F455525

General Info

Members Datasets Scaffolds Average Seq Length
500 265 1000 181

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10113434|Ga0114129_101134344
Length 194
Sequence MSQAYKARGGLQVATVTEKTAIPTGIWKSDPVHSHVGFAVKHMVVATFRGAFTDYSVTLANEDGDPRLYGAVRAESVDVRDPQLNGHLLSPDFFDTERYPEITFTSSEIDADQGELVVRGKLTIKDTTKEVVARGSIVGPIEHPAGGERIGIDLETVVDRTEFGLNWNAPVPSGGVAVQNDVTLTIHLELAKEQ

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
131 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
148 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
149 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
150 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.4
Metatranscriptomes 20.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 10.2
Rhizosphere 88.2
Stem 0
Stem Tuber 0
Unclassified 7.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10113434 3300009147 Bacteria 3737
2 Ga0006759J45824_1040853 3300003163 Bacteria 729
3 Ga0006770J48903_1014744 3300003305 Bacteria 916
4 Ga0006777J48905_1024212 3300003308 Bacteria 636
5 Ga0006777J48905_1048030 3300003308 Bacteria 816
6 Ga0007427J51700_107307 3300003559 Bacteria 746
7 Ga0007427J51700_117541 3300003559 Bacteria 743
8 Ga0007409J51694_1014217 3300003575 Bacteria 940
9 Ga0007409J51694_1050817 3300003575 Bacteria 642
10 Ga0007409J51694_1060403 3300003575 Bacteria 672
11 Ga0007416J51690_1043836 3300003577 Bacteria 659
12 Ga0007416J51690_1056969 3300003577 Bacteria 724
13 Ga0007429J51699_1034983 3300003579 Bacteria 627
14 Ga0007429J51699_1047274 3300003579 Bacteria 646
15 Ga0007429J51699_1057341 3300003579 Bacteria 608
16 JGI25404J52841_10027641 3300003659 Unclassified 1219
17 Ga0032354_1029561 3300003693 Bacteria 630
18 Ga0032354_1034499 3300003693 Bacteria 735
19 JGI25405J52794_10050070 3300003911 Bacteria 894
20 Ga0058859_11660340 3300004798 Bacteria 834
21 Ga0070658_10139821 3300005327 Bacteria 2022
22 Ga0070683_100002749 3300005329 Bacteria 14057
23 Ga0070683_100059295 3300005329 Bacteria 3556
24 Ga0070683_100177751 3300005329 Bacteria 2020
25 Ga0070660_100627141 3300005339 Bacteria 900
26 Ga0070660_100657146 3300005339 Bacteria 878
27 Ga0070689_100925514 3300005340 Bacteria 772
28 Ga0070691_10161241 3300005341 Bacteria 1156
29 Ga0070675_100339564 3300005354 Bacteria 1330
30 Ga0070675_101191203 3300005354 Bacteria 701
31 Ga0070671_100710983 3300005355 Unclassified 872
32 Ga0070674_100172058 3300005356 Bacteria 1652
33 Ga0070674_100412256 3300005356 Bacteria 1106
34 Ga0070673_100834829 3300005364 Bacteria 852
35 Ga0070659_100065662 3300005366 Bacteria 2874
36 Ga0070659_100312399 3300005366 Bacteria 1312
37 Ga0070659_100703580 3300005366 Bacteria 874
38 Ga0070667_100431686 3300005367 Bacteria 1202
39 Ga0070714_101098896 3300005435 Bacteria 775
40 Ga0070713_100107706 3300005436 Bacteria 2425
41 Ga0070710_10366316 3300005437 Bacteria 958
42 Ga0070710_10616595 3300005437 Bacteria 757
43 Ga0070711_100019951 3300005439 Bacteria 4311
44 Ga0070711_100088692 3300005439 Bacteria 2223
45 Ga0070711_100717908 3300005439 Unclassified 842
46 Ga0070708_101157915 3300005445 Bacteria 724
47 Ga0070708_101189939 3300005445 Bacteria 713
48 Ga0070678_101118326 3300005456 Bacteria 728
49 Ga0070662_100363110 3300005457 Bacteria 1188
50 Ga0070662_100816249 3300005457 Bacteria 793
51 Ga0068867_100295132 3300005459 Bacteria 1334
52 Ga0070685_10446550 3300005466 Bacteria 905
53 Ga0070685_10969940 3300005466 Bacteria 636
54 Ga0070679_100498903 3300005530 Bacteria 1161
55 Ga0070684_100008808 3300005535 Bacteria 7910
56 Ga0070684_100385694 3300005535 Bacteria 1291
57 Ga0070672_100438939 3300005543 Bacteria 1123
58 Ga0070672_100959381 3300005543 Bacteria 757
59 Ga0070696_101183071 3300005546 Bacteria 645
60 Ga0070704_100032645 3300005549 Bacteria 3514
61 Ga0068855_100814034 3300005563 Bacteria 992
62 Ga0070664_100038469 3300005564 Bacteria 4027
63 Ga0070664_100723874 3300005564 Bacteria 928
64 Ga0070664_100801549 3300005564 Unclassified 881
65 Ga0068857_100003527 3300005577 Bacteria 13074
66 Ga0068854_101010475 3300005578 Bacteria 737
67 Ga0068856_100020441 3300005614 Bacteria 6430
68 Ga0068856_100520483 3300005614 Bacteria 1211
69 Ga0068856_100946727 3300005614 Bacteria 880
70 Ga0070702_100184948 3300005615 Bacteria 1366
71 Ga0068852_100067964 3300005616 Bacteria 3117
72 Ga0068852_100916561 3300005616 Unclassified 894
73 Ga0068859_100206669 3300005617 Bacteria 2049
74 Ga0068866_10579717 3300005718 Bacteria 754
75 Ga0068861_100854384 3300005719 Bacteria 858
76 Ga0068851_10072104 3300005834 Bacteria 1788
77 Ga0068870_10056541 3300005840 Bacteria 2095
78 Ga0068858_100699722 3300005842 Bacteria 986
79 Ga0068862_101012823 3300005844 Unclassified 822
