0298192 3300048907 Unclassified 1524
443 Ga0496108_0083613 3300048911 Bacteria 2708
444 Ga0496108_0575574 3300048911 Bacteria 982
445 Ga0496110_0474192 3300048913 Unclassified 1140
446 Ga0496112_0120394 3300048915 Bacteria 2595
447 Ga0501306_010548 3300049127 Unclassified 1165
448 Ga0501291_009755 3300049514 Unclassified 1352
449 Ga0501292_007867 3300049515 Unclassified 1547
450 Ga0501292_024323 3300049515 Unclassified 993
451 Ga0501299_000318 3300049522 Bacteria 5543
452 Ga0501313_016004 3300049529 Bacteria 898
453 Ga0501323_016823 3300049539 Unclassified 935
454 Ga0501038_0001190 3300049574 Bacteria 23650
455 Ga0501198_014736 3300049649 Bacteria 1194
456 Ga0501202_001527 3300049652 Bacteria 3728
457 Ga0501216_024121 3300049660 Bacteria 1085
458 Ga0501224_006822 3300049664 Unclassified 1660
459 Ga0501227_010502 3300049665 Bacteria 2008
460 Ga0501230_011911 3300049667 Bacteria 1384
461 Ga0501233_026907 3300049668 Unclassified 1273
462 Ga0501235_001428 3300049669 Bacteria 5099
463 Ga0501240_016808 3300049673 Bacteria 1056
464 Ga0501249_038187 3300049679 Unclassified 1084
465 Ga0501249_040609 3300049679 Bacteria 1055
466 Ga0501259_015376 3300049688 Bacteria 1306
467 Ga0501225_0005690 3300049705 Bacteria 3653
468 Ga0501225_0006769 3300049705 Bacteria 3340
469 Ga0501234_007772 3300049707 Bacteria 1676
470 Ga0501079_0077446 3300049741 Unclassified 2572
471 Ga0501283_000357 3300049779 Bacteria 6126
472 Ga0501212_015578 3300049851 Unclassified 1135
473 nmdc:mga05p37_13493_c1 3300050507 Bacteria 9791
474 nmdc:mga05p37_155632_c1 3300050507 Unclassified 2793
475 nmdc:mga05p37_160685_c1 3300050507 Bacteria 2744
476 nmdc:mga05p37_291934_c1 3300050507 Bacteria 1941
477 nmdc:mga05p37_41987_c1 3300050507 Bacteria 5618
478 nmdc:mga05p37_502868_c1 3300050507 Archaea 1390
479 nmdc:mga05p37_69330_c1 3300050507 Bacteria 4337
480 nmdc:mga05p37_895826_c1 3300050507 Bacteria 957
481 nmdc:mga09592_139692_c1 3300050508 Unclassified 2087
482 nmdc:mga09592_240069_c1 3300050508 Bacteria 1570
483 nmdc:mga0qj67_329076_c1 3300050509 Bacteria 1236
484 nmdc:mga08y16_18632_c1 3300050511 Bacteria 7312
485 nmdc:mga08y16_48435_c1 3300050511 Bacteria 4448
486 nmdc:mga08y16_698205_c1 3300050511 Bacteria 1015
487 nmdc:mga08y16_818542_c1 3300050511 Bacteria 923
488 nmdc:mga0n895_207043_c1 3300050512 Unclassified 1992
489 nmdc:mga0n895_724384_c1 3300050512 Bacteria 989
490 nmdc:mga0rr50_49215_c1 3300050513 Bacteria 3119
491 nmdc:mga08x19_155108_c1 3300050514 Unclassified 1552
492 nmdc:mga08x19_50428_c1 3300050514 Unclassified 2671
493 nmdc:mga0a205_158005_c1 3300050515 Unclassified 2165
494 nmdc:mga0a205_61028_c2 3300050515 Bacteria 3123
495 Ga0587070_013155 3300059491 Bacteria 1272
496 Ga0587085_015737 3300059506 Bacteria 1085
497 Ga0587117_014492 3300059627 Bacteria 1025
498 Ga0587067_033254 3300059640 Unclassified 964
499 Ga0587068_025233 3300059641 Bacteria 999
500 Ga0587111_0038015 3300060346 Bacteria 1014
501 Ga0207681_10010733
502 MBSR1b_contig_13230442
503 MBSR1b_contig_5585598
504 JGI24751J29686_10000042
505 JGI24751J29686_10000072
506 JGI25406J46586_10003950
507 Ga0058861_10601031
508 Ga0058862_10696024
509 Ga0065714_10002183
510 Ga0065712_10000030
511 Ga0065712_10027130
512 Ga0065712_10032655
513 Ga0065712_10163135
514 Ga0065715_10090591
515 Ga0065715_10093031
516 Ga0065715_10122716
517 Ga0065715_10141244
518 Ga0065715_10281115
519 Ga0065707_10004418
520 Ga0065707_10098245
521 Ga0065707_10101375
522 Ga0065707_10140069
523 Ga0070676_10025103
524 Ga0070676_10214528
525 Ga0070690_100007607
526 Ga0070690_100062142
527 Ga0070670_100000378
528 Ga0070670_100070237
529 Ga0070670_100098389
530 Ga0070670_100102790
531 Ga0070670_100135072
