F455508

General Info

Members Datasets Scaffolds Average Seq Length
500 237 499 276

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100509511|Ga0068858_1005095111
Length 314
Sequence MFEETLKYSSPSDLLLPSSDLIHQTSDFTIFAQNLFMRKIIFTAIAAIILFTAGAQLKTPAPSPPQTIKQDFGLSAIELSYSRPGMKGRKIFGDLVPYGKIWRTGANNATTITFGDDVIIGGTKVPAGKYGLLTIPDKDNWTLIITKQLDITTNISAYKQDQDAVRVIVNPMKMKESMETFTMQFANIKPTSCELDLMWDNIAVAMPITTDVETKVMAQIDQLMNKDNRPYYNAALYYLENGKDLKQALVWFDKAAEQQPDAYWVQHQRANCLAKLGKKEEAKAAAEKSIALAKTAKNDDYVRLNEKLIAELNK

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
173 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
174 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
175 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
176 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
177 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
210 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
211 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
212 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
213 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
214 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
215 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
216 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
217 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
218 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
219 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
220 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
234 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
235 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
236 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 0
Rhizoplane 0.6
Rhizosphere 94.8
Stem 0
Stem Tuber 0
Unclassified 2.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c005374 3300000043 Bacteria 1182
2 JGI24740J21852_10001007 3300001979 Bacteria 12592
3 JGI25406J46586_10002945 3300003203 Bacteria 8029
4 rootH2_10312659 3300003320 Unclassified 2025
5 rootL2_10029339 3300003322 Bacteria 6434
6 rootL2_10056830 3300003322 Unclassified 2507
7 rootL2_10276368 3300003322 Bacteria 2893
8 rootH1_10008400 3300003323 Bacteria 11999
9 Ga0055531_10000023 3300003794 Bacteria 165025
10 Ga0065714_10174544 3300005288 Bacteria 989
11 Ga0065712_10085825 3300005290 Bacteria 2578
12 Ga0065712_10095409 3300005290 Bacteria 2219
13 Ga0065715_10198648 3300005293 Bacteria 1374
14 Ga0065707_10115452 3300005295 Bacteria 2266
15 Ga0070658_10016654 3300005327 Bacteria 5883
16 Ga0070658_10229994 3300005327 Bacteria 1570
17 Ga0070676_10009137 3300005328 Bacteria 5362
18 Ga0070676_10033550 3300005328 Bacteria 2945
19 Ga0070676_10048164 3300005328 Bacteria 2491
20 Ga0070676_10145337 3300005328 Bacteria 1513
21 Ga0070683_100000423 3300005329 Bacteria 29265
22 Ga0070683_100002680 3300005329 Bacteria 14237
23 Ga0070683_100331386 3300005329 Bacteria 1449
24 Ga0070690_100005732 3300005330 Bacteria 6994
25 Ga0070670_100176756 3300005331 Bacteria 1853