80 Ga0081455_10004545 3300005937 Bacteria 15491
81 Ga0081455_10064613 3300005937 Bacteria 3063
82 Ga0081455_10065752 3300005937 Bacteria 3031
83 Ga0081455_10289186 3300005937 Bacteria 1181
84 Ga0081540_1001345 3300005983 Bacteria 21379
85 Ga0081539_10009349 3300005985 Bacteria 8222
86 Ga0070717_10040765 3300006028 Bacteria 3784
87 Ga0070716_100402457 3300006173 Bacteria 985
88 Ga0070712_100028350 3300006175 Bacteria 3744
89 Ga0070712_100073155 3300006175 Bacteria 2458
90 Ga0070712_100197248 3300006175 Bacteria 1579
91 Ga0075428_101007639 3300006844 Bacteria 882
92 Ga0075431_100059661 3300006847 Bacteria 3937
93 Ga0075434_100043818 3300006871 Bacteria 4438
94 Ga0075436_100111136 3300006914 Bacteria 1913
95 Ga0075436_100115365 3300006914 Bacteria 1876
96 Ga0097620_100206670 3300006931 Bacteria 2049
97 Ga0075435_100165896 3300007076 Bacteria 1862
98 Ga0105240_10127716 3300009093 Bacteria 3053
99 Ga0111539_10153059 3300009094 Bacteria 2699
100 Ga0111539_10483201 3300009094 Bacteria 1443
101 Ga0111539_11660620 3300009094 Bacteria 741
102 Ga0105245_10002366 3300009098 Bacteria 17041
103 Ga0105245_10698146 3300009098 Bacteria 1048
104 Ga0105245_10921822 3300009098 Bacteria 916
105 Ga0114129_10056028 3300009147 Bacteria 5524
106 Ga0114129_10281213 3300009147 Bacteria 2223
107 Ga0114129_10625296 3300009147 Bacteria 1392
108 Ga0105243_10036162 3300009148 Bacteria 3831
109 Ga0105243_10230157 3300009148 Bacteria 1644
110 Ga0105243_10599925 3300009148 Bacteria 1060
111 Ga0105243_10845992 3300009148 Bacteria 906
112 Ga0105243_11356219 3300009148 Bacteria 730
113 Ga0105248_11401781 3300009177 Bacteria 791
114 Ga0105237_11584349 3300009545 Bacteria 662
115 Ga0105238_10521449 3300009551 Bacteria 1191
116 Ga0105249_10235013 3300009553 Bacteria 1809
117 Ga0105249_10800014 3300009553 Bacteria 1007
118 Ga0105249_11302572 3300009553 Bacteria 798
119 Ga0105239_10895644 3300010375 Bacteria 1018
120 Ga0105239_11133119 3300010375 Bacteria 901
121 Ga0105246_10084132 3300011119 Bacteria 2275
122 Ga0105246_10343044 3300011119 Bacteria 1221
123 Ga0105246_10848859 3300011119 Bacteria 814
124 Ga0157335_1008030 3300012492 Unclassified 801
125 Ga0157369_11208662 3300013105 Bacteria 771
126 Ga0157374_10160477 3300013296 Bacteria 2189
127 Ga0157378_10336894 3300013297 Bacteria 1470
128 Ga0157378_10662440 3300013297 Bacteria 1060
129 Ga0163162_10802278 3300013306 Bacteria 1059
130 Ga0163162_11159265 3300013306 Bacteria 876
131 Ga0157372_10236508 3300013307 Bacteria 2119
132 Ga0157372_10387125 3300013307 Bacteria 1629
133 Ga0157372_10813886 3300013307 Bacteria 1085
134 Ga0157372_11629752 3300013307 Bacteria 743
135 Ga0157375_10307783 3300013308 Bacteria 1748
136 Ga0157375_10430009 3300013308 Bacteria 1486
137 Ga0157375_10569247 3300013308 Bacteria 1294
138 Ga0157375_11955479 3300013308 Bacteria 697
139 Ga0163163_10234072 3300014325 Bacteria 1886
140 Ga0157380_10868104 3300014326 Bacteria 926
141 Ga0157377_10037790 3300014745 Bacteria 2662
142 Ga0157377_10203586 3300014745 Bacteria 1258
143 Ga0157377_10228586 3300014745 Bacteria 1195
144 Ga0206356_11248371 3300020070 Bacteria 776
145 Ga0206350_10905264 3300020080 Bacteria 656
146 Ga0154015_1229894 3300020610 Unclassified 749
147 Ga0224712_10249235 3300022467 Bacteria 820
148 Ga0224712_10271697 3300022467 Bacteria 787
149 Ga0207426_1013215 3300025302 Bacteria 3067
150 Ga0207692_10660764 3300025898 Bacteria 676
151 Ga0207688_10029199 3300025901 Bacteria 3035
152 Ga0207688_10075461 3300025901 Bacteria 1919
153 Ga0207685_10130848 3300025905 Bacteria 1113
154 Ga0207645_10241309 3300025907 Bacteria 1194
155 Ga0207643_10059358 3300025908 Bacteria 2182
156 Ga0207705_10108277 3300025909 Bacteria 2051
157 Ga0207705_10554744 3300025909 Bacteria 893
158 Ga0207707_10609526 3300025912 Bacteria 923
159 Ga0207695_10099272 3300025913 Bacteria 2909
160 Ga0207693_10005072 3300025915 Bacteria 11047
161 Ga0207693_10012734 3300025915 Bacteria 6791
162 Ga0207693_10401746 3300025915 Bacteria 1071
163 Ga0207663_10003721 3300025916 Bacteria 7512
164 Ga0207663_10014135 3300025916 Bacteria 4362
165 Ga0207663_10052560 3300025916 Bacteria 2542
166 Ga0207660_10798374 3300025917 Bacteria 770
167 Ga0207657_10005625 3300025919 Bacteria 13081
168 Ga0207657_10125190 3300025919 Bacteria 2111
169 Ga0207657_10266121 3300025919 Bacteria 1363
170 Ga0207652_10435997 3300025921 Bacteria 1181
171 Ga0207650_10902178 3300025925 Unclassified 750
172 Ga0207659_10333367 3300025926 Bacteria 1255
173 Ga0207687_10230169 3300025927 Bacteria 1464
174 Ga0207687_10315041 3300025927 Bacteria 1265
175 Ga0207700_10461896 3300025928 Bacteria 1120
176 Ga0207690_10173598 3300025932 Bacteria 1617
177 Ga0207690_10175517 3300025932 Bacteria 1609