532 Ga0070670_100147960
533 Ga0070670_100230599
534 Ga0068869_100167206
535 Ga0070680_100039502
536 Ga0070680_100117339
537 Ga0070680_100187257
538 Ga0070682_100000229
539 Ga0068868_100151597
540 Ga0068868_100192731
541 Ga0070689_100000230
542 Ga0070689_100181028
543 Ga0070687_100061732
544 Ga0070661_100069591
545 Ga0070692_10034123
546 Ga0070692_10037316
547 Ga0070669_100027301
548 Ga0070669_100042195
549 Ga0070669_100050624
550 Ga0070669_100095421
551 Ga0070669_100200644
552 Ga0070675_100280695
553 Ga0070675_100401056
554 Ga0070671_100022346
555 Ga0070671_100094581
556 Ga0070671_100233867
557 Ga0070674_100140330
558 Ga0070673_100033645
559 Ga0070688_100250560
560 Ga0070659_100002188
561 Ga0070709_10190774
562 Ga0070701_10009268
563 Ga0070701_10045073
564 Ga0070705_100034745
565 Ga0070705_100056831
566 Ga0070705_100339882
567 Ga0070705_100386319
568 Ga0070700_100000223
569 Ga0070700_100003166
570 Ga0070700_100031710
571 Ga0070700_100056102
572 Ga0070700_100121675
573 Ga0070694_100039127
574 Ga0070694_100084205
575 Ga0070694_100110492
576 Ga0070694_100195248
577 Ga0070708_100007334
578 Ga0070708_100259362
579 Ga0070662_100057246
580 Ga0070681_10000254
581 Ga0070681_10001421
582 Ga0070681_10009428
583 Ga0070681_10029276
584 Ga0068867_100079556
585 Ga0070685_10036917
586 Ga0070706_100000002
587 Ga0070706_100005583
588 Ga0070706_100069340
589 Ga0070706_100078447
590 Ga0070706_100135199
591 Ga0070707_100224231
592 Ga0070707_100281054
593 Ga0070698_100002576
594 Ga0070698_100025735
595 Ga0070698_100744740
596 Ga0070699_100000464
597 Ga0070699_100006252
598 Ga0070699_100012447
599 Ga0070699_100573395
600 Ga0070679_100000029
601 Ga0070679_100001933
602 Ga0070679_100202586
603 Ga0070684_100093872
604 Ga0070697_100000046
605 Ga0070697_100009642
606 Ga0070697_100060226
607 Ga0070697_100439327
608 Ga0068853_100051383
609 Ga0068853_100057957
610 Ga0068853_100109336
611 Ga0068853_100274175
612 Ga0068853_100430386
613 Ga0070686_100007128
614 Ga0070686_100202944
615 Ga0070686_100287212
616 Ga0070695_100023529
617 Ga0070695_100065536
618 Ga0070695_100117210
619 Ga0070695_100263466
620 Ga0070696_100013867
621 Ga0070696_100097095
622 Ga0070693_100050208
623 Ga0070693_100097989
624 Ga0070693_100122842
625 Ga0070693_100203015
626 Ga0070693_100219191
627 Ga0070704_100111219
628 Ga0070704_100168710
629 Ga0070704_100197724
630 Ga0070704_100427208
631 Ga0068855_100212708
632 Ga0070664_100002876
633 Ga0070664_100364397
634 Ga0070664_100492132
635 Ga0068857_100004039
636 Ga0068857_100182771
637 Ga0068857_100208802
638 Ga0068857_100225573
639 Ga0068856_100007675
640 Ga0070702_100001920
641 Ga0070702_100040594
642 Ga0070702_100051198
643 Ga0068852_100130838
644 Ga0068859_100023678
645 Ga0068859_100028014
646 Ga0068859_100033697
647 Ga0068859_100039736
648 Ga0068859_100048635
649 Ga0068859_100049231
650 Ga0068859_100104122
651 Ga0068859_100154099
652 Ga0068859_100179545
653 Ga0068859_100260789
654 Ga0068859_100796700
655 Ga0068864_100030760
656 Ga0068864_100031789
657 Ga0068864_100059269
658 Ga0068864_100081094
659 Ga0068864_100099609
660 Ga0068864_100121480
661 Ga0068864_100364225
662 Ga0068861_100039809
663 Ga0068861_100049600
664 Ga0068861_100116294
665 Ga0068861_100194509
666 Ga0068870_10027655
667 Ga0068863_100094435
668 Ga0068863_100200079
669 Ga0068863_100233570
670 Ga0068863_100306212
671 Ga0068858_100120767
672 Ga0068858_100188647
673 Ga0068858_100573897
674 Ga0068860_100026324
675 Ga0068860_100071526
676 Ga0068860_100113002
677 Ga0068860_100646748
678 Ga0068862_100019704
679 Ga0068862_100040897
680 Ga0068862_100056760
681 Ga0068862_100119924
682 Ga0068862_100512936
683 Ga0081539_10000912
684 Ga0081539_10004405