26 Ga0070670_100222387 3300005331 Unclassified 1643
27 Ga0070670_100537251 3300005331 Bacteria 1042
28 Ga0070677_10052759 3300005333 Bacteria 1651
29 Ga0068869_100009791 3300005334 Bacteria 6224
30 Ga0068869_100040088 3300005334 Bacteria 3347
31 Ga0068869_100330141 3300005334 Unclassified 1239
32 Ga0068869_100342650 3300005334 Bacteria 1217
33 Ga0068869_100376457 3300005334 Bacteria 1163
34 Ga0070666_10012219 3300005335 Bacteria 5410
35 Ga0070666_10071587 3300005335 Unclassified 2360
36 Ga0070680_100001198 3300005336 Bacteria 18698
37 Ga0070680_100019154 3300005336 Bacteria 5421
38 Ga0070682_100002561 3300005337 Bacteria 10035
39 Ga0070682_100206162 3300005337 Bacteria 1390
40 Ga0068868_100002364 3300005338 Bacteria 13055
41 Ga0068868_100032976 3300005338 Unclassified 3988
42 Ga0068868_100080443 3300005338 Bacteria 2611
43 Ga0070660_100000327 3300005339 Bacteria 31340
44 Ga0070660_100075730 3300005339 Bacteria 2635
45 Ga0070660_100211251 3300005339 Unclassified 1576
46 Ga0070660_100231904 3300005339 Unclassified 1502
47 Ga0070660_100520406 3300005339 Bacteria 991
48 Ga0070689_100016085 3300005340 Bacteria 5472
49 Ga0070691_10002873 3300005341 Bacteria 7715
50 Ga0070691_10048182 3300005341 Unclassified 2027
51 Ga0070661_100011314 3300005344 Bacteria 6217
52 Ga0070661_100017005 3300005344 Bacteria 5152
53 Ga0070668_100041743 3300005347 Bacteria 3515
54 Ga0070668_100067191 3300005347 Unclassified 2784
55 Ga0070669_100173806 3300005353 Unclassified 1681
56 Ga0070669_100235893 3300005353 Unclassified 1451
57 Ga0070669_100530863 3300005353 Bacteria 979
58 Ga0070675_100003139 3300005354 Bacteria 12498
59 Ga0070675_100007564 3300005354 Bacteria 8404
60 Ga0070675_100023643 3300005354 Bacteria 4916
61 Ga0070675_100042804 3300005354 Bacteria 3701
62 Ga0070675_100096796 3300005354 Bacteria 2480
63 Ga0070675_100658781 3300005354 Bacteria 952
64 Ga0070671_100180369 3300005355 Unclassified 1787
65 Ga0070671_100341663 3300005355 Unclassified 1277
66 Ga0070674_100019811 3300005356 Bacteria 4282
67 Ga0070674_100046034 3300005356 Unclassified 2983
68 Ga0070674_100094711 3300005356 Bacteria 2163
69 Ga0070673_100005056 3300005364 Bacteria 8412
70 Ga0070673_100029290 3300005364 Bacteria 4105
71 Ga0070673_100129431 3300005364 Unclassified 2116
72 Ga0070688_100034086 3300005365 Bacteria 3081
73 Ga0070688_100523708 3300005365 Bacteria 897
74 Ga0070659_100001674 3300005366 Bacteria 15927
75 Ga0070659_100038184 3300005366 Bacteria 3745
76 Ga0070659_100232943 3300005366 Unclassified 1522
77 Ga0070667_100005006 3300005367 Bacteria 11092
78 Ga0070667_100138120 3300005367 Bacteria 2132
79 Ga0070667_100142983 3300005367 Unclassified 2096
80 Ga0070705_100164596 3300005440 Bacteria 1486
81 Ga0070663_100011540 3300005455 Bacteria 5552
82 Ga0070663_100087979 3300005455 Bacteria 2296
83 Ga0070678_100001368 3300005456 Bacteria 12967
84 Ga0070678_100085913 3300005456 Unclassified 2398
85 Ga0070662_100016747 3300005457 Bacteria 4926