178 Ga0207706_10096947 3300025933 Bacteria 2593
179 Ga0207706_10966776 3300025933 Bacteria 717
180 Ga0207709_10595342 3300025935 Bacteria 875
181 Ga0207709_10613399 3300025935 Unclassified 863
182 Ga0207670_10073825 3300025936 Bacteria 2366
183 Ga0207669_10142915 3300025937 Bacteria 1664
184 Ga0207669_10153427 3300025937 Bacteria 1617
185 Ga0207669_10199807 3300025937 Bacteria 1450
186 Ga0207665_10102570 3300025939 Bacteria 1999
187 Ga0207691_10704999 3300025940 Bacteria 851
188 Ga0207689_10697990 3300025942 Bacteria 856
189 Ga0207661_10001047 3300025944 Bacteria 18355
190 Ga0207661_10815423 3300025944 Bacteria 859
191 Ga0207679_10099053 3300025945 Bacteria 2275
192 Ga0207679_10330855 3300025945 Bacteria 1322
193 Ga0207679_10416431 3300025945 Bacteria 1185
194 Ga0207651_11095954 3300025960 Bacteria 714
195 Ga0207712_10249454 3300025961 Bacteria 1434
196 Ga0207712_10532773 3300025961 Bacteria 1008
197 Ga0207712_10551235 3300025961 Bacteria 992
198 Ga0207668_11273111 3300025972 Bacteria 662
199 Ga0207640_11488405 3300025981 Bacteria 608
200 Ga0207658_11079374 3300025986 Bacteria 733
201 Ga0207677_10185871 3300026023 Bacteria 1639
202 Ga0207677_10808609 3300026023 Bacteria 840
203 Ga0207639_10302169 3300026041 Bacteria 1415
204 Ga0207702_10238640 3300026078 Bacteria 1702
205 Ga0207702_10490178 3300026078 Bacteria 1197
206 Ga0207641_11406125 3300026088 Bacteria 699
207 Ga0207648_10561146 3300026089 Bacteria 1050
208 Ga0207648_10852348 3300026089 Bacteria 850
209 Ga0207674_10007111 3300026116 Bacteria 13081
210 Ga0207675_100504337 3300026118 Bacteria 1205
211 Ga0207675_101125544 3300026118 Bacteria 805
212 Ga0207683_10003046 3300026121 Bacteria 14655
213 Ga0207698_10357911 3300026142 Bacteria 1381
214 Ga0265326_10025234 3300028558 Bacteria 1695
215 Ga0265319_1134632 3300028563 Unclassified 768
216 Ga0265327_10002631 3300031251 Bacteria 18518
217 Ga0307405_10736724 3300031731 Bacteria 820
218 Ga0307410_10010695 3300031852 Bacteria 5214
219 Ga0307410_10978160 3300031852 Bacteria 729
220 Ga0307406_10074835 3300031901 Bacteria 2232
221 Ga0307406_10090536 3300031901 Bacteria 2059
222 Ga0307406_10199222 3300031901 Bacteria 1472
223 Ga0307406_11418746 3300031901 Unclassified 609
224 Ga0307409_100534824 3300031995 Bacteria 1147
225 Ga0307409_100594250 3300031995 Bacteria 1093
226 Ga0307416_100217881 3300032002 Bacteria 1828
227 Ga0307416_100682061 3300032002 Bacteria 1115
228 Ga0307416_100745858 3300032002 Unclassified 1071
229 Ga0307416_101968633 3300032002 Bacteria 687
230 Ga0307411_10114000 3300032005 Bacteria 1941
231 Ga0307415_100253390 3300032126 Bacteria 1432
232 Ga0307415_100351805 3300032126 Bacteria 1240
233 Ga0307415_100442261 3300032126 Bacteria 1122
234 Ga0307415_101390850 3300032126 Bacteria 668
235 Ga0373931_0538501 3300035691 Bacteria 757
236 Ga0395898_0150062 3300037466 Bacteria 2230
237 Ga0395905_0664657 3300037471 Unclassified 944
238 Ga0395901_0090420 3300038443 Bacteria 3204
239 Ga0395901_0872114 3300038443 Bacteria 884
240 Ga0436365_0771004 3300039437 Unclassified 770
241 Ga0436363_1659743 3300039450 Unclassified 1401
242 Ga0436362_1210126 3300039453 Bacteria 927
243 Ga0451793_1685695 3300041452 Bacteria 1138
244 Ga0451802_1770491 3300041460 Bacteria 888
245 Ga0451847_0508116 3300041503 Bacteria 700
246 Ga0439460_0169004 3300042461 Bacteria 736
247 Ga0466965_0046445 3300044683 Bacteria 2150
248 Ga0466965_0068119 3300044683 Bacteria 1787
249 Ga0466966_0039497 3300044684 Bacteria 3039
250 Ga0466966_0509085 3300044684 Bacteria 724
251 Ga0466961_0203329 3300044693 Bacteria 1224
252 Ga0466961_0253759 3300044693 Bacteria 1080
253 Ga0466963_0095869 3300044694 Bacteria 2026
254 Ga0466963_0098386 3300044694 Bacteria 2000
255 Ga0466963_0222155 3300044694 Bacteria 1323
256 Ga0466963_0252015 3300044694 Bacteria 1239
257 Ga0466963_0802399 3300044694 Unclassified 664
258 Ga0466964_0083082 3300044706 Bacteria 1378
259 Ga0466957_0119356 3300044842 Bacteria 1680
260 Ga0466957_0504486 3300044842 Bacteria 839
261 Ga0466960_0201471 3300044901 Bacteria 1088
262 Ga0466960_0221721 3300044901 Bacteria 1041
263 Ga0466960_0317304 3300044901 Bacteria 882
264 Ga0466959_0432721 3300045049 Bacteria 893
265 Ga0466958_0105897 3300045836 Bacteria 1753
266 Ga0466958_0754721 3300045836 Bacteria 634
267 Ga0466967_0003235 3300045976 Bacteria 10533
268 Ga0466967_0031170 3300045976 Bacteria 4485
269 Ga0466967_0154657 3300045976 Bacteria 2147
270 Ga0466967_0254615 3300045976 Bacteria 1678
271 Ga0466967_0281993 3300045976 Bacteria 1594
272 Ga0466967_0301316 3300045976 Bacteria 1542
273 Ga0466967_0344142 3300045976 Bacteria 1442
274 Ga0466967_0519924 3300045976 Bacteria 1169