685 Ga0097621_100016197
686 Ga0097621_100029825
687 Ga0068871_100011544
688 Ga0068871_100180569
689 Ga0075430_100461547
690 Ga0075431_100240263
691 Ga0075433_10080485
692 Ga0075433_10246822
693 Ga0075433_10486834
694 Ga0075434_100028100
695 Ga0075434_100222866
696 Ga0075434_100730103
697 Ga0068865_100161185
698 Ga0097620_100023678
699 Ga0097620_100028014
700 Ga0097620_100033695
701 Ga0097620_100039733
702 Ga0097620_100048635
703 Ga0097620_100049231
704 Ga0097620_100104114
705 Ga0097620_100154095
706 Ga0097620_100179551
707 Ga0097620_100245817
708 Ga0097620_100260797
709 Ga0097620_100353022
710 Ga0097620_100796801
711 Ga0075435_100002588
712 Ga0105251_10084144
713 Ga0105250_10111538
714 Ga0105240_10106148
715 Ga0111539_10011846
716 Ga0111539_10567244
717 Ga0105247_10026906
718 Ga0114129_10011179
719 Ga0114129_10015823
720 Ga0114129_10026044
721 Ga0114129_10121430
722 Ga0114129_10139556
723 Ga0114129_10208345
724 Ga0114129_10404602
725 Ga0114129_10916142
726 Ga0105243_10010807
727 Ga0105243_10022385
728 Ga0105243_10115826
729 Ga0105243_10414324
730 Ga0105241_10035409
731 Ga0105241_10317719
732 Ga0105241_10413319
733 Ga0105242_10103152
734 Ga0105242_10103242
735 Ga0105248_10014444
736 Ga0105248_10016168
737 Ga0105248_10018079
738 Ga0105248_10040218
739 Ga0105248_10050311
740 Ga0105248_10103005
741 Ga0105248_10178538
742 Ga0105248_10221970
743 Ga0105237_10047720
744 Ga0105238_10215308
745 Ga0105249_10016835
746 Ga0105249_10049249
747 Ga0105249_10089651
748 Ga0105249_10133418
749 Ga0105239_10387764
750 Ga0105239_10410209
751 Ga0105239_10420591
752 Ga0105246_10016323
753 Ga0105246_10171806
754 Ga0105246_10334970
755 Ga0157373_10035111
756 Ga0157373_10087490
757 Ga0157373_10168529
758 Ga0157373_10183754
759 Ga0157373_10282744
760 Ga0157371_10179213
761 Ga0157371_10370536
762 Ga0157374_10047998
763 Ga0157378_10016727
764 Ga0157378_10026685
765 Ga0157378_10278829
766 Ga0157378_10375635
767 Ga0157378_10422059
768 Ga0163162_10001550
769 Ga0163162_10016789
770 Ga0163162_10031436
771 Ga0163162_10085701
772 Ga0163162_10244023
773 Ga0157372_10018421
774 Ga0157372_10230911
775 Ga0157372_10545992
776 Ga0157372_10828289
777 Ga0157375_10027382
778 Ga0157375_10046558
779 Ga0157375_10130798
780 Ga0157375_10222500
781 Ga0157375_10241456
782 Ga0163163_10000217
783 Ga0163163_10008018
784 Ga0163163_10031400
785 Ga0163163_10044720
786 Ga0163163_10080262
787 Ga0163163_10086284
788 Ga0163163_10089499
789 Ga0163163_10178661
790 Ga0157380_10006613
791 Ga0157380_10020590
792 Ga0157380_10025179
793 Ga0157380_10066659
794 Ga0157380_10121669
795 Ga0157380_10162347
796 Ga0157377_10057660
797 Ga0157377_10100443
798 Ga0157377_10128390
799 Ga0157376_10135717
800 Ga0163161_10038461
801 Ga0163161_10129032
802 Ga0207697_10015587
803 Ga0207710_10129974
804 Ga0207680_10278315
805 Ga0207647_10071198
806 Ga0207645_10013930
807 Ga0207643_10001030
808 Ga0207643_10030846
809 Ga0207684_10000076
810 Ga0207684_10018499
811 Ga0207684_10087782
812 Ga0207654_10239955
813 Ga0207707_10000060
814 Ga0207707_10002592
815 Ga0207707_10097220
816 Ga0207695_10184604
817 Ga0207671_10103162
818 Ga0207660_10005767
819 Ga0207660_10010919
820 Ga0207660_10152450
821 Ga0207660_10190337
822 Ga0207660_10228498
823 Ga0207662_10147691
824 Ga0207662_10170751
825 Ga0207649_10034592
826 Ga0207652_10000073
827 Ga0207652_10009816
828 Ga0207652_10206820
829 Ga0207646_10056415
830 Ga0207646_10062326
831 Ga0207681_10030458
832 Ga0207681_10236719
833 Ga0207694_10131013
834 Ga0207650_10000027
835 Ga0207650_10107090
836 Ga0207650_10185989
837 Ga0207659_10190333
838 Ga0207659_10196889
839 Ga0207687_10130277
840 Ga0207644_10003808
841 Ga0207690_10000867
842 Ga0207706_10070899