86 Ga0070662_100032353 3300005457 Bacteria 3675
87 Ga0070662_100066556 3300005457 Unclassified 2643
88 Ga0070662_100139539 3300005457 Bacteria 1877
89 Ga0070681_10011430 3300005458 Bacteria 8786
90 Ga0070681_10092257 3300005458 Bacteria 2977
91 Ga0070681_10566419 3300005458 Bacteria 1050
92 Ga0068867_100006548 3300005459 Bacteria 8226
93 Ga0068867_100127911 3300005459 Bacteria 1970
94 Ga0068867_100141790 3300005459 Bacteria 1879
95 Ga0070679_100002375 3300005530 Bacteria 17060
96 Ga0070679_100008240 3300005530 Bacteria 9802
97 Ga0070679_100029404 3300005530 Bacteria 5421
98 Ga0070684_100000691 3300005535 Bacteria 23235
99 Ga0070684_100001012 3300005535 Bacteria 20043
100 Ga0070684_100065373 3300005535 Unclassified 3192
101 Ga0070684_100142758 3300005535 Bacteria 2166
102 Ga0068853_100000097 3300005539 Bacteria 59626
103 Ga0068853_100042161 3300005539 Bacteria 3901
104 Ga0068853_100102747 3300005539 Bacteria 2529
105 Ga0068853_100107735 3300005539 Bacteria 2471
106 Ga0070672_100047011 3300005543 Bacteria 3347
107 Ga0070672_100116324 3300005543 Unclassified 2184
108 Ga0070672_100120148 3300005543 Bacteria 2150
109 Ga0070672_100379339 3300005543 Bacteria 1209
110 Ga0070693_100003469 3300005547 Bacteria 7361
111 Ga0070665_100040137 3300005548 Bacteria 4705
112 Ga0068855_100003699 3300005563 Bacteria 18698
113 Ga0068855_100016129 3300005563 Bacteria 8984
114 Ga0068855_100024468 3300005563 Bacteria 7224
115 Ga0068855_100205955 3300005563 Unclassified 2213
116 Ga0070664_100000142 3300005564 Bacteria 49085
117 Ga0070664_100008919 3300005564 Bacteria 8129
118 Ga0070664_100111973 3300005564 Bacteria 2383
119 Ga0070664_100277601 3300005564 Unclassified 1510
120 Ga0068857_100010293 3300005577 Bacteria 8126
121 Ga0068857_100047109 3300005577 Bacteria 3826
122 Ga0068856_100544066 3300005614 Bacteria 1182
123 Ga0068852_100161117 3300005616 Bacteria 2095
124 Ga0068852_100172277 3300005616 Bacteria 2030
125 Ga0068859_100056013 3300005617 Bacteria 3967
126 Ga0068859_100069122 3300005617 Bacteria 3566
127 Ga0068859_100073541 3300005617 Bacteria 3456
128 Ga0068859_100083107 3300005617 Bacteria 3245
129 Ga0068859_100142712 3300005617 Bacteria 2469
130 Ga0068864_100026088 3300005618 Bacteria 4925
131 Ga0068864_100088070 3300005618 Bacteria 2734
132 Ga0068864_100204652 3300005618 Bacteria 1815
133 Ga0068864_100378078 3300005618 Bacteria 1342
134 Ga0068861_100074300 3300005719 Bacteria 2643
135 Ga0068861_100114157 3300005719 Bacteria 2168
136 Ga0068870_10021012 3300005840 Unclassified 3188
137 Ga0068863_100043551 3300005841 Bacteria 4260
138 Ga0068863_100085740 3300005841 Bacteria 2984
139 Ga0068863_100159561 3300005841 Bacteria 2160
140 Ga0068858_100215905 3300005842 Bacteria 1816
141 Ga0068858_100232315 3300005842 Unclassified 1749
142 Ga0068858_100509511 3300005842 Bacteria 1163
143 Ga0068860_100024330 3300005843 Bacteria 5853
144 Ga0068860_100086632 3300005843 Unclassified 2981