275 Ga0466967_0705802 3300045976 Bacteria 999
276 Ga0466967_1231875 3300045976 Bacteria 745
277 Ga0466967_1713933 3300045976 Unclassified 626
278 Ga0495592_0560398 3300046454 Bacteria 701
279 Ga0495603_0121242 3300046455 Bacteria 1524
280 Ga0495603_0206101 3300046455 Bacteria 1136
281 Ga0495629_0104706 3300046459 Bacteria 1974
282 Ga0495641_0013103 3300046461 Bacteria 4583
283 Ga0495641_0108557 3300046461 Bacteria 1238
284 Ga0495641_0125357 3300046461 Bacteria 1146
285 Ga0495582_0071421 3300046473 Bacteria 1921
286 Ga0495582_0234188 3300046473 Bacteria 1052
287 Ga0495582_0445800 3300046473 Bacteria 747
288 Ga0495605_0102252 3300046474 Bacteria 1316
289 Ga0495584_0066421 3300046491 Bacteria 1814
290 Ga0495608_0464242 3300046511 Unclassified 769
291 Ga0495637_0205685 3300046520 Bacteria 722
292 Ga0495587_0299642 3300046536 Bacteria 899
293 Ga0495656_0033347 3300046615 Bacteria 2101
294 Ga0495668_0237269 3300046616 Bacteria 999
295 Ga0495668_0378867 3300046616 Bacteria 777
296 Ga0495634_0049913 3300046642 Bacteria 2812
297 Ga0495635_0116084 3300046663 Bacteria 1827
298 Ga0495661_0267178 3300046665 Bacteria 867
299 Ga0495588_0131529 3300046674 Bacteria 1320
300 Ga0495588_0376946 3300046674 Bacteria 745
301 Ga0495647_0086194 3300046681 Bacteria 1281
302 Ga0495647_0176000 3300046681 Bacteria 929
303 Ga0495613_0125986 3300046689 Bacteria 1837
304 Ga0495624_0397731 3300046690 Bacteria 827
305 Ga0495624_0592815 3300046690 Bacteria 661
306 Ga0495671_0186648 3300046692 Bacteria 1007
307 Ga0495649_0372871 3300046694 Bacteria 719
308 Ga0495660_0166464 3300046810 Bacteria 1077
309 Ga0495674_0024409 3300047319 Bacteria 5556
310 Ga0495676_0136969 3300047321 Bacteria 1759
311 Ga0495680_0020220 3300047322 Bacteria 5607
312 Ga0495683_0319185 3300047323 Unclassified 663
313 Ga0495684_0084199 3300047471 Bacteria 2412
314 Ga0495602_0564763 3300048088 Bacteria 787
315 Ga0495614_0170232 3300048089 Unclassified 977
316 Ga0496100_0188751 3300048903 Bacteria 1495
317 Ga0496100_0201139 3300048903 Bacteria 1452
318 Ga0496100_0359727 3300048903 Bacteria 1101
319 Ga0496100_1019781 3300048903 Bacteria 651
320 Ga0496101_0015422 3300048904 Bacteria 5150
321 Ga0496101_0281127 3300048904 Bacteria 1301
322 Ga0496102_0015880 3300048905 Bacteria 6567
323 Ga0496102_0146820 3300048905 Bacteria 2214
324 Ga0496102_0555506 3300048905 Bacteria 1071
325 Ga0496102_0885903 3300048905 Unclassified 814
326 Ga0496103_0008247 3300048906 Bacteria 6185
327 Ga0496103_0205650 3300048906 Bacteria 1266
328 Ga0496104_0003829 3300048907 Bacteria 13027
329 Ga0496104_0035289 3300048907 Bacteria 4669
330 Ga0496104_0267871 3300048907 Bacteria 1621
331 Ga0496104_0342268 3300048907 Bacteria 1408
332 Ga0496104_1024054 3300048907 Bacteria 730
333 Ga0496105_0008600 3300048908 Bacteria 7933
334 Ga0496105_0842734 3300048908 Bacteria 694
335 Ga0496106_0011818 3300048909 Bacteria 6446
336 Ga0496106_0025684 3300048909 Bacteria 4385
337 Ga0496106_0144769 3300048909 Bacteria 1871
338 Ga0496107_0002031 3300048910 Bacteria 12927
339 Ga0496108_0008015 3300048911 Bacteria 8571
340 Ga0496108_0049658 3300048911 Bacteria 3509
341 Ga0496108_0094957 3300048911 Bacteria 2538
342 Ga0496108_0333095 3300048911 Bacteria 1324
343 Ga0496109_0011327 3300048912 Bacteria 7661
344 Ga0496109_0045660 3300048912 Bacteria 3976
345 Ga0496109_0223955 3300048912 Bacteria 1769
346 Ga0496109_0649835 3300048912 Bacteria 991
347 Ga0496109_1042341 3300048912 Bacteria 755
348 Ga0496109_1147681 3300048912 Bacteria 714
349 Ga0496110_0033535 3300048913 Bacteria 4441
350 Ga0496110_1144743 3300048913 Unclassified 686
351 Ga0496111_0011187 3300048914 Bacteria 6039
352 Ga0496111_0050393 3300048914 Bacteria 3003
353 Ga0496111_0273389 3300048914 Bacteria 1253
354 Ga0496112_0013727 3300048915 Bacteria 7489
355 Ga0496112_0084729 3300048915 Bacteria 3135
356 Ga0496112_0228742 3300048915 Bacteria 1814
357 Ga0496113_0008550 3300048916 Bacteria 6676
358 Ga0496113_0267290 3300048916 Bacteria 1367
359 Ga0496114_0014411 3300048917 Bacteria 6346
360 Ga0496115_0000053 3300048918 Bacteria 106425
361 Ga0496115_0000574 3300048918 Bacteria 28429
362 Ga0496115_0169515 3300048918 Bacteria 1805
363 Ga0496115_0313061 3300048918 Bacteria 1285
364 Ga0496115_0531413 3300048918 Bacteria 942
365 Ga0496119_0237828 3300048922 Bacteria 924
366 Ga0496121_0135457 3300048924 Bacteria 1836
367 Ga0496126_0562630 3300048929 Bacteria 903
368 Ga0501306_021278 3300049127 Bacteria 907
369 Ga0501306_023551 3300049127 Bacteria 875
370 Ga0501306_042606 3300049127 Bacteria 708
371 Ga0501306_058000 3300049127 Bacteria 633
372 Ga0501308_013713 3300049128 Bacteria 940
373 Ga0501308_033629 3300049128 Bacteria 698
374 Ga0501309_054882 3300049129 Bacteria 632