843 Ga0207706_10148299
844 Ga0207686_10172860
845 Ga0207709_10002017
846 Ga0207709_10050310
847 Ga0207670_10001735
848 Ga0207670_10359081
849 Ga0207704_10121157
850 Ga0207691_10000985
851 Ga0207691_10226971
852 Ga0207711_10032312
853 Ga0207711_10040484
854 Ga0207711_10112335
855 Ga0207711_10251298
856 Ga0207711_10405921
857 Ga0207689_10009827
858 Ga0207689_10108386
859 Ga0207689_10250656
860 Ga0207679_10004633
861 Ga0207679_10426754
862 Ga0207679_10436981
863 Ga0207712_10011369
864 Ga0207712_10022833
865 Ga0207668_10428948
866 Ga0207703_10087750
867 Ga0207703_10176053
868 Ga0207639_10053739
869 Ga0207639_10108793
870 Ga0207708_10000028
871 Ga0207708_10007648
872 Ga0207708_10014390
873 Ga0207702_10030541
874 Ga0207641_10207641
875 Ga0207641_10225630
876 Ga0207648_10066564
877 Ga0207648_10075968
878 Ga0207648_10244046
879 Ga0207648_10267515
880 Ga0207648_10441739
881 Ga0207676_10004479
882 Ga0207676_10012322
883 Ga0207676_10057902
884 Ga0207676_10065666
885 Ga0207676_10208356
886 Ga0207676_10330874
887 Ga0207676_10604955
888 Ga0207676_10628132
889 Ga0207674_10001414
890 Ga0207674_10144343
891 Ga0207674_10257585
892 Ga0207674_10328076
893 Ga0207674_10378109
894 Ga0207674_10528247
895 Ga0207674_10550440
896 Ga0207675_100004372
897 Ga0207675_100050503
898 Ga0207675_100065265
899 Ga0207675_100101941
900 Ga0207675_100120875
901 Ga0207675_100159636
902 Ga0207675_100364423
903 Ga0207675_100706807
904 Ga0207428_10034992
905 Ga0207428_10339483
906 Ga0268265_10066201
907 Ga0268265_10067152
908 Ga0268265_10394528
909 Ga0268265_10480905
910 Ga0268264_10057070
911 Ga0268264_10079992
912 Ga0268264_10080661
913 Ga0268264_10319243
914 Ga0307513_10356418
915 Ga0307408_100017117
916 Ga0307408_100093320
917 Ga0307406_10074015
918 Ga0307407_10171880
919 Ga0307412_10294149
920 Ga0307416_100019959
921 Ga0307416_100087315
922 Ga0307416_100170710
923 Ga0307414_10081609
924 Ga0307415_100082915
925 Ga0307415_100109713
926 Ga0373940_0015989
927 Ga0373951_0000553
928 Ga0373941_0004706
929 Ga0373942_0014234
930 Ga0373937_0034398
931 Ga0395900_0087547
932 Ga0395900_0294993
933 Ga0395898_0094155
934 Ga0395901_0219391
935 Ga0395901_0265261
936 Ga0242420_021338
937 Ga0451576_0488202
938 Ga0495610_0121017
939 Ga0495663_0000173
940 Ga0495621_0000023
941 Ga0496102_0100610
942 Ga0496104_0298192
943 Ga0496108_0083613
944 Ga0496108_0575574
945 Ga0496110_0474192
946 Ga0496112_0120394
947 Ga0501306_010548
948 Ga0501291_009755
949 Ga0501292_007867
950 Ga0501292_024323
951 Ga0501299_000318
952 Ga0501313_016004
953 Ga0501323_016823
954 Ga0501038_0001190
955 Ga0501198_014736
956 Ga0501202_001527
957 Ga0501216_024121
958 Ga0501224_006822
959 Ga0501227_010502
960 Ga0501230_011911
961 Ga0501233_026907
962 Ga0501235_001428
963 Ga0501240_016808
964 Ga0501249_038187
965 Ga0501249_040609
966 Ga0501259_015376
967 Ga0501225_0005690
968 Ga0501225_0006769
969 Ga0501234_007772
970 Ga0501079_0077446
971 Ga0501283_000357
972 Ga0501212_015578
973 nmdc:mga05p37_13493_c1
974 nmdc:mga05p37_155632_c1
975 nmdc:mga05p37_160685_c1
976 nmdc:mga05p37_291934_c1
977 nmdc:mga05p37_41987_c1
978 nmdc:mga05p37_502868_c1
979 nmdc:mga05p37_69330_c1
980 nmdc:mga05p37_895826_c1
981 nmdc:mga09592_139692_c1
982 nmdc:mga09592_240069_c1
983 nmdc:mga0qj67_329076_c1
984 nmdc:mga08y16_18632_c1
985 nmdc:mga08y16_48435_c1
986 nmdc:mga08y16_698205_c1
987 nmdc:mga08y16_818542_c1
988 nmdc:mga0n895_207043_c1
989 nmdc:mga0n895_724384_c1
990 nmdc:mga0rr50_49215_c1
991 nmdc:mga08x19_155108_c1
992 nmdc:mga08x19_50428_c1
993 nmdc:mga0a205_158005_c1
994 nmdc:mga0a205_61028_c2
995 Ga0587070_013155
996 Ga0587085_015737
997 Ga0587117_014492
998 Ga0587067_033254
999 Ga0587068_025233
1000 Ga0587111_0038015