145 Ga0068860_100113004 3300005843 Bacteria 2596
146 Ga0068860_100251349 3300005843 Bacteria 1722
147 Ga0068860_100324285 3300005843 Bacteria 1512
148 Ga0068860_100474770 3300005843 Bacteria 1246
149 Ga0068862_100001959 3300005844 Bacteria 18670
150 Ga0068862_100502331 3300005844 Unclassified 1151
151 Ga0068862_100670242 3300005844 Bacteria 1002
152 Ga0081539_10000223 3300005985 Bacteria 133106
153 Ga0075366_10026063 3300006195 Bacteria 3422
154 Ga0097621_100018040 3300006237 Bacteria 5379
155 Ga0097621_100291222 3300006237 Bacteria 1439
156 Ga0097621_100383067 3300006237 Bacteria 1256
157 Ga0097621_100402589 3300006237 Bacteria 1225
158 Ga0068871_100005350 3300006358 Bacteria 8997
159 Ga0068871_100196492 3300006358 Bacteria 1740
160 Ga0068871_100210623 3300006358 Bacteria 1681
161 Ga0068871_100224983 3300006358 Unclassified 1627
162 Ga0068871_100365264 3300006358 Unclassified 1279
163 Ga0075434_100349461 3300006871 Unclassified 1500
164 Ga0068865_100035886 3300006881 Bacteria 3338
165 Ga0068865_100069099 3300006881 Unclassified 2499
166 Ga0068865_100414308 3300006881 Bacteria 1106
167 Ga0097620_100056011 3300006931 Bacteria 3967
168 Ga0097620_100069122 3300006931 Bacteria 3566
169 Ga0097620_100073539 3300006931 Bacteria 3456
170 Ga0097620_100083107 3300006931 Bacteria 3245
171 Ga0097620_100142715 3300006931 Bacteria 2469
172 Ga0075435_100439706 3300007076 Unclassified 1124
173 Ga0105240_10003179 3300009093 Bacteria 25807
174 Ga0105240_10281816 3300009093 Bacteria 1909
175 Ga0105240_10843524 3300009093 Unclassified 990
176 Ga0111539_10004437 3300009094 Bacteria 18334
177 Ga0105247_10001854 3300009101 Bacteria 14787
178 Ga0105247_10161615 3300009101 Unclassified 1483
179 Ga0114129_10003132 3300009147 Bacteria 23207
180 Ga0105243_10175891 3300009148 Unclassified 1857
181 Ga0105241_10001894 3300009174 Bacteria 15861
182 Ga0105241_10320592 3300009174 Unclassified 1336
183 Ga0105242_10107033 3300009176 Bacteria 2378
184 Ga0105242_10256168 3300009176 Bacteria 1579
185 Ga0105237_10579076 3300009545 Unclassified 1129
186 Ga0105249_10018201 3300009553 Bacteria 6245
187 Ga0105249_10032022 3300009553 Bacteria 4756
188 Ga0105249_10041703 3300009553 Unclassified 4173
189 Ga0105249_10125066 3300009553 Unclassified 2448
190 Ga0105249_10153748 3300009553 Bacteria 2217
191 Ga0105249_10262884 3300009553 Unclassified 1716
192 Ga0105239_10162226 3300010375 Bacteria 2498
193 Ga0105246_10247782 3300011119 Bacteria 1412
194 Ga0105246_10321066 3300011119 Bacteria 1258
195 Ga0157373_10003686 3300013100 Bacteria 11585
196 Ga0157373_10131443 3300013100 Unclassified 1760
197 Ga0157373_10379492 3300013100 Bacteria 1011
198 Ga0157371_10002613 3300013102 Bacteria 17094
199 Ga0157371_10005272 3300013102 Bacteria 10955
200 Ga0157371_10100240 3300013102 Bacteria 2054
201 Ga0157371_10109674 3300013102 Unclassified 1959
202 Ga0157370_10003505 3300013104 Bacteria 18395
203 Ga0157370_10016434 3300013104 Bacteria 7492