375 Ga0501310_044891 3300049130 Bacteria 625
376 Ga0501305_024175 3300049161 Bacteria 914
377 Ga0501305_029304 3300049161 Bacteria 851
378 Ga0501305_061506 3300049161 Bacteria 647
379 Ga0501307_009366 3300049162 Bacteria 1118
380 Ga0501307_019374 3300049162 Bacteria 872
381 Ga0501307_026515 3300049162 Bacteria 783
382 Ga0501307_027541 3300049162 Bacteria 773
383 Ga0501307_032841 3300049162 Bacteria 727
384 Ga0501307_050920 3300049162 Bacteria 623
385 Ga0501307_052033 3300049162 Unclassified 618
386 Ga0501311_007503 3300049527 Bacteria 1257
387 Ga0501311_025015 3300049527 Bacteria 835
388 Ga0501311_042620 3300049527 Bacteria 692
389 Ga0501311_057384 3300049527 Unclassified 622
390 Ga0501311_061220 3300049527 Bacteria 609
391 Ga0501312_021828 3300049528 Bacteria 956
392 Ga0501312_022334 3300049528 Bacteria 947
393 Ga0501312_027318 3300049528 Bacteria 879
394 Ga0501312_031465 3300049528 Bacteria 834
395 Ga0501312_040970 3300049528 Bacteria 757
396 Ga0501312_059274 3300049528 Unclassified 660
397 Ga0501312_078335 3300049528 Unclassified 595
398 Ga0501312_080282 3300049528 Bacteria 590
399 Ga0501313_005668 3300049529 Bacteria 1327
400 Ga0501313_009797 3300049529 Bacteria 1083
401 Ga0501313_017188 3300049529 Bacteria 873
402 Ga0501313_019736 3300049529 Bacteria 826
403 Ga0501313_025673 3300049529 Bacteria 746
404 Ga0501313_034942 3300049529 Bacteria 662
405 Ga0501313_039670 3300049529 Bacteria 630
406 Ga0501313_046833 3300049529 Bacteria 591
407 Ga0501314_016699 3300049530 Bacteria 734
408 Ga0501314_017177 3300049530 Unclassified 727
409 Ga0501315_009707 3300049531 Bacteria 1143
410 Ga0501316_018070 3300049532 Bacteria 869
411 Ga0501316_041819 3300049532 Bacteria 641
412 Ga0501316_053220 3300049532 Unclassified 587
413 Ga0501317_005466 3300049533 Bacteria 1362
414 Ga0501317_013177 3300049533 Bacteria 1030
415 Ga0501317_015089 3300049533 Bacteria 987
416 Ga0501317_017309 3300049533 Bacteria 944
417 Ga0501317_025797 3300049533 Bacteria 825
418 Ga0501317_049826 3300049533 Bacteria 662
419 Ga0501318_004403 3300049534 Bacteria 1349
420 Ga0501318_007609 3300049534 Bacteria 1137
421 Ga0501318_012367 3300049534 Bacteria 978
422 Ga0501318_015212 3300049534 Bacteria 916
423 Ga0501318_017431 3300049534 Bacteria 877
424 Ga0501318_020606 3300049534 Bacteria 832
425 Ga0501318_032886 3300049534 Bacteria 713
426 Ga0501318_033832 3300049534 Bacteria 706
427 Ga0501319_011453 3300049535 Bacteria 717
428 Ga0501319_016480 3300049535 Bacteria 635
429 Ga0501319_019251 3300049535 Bacteria 603
430 Ga0501320_005370 3300049536 Bacteria 1165
431 Ga0501320_022662 3300049536 Bacteria 738
432 Ga0501321_008628 3300049537 Bacteria 1085
433 Ga0501321_018213 3300049537 Bacteria 851
434 Ga0501321_040730 3300049537 Bacteria 653
435 Ga0501322_013445 3300049538 Bacteria 660
436 Ga0501323_016782 3300049539 Bacteria 936
437 Ga0501323_022923 3300049539 Bacteria 835
438 Ga0501323_037602 3300049539 Unclassified 700
439 Ga0501323_039041 3300049539 Unclassified 691
440 Ga0501323_046584 3300049539 Bacteria 649
441 Ga0501324_017761 3300049540 Bacteria 707
442 Ga0501325_004582 3300049541 Bacteria 1065
443 Ga0501325_027423 3300049541 Bacteria 635
444 Ga0501325_029394 3300049541 Archaea 622
445 Ga0501031_0071261 3300049568 Bacteria 2263
446 Ga0501032_0296075 3300049569 Bacteria 1046
447 Ga0501034_0956346 3300049571 Bacteria 742
448 Ga0501036_0117127 3300049572 Bacteria 2250
449 Ga0501038_0269402 3300049574 Bacteria 1343
450 Ga0501038_0400074 3300049574 Bacteria 1063
451 Ga0501039_0005706 3300049575 Bacteria 9427
452 Ga0501039_0363047 3300049575 Bacteria 1138
453 Ga0501039_0648816 3300049575 Bacteria 826
454 Ga0501040_0131123 3300049576 Bacteria 1763
455 Ga0501040_0906658 3300049576 Unclassified 639
456 Ga0501041_0023793 3300049577 Bacteria 3674
457 Ga0501042_0192066 3300049578 Bacteria 1473
458 Ga0501042_0286837 3300049578 Bacteria 1189
459 Ga0501046_0085043 3300049580 Bacteria 2439
460 Ga0501047_0032075 3300049581 Bacteria 5070
461 Ga0501068_0272208 3300049584 Bacteria 1081
462 Ga0501071_0221581 3300049587 Bacteria 1424
463 Ga0501071_0947528 3300049587 Unclassified 664
464 Ga0501072_0190475 3300049588 Bacteria 1636
465 Ga0501072_0220678 3300049588 Bacteria 1511
466 Ga0501072_0245420 3300049588 Bacteria 1426
467 Ga0501072_0381899 3300049588 Bacteria 1118
468 Ga0501075_0029096 3300049591 Bacteria 4084
469 Ga0501075_0340346 3300049591 Bacteria 1143
470 Ga0501076_0076316 3300049592 Bacteria 2688
471 Ga0501076_0292887 3300049592 Bacteria 1334
472 Ga0501077_0462366 3300049593 Bacteria 813
473 Ga0501079_0134874 3300049741 Bacteria 1922
474 Ga0501079_0642317 3300049741 Bacteria 836
475 Ga0501081_0639480 3300049743 Unclassified 797