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14686

fn3_3

Polysaccharide lyase family 4, domain II

229

290

0.89

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

238

295

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pcy-assembly1.cif.gz_A the crystal structure of plastocyanin from a green alga, enteromorpha prolifera 0.8729 99 182
4dp8-assembly1.cif.gz_X the 1.07 angstrom crystal structure of reduced (cui) poplar plastocyanin a at ph 4.0 0.8563 99 181
1iuz-assembly1.cif.gz_A plastocyanin 0.8554 99 182
4dp6-assembly1.cif.gz_X the 1.67 angstrom crystal structure of reduced (cui) poplar plastocyanin b at ph 8.0 0.8542 99 181
1tef-assembly2.cif.gz_B crystal structure of the spinach plastocyanin mutants g8d/k30c/t69c and k30c/t69c- a study of the effect on crystal packing and thermostability from the introduction of a novel disulfide bond 0.8448 99 181
ID Description Score Start End Superfamily
1jxdA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8527 97 181 2.60.40.420
5fc9B00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8309 99 181 2.60.40.420
1b3iA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8175 97 181 2.60.40.420
5ysgA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8094 97 185 2.60.40.420
af_Q54VX3_19_99_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8085 95 181 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A7V9CPV2-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9734 101 225 GO:0004180
GO:0030246
AF-A0A2V8JVL1-F1-model_v4 TonB-dependent receptor 0.9681 25 239
AF-A0A2V9YRM6-F1-model_v4 Rhamnogalacturonan lyase domain-containing protein 0.9675 70 238
AF-A0A2V9HNQ5-F1-model_v4 Rhamnogalacturonan lyase domain-containing protein 0.9637 21 240
AF-A0A523D2D2-F1-model_v4 TonB-dependent receptor 0.9628 21 241

Map