204 Ga0157370_10016745 3300013104 Bacteria 7417
205 Ga0157370_10057181 3300013104 Bacteria 3710
206 Ga0157369_10016679 3300013105 Bacteria 8257
207 Ga0157374_10044715 3300013296 Bacteria 4093
208 Ga0157374_10047048 3300013296 Unclassified 3998
209 Ga0157374_10058591 3300013296 Bacteria 3599
210 Ga0157374_10098136 3300013296 Bacteria 2804
211 Ga0157378_10002018 3300013297 Bacteria 18170
212 Ga0157378_10040760 3300013297 Bacteria 4119
213 Ga0157378_10122119 3300013297 Unclassified 2402
214 Ga0157378_10153519 3300013297 Unclassified 2147
215 Ga0157378_10353834 3300013297 Bacteria 1435
216 Ga0157378_10621912 3300013297 Unclassified 1093
217 Ga0163162_10004947 3300013306 Bacteria 12840
218 Ga0163162_10005423 3300013306 Bacteria 12326
219 Ga0163162_10033370 3300013306 Bacteria 5115
220 Ga0163162_10134704 3300013306 Bacteria 2581
221 Ga0157372_10005839 3300013307 Bacteria 13108
222 Ga0157372_10028977 3300013307 Bacteria 6040
223 Ga0157372_10075466 3300013307 Bacteria 3804
224 Ga0157372_10076436 3300013307 Bacteria 3780
225 Ga0157372_10084008 3300013307 Bacteria 3607
226 Ga0157372_10125821 3300013307 Bacteria 2947
227 Ga0157372_10262999 3300013307 Bacteria 2004
228 Ga0157372_10490330 3300013307 Bacteria 1433
229 Ga0157375_10013870 3300013308 Bacteria 7185
230 Ga0157375_10033998 3300013308 Bacteria 4852
231 Ga0157375_10035028 3300013308 Bacteria 4788
232 Ga0157375_10072442 3300013308 Bacteria 3462
233 Ga0157375_10087008 3300013308 Bacteria 3176
234 Ga0157375_10551459 3300013308 Unclassified 1314
235 Ga0157375_10695079 3300013308 Bacteria 1171
236 Ga0163163_10000488 3300014325 Bacteria 35858
237 Ga0163163_10000652 3300014325 Bacteria 29704
238 Ga0163163_10084622 3300014325 Bacteria 3178
239 Ga0163163_10239120 3300014325 Bacteria 1865
240 Ga0163163_10540834 3300014325 Bacteria 1227
241 Ga0157380_10007645 3300014326 Bacteria 7684
242 Ga0157380_10065686 3300014326 Bacteria 2917
243 Ga0157380_10237781 3300014326 Unclassified 1640
244 Ga0157377_10024518 3300014745 Bacteria 3207
245 Ga0157377_10135524 3300014745 Bacteria 1508
246 Ga0157379_10010814 3300014968 Bacteria 7958
247 Ga0157379_10022758 3300014968 Bacteria 5553
248 Ga0157376_10018053 3300014969 Bacteria 5397
249 Ga0163161_10133797 3300017792 Bacteria 1872
250 Ga0163161_10291138 3300017792 Bacteria 1284
251 Ga0209758_1004203 3300025297 Bacteria 12208
252 Ga0207426_1000562 3300025302 Bacteria 50691
253 Ga0209257_1000013 3300025304 Bacteria 1047305
254 Ga0207697_10087786 3300025315 Bacteria 1316
255 Ga0207682_10014067 3300025893 Bacteria 3118
256 Ga0207682_10099465 3300025893 Bacteria 1270
257 Ga0207642_10042814 3300025899 Bacteria 1992
258 Ga0207710_10000652 3300025900 Bacteria 19617
259 Ga0207710_10147480 3300025900 Bacteria 1139
260 Ga0207688_10015054 3300025901 Bacteria 4197
261 Ga0207680_10031078 3300025903 Bacteria 3021
262 Ga0207647_10153615 3300025904 Unclassified 1344
263 Ga0207645_10005287 3300025907 Bacteria 9398
264 Ga0207645_10010099 3300025907 Bacteria 6497