476 Ga0501035_0301795 3300049822 Bacteria 1349
477 nmdc:mga05p37_230445_c1 3300050507 Bacteria 2232
478 nmdc:mga05p37_66218_c1 3300050507 Bacteria 4443
479 nmdc:mga05p37_812736_c1 3300050507 Bacteria 1021
480 nmdc:mga06r32_255930_c1 3300050510 Bacteria 1738
481 nmdc:mga08y16_137870_c1 3300050511 Bacteria 2536
482 nmdc:mga08y16_181628_c1 3300050511 Bacteria 2184
483 nmdc:mga0n895_185897_c1 3300050512 Bacteria 2109
484 nmdc:mga0rr50_122923_c1 3300050513 Bacteria 2068
485 nmdc:mga08x19_132863_c1 3300050514 Bacteria 1675
486 nmdc:mga0a205_255661_c1 3300050515 Bacteria 1630
487 Ga0495601_0001509 3300053077 Bacteria 12838
488 Ga0495619_0162025 3300053085 Bacteria 1545
489 Ga0495619_0494596 3300053085 Bacteria 841
490 Ga0495619_1094235 3300053085 Unclassified 530
491 Ga0501084_0034183 3300054114 Bacteria 4251
492 Ga0501084_0234873 3300054114 Bacteria 1548
493 Ga0587082_046213 3300059504 Archaea 816
494 Ga0587088_097334 3300059508 Bacteria 653
495 Ga0587106_082343 3300059605 Unclassified 629
496 Ga0587071_071964 3300060344 Archaea 755
497 Ga0501082_0059790 3300060353 Bacteria 3284
498 Ga0501082_0733672 3300060353 Bacteria 865
499 Ga0530510_0461173 3300061734 Bacteria 961
500 Ga0530510_0623695 3300061734 Bacteria 820
501 Ga0114129_10113434
502 Ga0006759J45824_1040853
503 Ga0006770J48903_1014744
504 Ga0006777J48905_1024212
505 Ga0006777J48905_1048030
506 Ga0007427J51700_107307
507 Ga0007427J51700_117541
508 Ga0007409J51694_1014217
509 Ga0007409J51694_1050817
510 Ga0007409J51694_1060403
511 Ga0007416J51690_1043836
512 Ga0007416J51690_1056969
513 Ga0007429J51699_1034983
514 Ga0007429J51699_1047274
515 Ga0007429J51699_1057341
516 JGI25404J52841_10027641
517 Ga0032354_1029561
518 Ga0032354_1034499
519 JGI25405J52794_10050070
520 Ga0058859_11660340
521 Ga0070658_10139821
522 Ga0070683_100002749
523 Ga0070683_100059295
524 Ga0070683_100177751
525 Ga0070660_100627141
526 Ga0070660_100657146
527 Ga0070689_100925514
528 Ga0070691_10161241
529 Ga0070675_100339564
530 Ga0070675_101191203
531 Ga0070671_100710983
532 Ga0070674_100172058
533 Ga0070674_100412256
534 Ga0070673_100834829
535 Ga0070659_100065662
536 Ga0070659_100312399
537 Ga0070659_100703580
538 Ga0070667_100431686
539 Ga0070714_101098896
540 Ga0070713_100107706
541 Ga0070710_10366316
542 Ga0070710_10616595
543 Ga0070711_100019951
544 Ga0070711_100088692
545 Ga0070711_100717908
546 Ga0070708_101157915
547 Ga0070708_101189939
548 Ga0070678_101118326
549 Ga0070662_100363110
550 Ga0070662_100816249
551 Ga0068867_100295132
552 Ga0070685_10446550
553 Ga0070685_10969940
554 Ga0070679_100498903
555 Ga0070684_100008808
556 Ga0070684_100385694
557 Ga0070672_100438939
558 Ga0070672_100959381
559 Ga0070696_101183071
560 Ga0070704_100032645
561 Ga0068855_100814034
562 Ga0070664_100038469
563 Ga0070664_100723874
564 Ga0070664_100801549
565 Ga0068857_100003527
566 Ga0068854_101010475
567 Ga0068856_100020441
568 Ga0068856_100520483
569 Ga0068856_100946727
570 Ga0070702_100184948
571 Ga0068852_100067964
572 Ga0068852_100916561
573 Ga0068859_100206669
574 Ga0068866_10579717
575 Ga0068861_100854384
576 Ga0068851_10072104
577 Ga0068870_10056541
578 Ga0068858_100699722
579 Ga0068862_101012823
580 Ga0081455_10004545
581 Ga0081455_10064613
582 Ga0081455_10065752
583 Ga0081455_10289186
584 Ga0081540_1001345
585 Ga0081539_10009349
586 Ga0070717_10040765
587 Ga0070716_100402457
588 Ga0070712_100028350
589 Ga0070712_100073155
590 Ga0070712_100197248
591 Ga0075428_101007639
592 Ga0075431_100059661
593 Ga0075434_100043818
594 Ga0075436_100111136
595 Ga0075436_100115365
596 Ga0097620_100206670
597 Ga0075435_100165896
598 Ga0105240_10127716
599 Ga0111539_10153059
600 Ga0111539_10483201
601 Ga0111539_11660620
602 Ga0105245_10002366
603 Ga0105245_10698146
604 Ga0105245_10921822
605 Ga0114129_10056028
606 Ga0114129_10281213
607 Ga0114129_10625296
608 Ga0105243_10036162
609 Ga0105243_10230157
610 Ga0105243_10599925
611 Ga0105243_10845992
612 Ga0105243_11356219
613 Ga0105248_11401781
614 Ga0105237_11584349
615 Ga0105238_10521449
616 Ga0105249_10235013
617 Ga0105249_10800014
618 Ga0105249_11302572
619 Ga0105239_10895644
620 Ga0105239_11133119
621 Ga0105246_10084132
622 Ga0105246_10343044
623 Ga0105246_10848859
624 Ga0157335_1008030
625 Ga0157369_11208662
626 Ga0157374_10160477
627 Ga0157378_10336894
628 Ga0157378_10662440
629 Ga0163162_10802278
630 Ga0163162_11159265
631 Ga0157372_10236508
632 Ga0157372_10387125
633 Ga0157372_10813886
634 Ga0157372_11629752
635 Ga0157375_10307783
636 Ga0157375_10430009
637 Ga0157375_10569247
638 Ga0157375_11955479
639 Ga0163163_10234072
640 Ga0157380_10868104
641 Ga0157377_10037790
642 Ga0157377_10203586
643 Ga0157377_10228586
644 Ga0206356_11248371
645 Ga0206350_10905264
646 Ga0154015_1229894
647 Ga0224712_10249235
648 Ga0224712_10271697
649 Ga0207426_1013215
650 Ga0207692_10660764
651 Ga0207688_10029199
652 Ga0207688_10075461
653 Ga0207685_10130848
654 Ga0207645_10241309
655 Ga0207643_10059358
656 Ga0207705_10108277
657 Ga0207705_10554744
658 Ga0207707_10609526
659 Ga0207695_10099272
660 Ga0207693_10005072
661 Ga0207693_10012734
662 Ga0207693_10401746
663 Ga0207663_10003721
664 Ga0207663_10014135
665 Ga0207663_10052560
666 Ga0207660_10798374
667 Ga0207657_10005625
668 Ga0207657_10125190
669 Ga0207657_10266121
670 Ga0207652_10435997
671 Ga0207650_10902178
672 Ga0207659_10333367
673 Ga0207687_10230169
674 Ga0207687_10315041
675 Ga0207700_10461896
676 Ga0207690_10173598
677 Ga0207690_10175517
678 Ga0207706_10096947
679 Ga0207706_10966776
680 Ga0207709_10595342
681 Ga0207709_10613399
682 Ga0207670_10073825
683 Ga0207669_10142915
684 Ga0207669_10153427
685 Ga0207669_10199807
686 Ga0207665_10102570
687 Ga0207691_10704999
688 Ga0207689_10697990
689 Ga0207661_10001047
690 Ga0207661_10815423
691 Ga0207679_10099053
692 Ga0207679_10330855
693 Ga0207679_10416431
694 Ga0207651_11095954
695 Ga0207712_10249454
696 Ga0207712_10532773
697 Ga0207712_10551235
698 Ga0207668_11273111
699 Ga0207640_11488405
700 Ga0207658_11079374
701 Ga0207677_10185871
702 Ga0207677_10808609
703 Ga0207639_10302169
704 Ga0207702_10238640
705 Ga0207702_10490178
706 Ga0207641_11406125
707 Ga0207648_10561146
708 Ga0207648_10852348
709 Ga0207674_10007111
710 Ga0207675_100504337
711 Ga0207675_101125544
712 Ga0207683_10003046
713 Ga0207698_10357911
714 Ga0265326_10025234
715 Ga0265319_1134632
716 Ga0265327_10002631
717 Ga0307405_10736724
718 Ga0307410_10010695
719 Ga0307410_10978160
720 Ga0307406_10074835
721 Ga0307406_10090536
722 Ga0307406_10199222
723 Ga0307406_11418746
724 Ga0307409_100534824
725 Ga0307409_100594250
726 Ga0307416_100217881
727 Ga0307416_100682061
728 Ga0307416_100745858
729 Ga0307416_101968633
730 Ga0307411_10114000
731 Ga0307415_100253390
732 Ga0307415_100351805
733 Ga0307415_100442261
734 Ga0307415_101390850
735 Ga0373931_0538501
736 Ga0395898_0150062
737 Ga0395905_0664657
738 Ga0395901_0090420
739 Ga0395901_0872114
740 Ga0436365_0771004
741 Ga0436363_1659743
742 Ga0436362_1210126
743 Ga0451793_1685695
744 Ga0451802_1770491
745 Ga0451847_0508116
746 Ga0439460_0169004
747 Ga0466965_0046445
748 Ga0466965_0068119
749 Ga0466966_0039497
750 Ga0466966_0509085
751 Ga0466961_0203329
752 Ga0466961_0253759
753 Ga0466963_0095869
754 Ga0466963_0098386
755 Ga0466963_0222155
756 Ga0466963_0252015
757 Ga0466963_0802399
758 Ga0466964_0083082
759 Ga0466957_0119356
760 Ga0466957_0504486
761 Ga0466960_0201471
762 Ga0466960_0221721
763 Ga0466960_0317304
764 Ga0466959_0432721
765 Ga0466958_0105897
766 Ga0466958_0754721
767 Ga0466967_0003235
768 Ga0466967_0031170
769 Ga0466967_0154657
770 Ga0466967_0254615
771 Ga0466967_0281993
772 Ga0466967_0301316
773 Ga0466967_0344142
774 Ga0466967_0519924
775 Ga0466967_0705802
776 Ga0466967_1231875
777 Ga0466967_1713933
778 Ga0495592_0560398
779 Ga0495603_0121242
780 Ga0495603_0206101
781 Ga0495629_0104706
782 Ga0495641_0013103
783 Ga0495641_0108557
784 Ga0495641_0125357
785 Ga0495582_0071421
786 Ga0495582_0234188
787 Ga0495582_0445800
788 Ga0495605_0102252
789 Ga0495584_0066421
790 Ga0495608_0464242
791 Ga0495637_0205685
792 Ga0495587_0299642
793 Ga0495656_0033347
794 Ga0495668_0237269
795 Ga0495668_0378867
796 Ga0495634_0049913
797 Ga0495635_0116084
798 Ga0495661_0267178
799 Ga0495588_0131529
800 Ga0495588_0376946
801 Ga0495647_0086194
802 Ga0495647_0176000
803 Ga0495613_0125986
804 Ga0495624_0397731
805 Ga0495624_0592815
806 Ga0495671_0186648
807 Ga0495649_0372871
808 Ga0495660_0166464
809 Ga0495674_0024409
810 Ga0495676_0136969
811 Ga0495680_0020220
812 Ga0495683_0319185
813 Ga0495684_0084199
814 Ga0495602_0564763
815 Ga0495614_0170232
816 Ga0496100_0188751
817 Ga0496100_0201139
818 Ga0496100_0359727
819 Ga0496100_1019781
820 Ga0496101_0015422
821 Ga0496101_0281127
822 Ga0496102_0015880
823 Ga0496102_0146820
824 Ga0496102_0555506
825 Ga0496102_0885903
826 Ga0496103_0008247
827 Ga0496103_0205650
828 Ga0496104_0003829
829 Ga0496104_0035289
830 Ga0496104_0267871
831 Ga0496104_0342268
832 Ga0496104_1024054
833 Ga0496105_0008600
834 Ga0496105_0842734
835 Ga0496106_0011818
836 Ga0496106_0025684
837 Ga0496106_0144769
838 Ga0496107_0002031
839 Ga0496108_0008015
840 Ga0496108_0049658
841 Ga0496108_0094957
842 Ga0496108_0333095
843 Ga0496109_0011327
844 Ga0496109_0045660
845 Ga0496109_0223955
846 Ga0496109_0649835
847 Ga0496109_1042341
848 Ga0496109_1147681
849 Ga0496110_0033535