265 Ga0207645_10086897 3300025907 Bacteria 2009
266 Ga0207645_10116440 3300025907 Bacteria 1733
267 Ga0207643_10004981 3300025908 Bacteria 7108
268 Ga0207643_10015733 3300025908 Unclassified 4120
269 Ga0207643_10032156 3300025908 Bacteria 2928
270 Ga0207705_10001125 3300025909 Bacteria 21755
271 Ga0207705_10470291 3300025909 Bacteria 975
272 Ga0207654_10001235 3300025911 Bacteria 13641
273 Ga0207707_10000449 3300025912 Bacteria 42875
274 Ga0207707_10062528 3300025912 Bacteria 3240
275 Ga0207707_10204826 3300025912 Unclassified 1719
276 Ga0207695_10017744 3300025913 Bacteria 8262
277 Ga0207695_10271276 3300025913 Unclassified 1592
278 Ga0207660_10077004 3300025917 Bacteria 2440
279 Ga0207657_10000716 3300025919 Bacteria 35235
280 Ga0207657_10167430 3300025919 Unclassified 1782
281 Ga0207657_10172717 3300025919 Bacteria 1750
282 Ga0207649_10001717 3300025920 Bacteria 12602
283 Ga0207649_10022160 3300025920 Bacteria 3669
284 Ga0207652_10000010 3300025921 Bacteria 247079
285 Ga0207652_10000475 3300025921 Bacteria 41112
286 Ga0207652_10004718 3300025921 Bacteria 11053
287 Ga0207681_10002255 3300025923 Bacteria 12258
288 Ga0207681_10252511 3300025923 Bacteria 1377
289 Ga0207650_10100326 3300025925 Bacteria 2227
290 Ga0207650_10154223 3300025925 Bacteria 1815
291 Ga0207659_10024330 3300025926 Bacteria 4056
292 Ga0207659_10098356 3300025926 Bacteria 2200
293 Ga0207659_10108820 3300025926 Bacteria 2103
294 Ga0207644_10197090 3300025931 Bacteria 1587
295 Ga0207644_10211048 3300025931 Bacteria 1535
296 Ga0207644_10375212 3300025931 Bacteria 1159
297 Ga0207690_10024559 3300025932 Bacteria 3776
298 Ga0207690_10254947 3300025932 Bacteria 1357
299 Ga0207706_10005151 3300025933 Bacteria 12200
300 Ga0207706_10043838 3300025933 Bacteria 3964
301 Ga0207706_10053903 3300025933 Bacteria 3550
302 Ga0207706_10074299 3300025933 Bacteria 2989
303 Ga0207706_10120306 3300025933 Unclassified 2308
304 Ga0207686_10196944 3300025934 Unclassified 1440
305 Ga0207686_10237910 3300025934 Bacteria 1324
306 Ga0207686_10337909 3300025934 Unclassified 1130
307 Ga0207709_10147020 3300025935 Unclassified 1627
308 Ga0207670_10019840 3300025936 Bacteria 4115
309 Ga0207670_10052478 3300025936 Unclassified 2742
310 Ga0207670_10154357 3300025936 Bacteria 1707
311 Ga0207669_10034897 3300025937 Bacteria 2856
312 Ga0207704_10044288 3300025938 Unclassified 2635
313 Ga0207704_10144079 3300025938 Unclassified 1671
314 Ga0207704_10198207 3300025938 Bacteria 1467
315 Ga0207691_10003616 3300025940 Bacteria 15003
316 Ga0207691_10027251 3300025940 Bacteria 5360
317 Ga0207689_10003428 3300025942 Bacteria 14476
318 Ga0207689_10013384 3300025942 Bacteria 7002
319 Ga0207689_10234728 3300025942 Bacteria 1516
320 Ga0207689_10350855 3300025942 Bacteria 1226
321 Ga0207661_10000710 3300025944 Bacteria 21628
322 Ga0207661_10058673 3300025944 Bacteria 3098
323 Ga0207679_10000408 3300025945 Bacteria 30790
324 Ga0207679_10228283 3300025945 Unclassified 1570