850 Ga0496110_1144743
851 Ga0496111_0011187
852 Ga0496111_0050393
853 Ga0496111_0273389
854 Ga0496112_0013727
855 Ga0496112_0084729
856 Ga0496112_0228742
857 Ga0496113_0008550
858 Ga0496113_0267290
859 Ga0496114_0014411
860 Ga0496115_0000053
861 Ga0496115_0000574
862 Ga0496115_0169515
863 Ga0496115_0313061
864 Ga0496115_0531413
865 Ga0496119_0237828
866 Ga0496121_0135457
867 Ga0496126_0562630
868 Ga0501306_021278
869 Ga0501306_023551
870 Ga0501306_042606
871 Ga0501306_058000
872 Ga0501308_013713
873 Ga0501308_033629
874 Ga0501309_054882
875 Ga0501310_044891
876 Ga0501305_024175
877 Ga0501305_029304
878 Ga0501305_061506
879 Ga0501307_009366
880 Ga0501307_019374
881 Ga0501307_026515
882 Ga0501307_027541
883 Ga0501307_032841
884 Ga0501307_050920
885 Ga0501307_052033
886 Ga0501311_007503
887 Ga0501311_025015
888 Ga0501311_042620
889 Ga0501311_057384
890 Ga0501311_061220
891 Ga0501312_021828
892 Ga0501312_022334
893 Ga0501312_027318
894 Ga0501312_031465
895 Ga0501312_040970
896 Ga0501312_059274
897 Ga0501312_078335
898 Ga0501312_080282
899 Ga0501313_005668
900 Ga0501313_009797
901 Ga0501313_017188
902 Ga0501313_019736
903 Ga0501313_025673
904 Ga0501313_034942
905 Ga0501313_039670
906 Ga0501313_046833
907 Ga0501314_016699
908 Ga0501314_017177
909 Ga0501315_009707
910 Ga0501316_018070
911 Ga0501316_041819
912 Ga0501316_053220
913 Ga0501317_005466
914 Ga0501317_013177
915 Ga0501317_015089
916 Ga0501317_017309
917 Ga0501317_025797
918 Ga0501317_049826
919 Ga0501318_004403
920 Ga0501318_007609
921 Ga0501318_012367
922 Ga0501318_015212
923 Ga0501318_017431
924 Ga0501318_020606
925 Ga0501318_032886
926 Ga0501318_033832
927 Ga0501319_011453
928 Ga0501319_016480
929 Ga0501319_019251
930 Ga0501320_005370
931 Ga0501320_022662
932 Ga0501321_008628
933 Ga0501321_018213
934 Ga0501321_040730
935 Ga0501322_013445
936 Ga0501323_016782
937 Ga0501323_022923
938 Ga0501323_037602
939 Ga0501323_039041
940 Ga0501323_046584
941 Ga0501324_017761
942 Ga0501325_004582
943 Ga0501325_027423
944 Ga0501325_029394
945 Ga0501031_0071261
946 Ga0501032_0296075
947 Ga0501034_0956346
948 Ga0501036_0117127
949 Ga0501038_0269402
950 Ga0501038_0400074
951 Ga0501039_0005706
952 Ga0501039_0363047
953 Ga0501039_0648816
954 Ga0501040_0131123
955 Ga0501040_0906658
956 Ga0501041_0023793
957 Ga0501042_0192066
958 Ga0501042_0286837
959 Ga0501046_0085043
960 Ga0501047_0032075
961 Ga0501068_0272208
962 Ga0501071_0221581
963 Ga0501071_0947528
964 Ga0501072_0190475
965 Ga0501072_0220678
966 Ga0501072_0245420
967 Ga0501072_0381899
968 Ga0501075_0029096
969 Ga0501075_0340346
970 Ga0501076_0076316
971 Ga0501076_0292887
972 Ga0501077_0462366
973 Ga0501079_0134874
974 Ga0501079_0642317
975 Ga0501081_0639480
976 Ga0501035_0301795
977 nmdc:mga05p37_230445_c1
978 nmdc:mga05p37_66218_c1
979 nmdc:mga05p37_812736_c1
980 nmdc:mga06r32_255930_c1
981 nmdc:mga08y16_137870_c1
982 nmdc:mga08y16_181628_c1
983 nmdc:mga0n895_185897_c1
984 nmdc:mga0rr50_122923_c1
985 nmdc:mga08x19_132863_c1
986 nmdc:mga0a205_255661_c1
987 Ga0495601_0001509
988 Ga0495619_0162025
989 Ga0495619_0494596
990 Ga0495619_1094235
991 Ga0501084_0034183
992 Ga0501084_0234873
993 Ga0587082_046213
994 Ga0587088_097334
995 Ga0587106_082343
996 Ga0587071_071964
997 Ga0501082_0059790
998 Ga0501082_0733672
999 Ga0530510_0461173
1000 Ga0530510_0623695

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

27

190

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wub-assembly1.cif.gz_A crystal structure of the polyisoprenoid-binding protein, tt1927b, from thermus thermophilus hb8 0.8049 13 162
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.7949 12 164
3hpe-assembly1.cif.gz_B crystal structure of ycei (hp1286) from helicobacter pylori 0.7899 13 162
5ixg-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcnb 0.787 12 164
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.7719 12 164
ID Description Score Start End Superfamily
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8432 16 160 2.40.128.110
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8049 13 162 2.40.128.110
3hpeB00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.7899 13 162 2.40.128.110
5ixgA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.787 12 164 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.7823 12 164 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A1X3P6B0-F1-model_v4 Polyisoprenoid-binding protein 0.8964 7 164
AF-A0A359FU06-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.8895 9 94
AF-A0A538LXS3-F1-model_v4 YceI family protein 0.8826 2 164
AF-A0A1V2AA92-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.8815 9 164
AF-A0A1R4GHE7-F1-model_v4 Protein yceI 0.8802 3 164

Map