325 Ga0207679_10263109 3300025945 Bacteria 1472
326 Ga0207667_10002780 3300025949 Bacteria 21662
327 Ga0207667_10113553 3300025949 Bacteria 2793
328 Ga0207651_10015249 3300025960 Bacteria 4461
329 Ga0207651_10030074 3300025960 Bacteria 3453
330 Ga0207651_10160245 3300025960 Bacteria 1763
331 Ga0207712_10066183 3300025961 Bacteria 2582
332 Ga0207712_10186980 3300025961 Bacteria 1632
333 Ga0207668_10082475 3300025972 Bacteria 2336
334 Ga0207668_10121728 3300025972 Bacteria 1977
335 Ga0207640_10559089 3300025981 Bacteria 962
336 Ga0207658_10020159 3300025986 Bacteria 4618
337 Ga0207658_10117466 3300025986 Bacteria 2114
338 Ga0207658_10185065 3300025986 Bacteria 1727
339 Ga0207658_10201441 3300025986 Bacteria 1662
340 Ga0207658_10434197 3300025986 Bacteria 1160
341 Ga0207677_10007017 3300026023 Bacteria 6198
342 Ga0207677_10008637 3300026023 Bacteria 5703
343 Ga0207677_10278247 3300026023 Bacteria 1372
344 Ga0207703_10391357 3300026035 Bacteria 1288
345 Ga0207703_10681454 3300026035 Unclassified 977
346 Ga0207639_10002038 3300026041 Bacteria 13617
347 Ga0207639_10032009 3300026041 Bacteria 3868
348 Ga0207678_10009662 3300026067 Bacteria 8484
349 Ga0207678_10025244 3300026067 Bacteria 5188
350 Ga0207678_10115826 3300026067 Bacteria 2287
351 Ga0207641_10034790 3300026088 Bacteria 4193
352 Ga0207641_10062609 3300026088 Bacteria 3176
353 Ga0207641_10570884 3300026088 Bacteria 1105
354 Ga0207648_10020340 3300026089 Bacteria 5979
355 Ga0207648_10026755 3300026089 Bacteria 5123
356 Ga0207648_10030735 3300026089 Bacteria 4753
357 Ga0207648_10055993 3300026089 Unclassified 3442
358 Ga0207648_10367638 3300026089 Bacteria 1298
359 Ga0207676_10007197 3300026095 Bacteria 7875
360 Ga0207676_10188476 3300026095 Unclassified 1813
361 Ga0207676_10519350 3300026095 Bacteria 1133
362 Ga0207674_10004986 3300026116 Bacteria 15872
363 Ga0207674_10169867 3300026116 Unclassified 2134
364 Ga0207674_10403057 3300026116 Bacteria 1322
365 Ga0207675_100002004 3300026118 Bacteria 20311
366 Ga0207675_100042653 3300026118 Unclassified 4236
367 Ga0207683_10004176 3300026121 Bacteria 12504
368 Ga0207683_10042167 3300026121 Bacteria 3985
369 Ga0207428_10035895 3300027907 Bacteria 4049
370 Ga0268265_10006107 3300028380 Bacteria 8173
371 Ga0268265_10190478 3300028380 Unclassified 1771
372 Ga0268265_10199159 3300028380 Bacteria 1736
373 Ga0268265_10306092 3300028380 Unclassified 1433
374 Ga0268264_10026579 3300028381 Unclassified 4731
375 Ga0268264_10034390 3300028381 Unclassified 4169
376 Ga0268264_10133399 3300028381 Bacteria 2205
377 Ga0268264_10246641 3300028381 Bacteria 1657
378 Ga0307511_10005062 3300030521 Bacteria 13442
379 Ga0265327_10000031 3300031251 Bacteria 325718
380 Ga0265327_10008788 3300031251 Bacteria 7451
381 Ga0307513_10046322 3300031456 Bacteria 4742
382 Ga0307509_10134640 3300031507 Bacteria 2419
383 Ga0307508_10000923 3300031616 Bacteria 34113
384 Ga0307405_10185962 3300031731 Bacteria 1496
385 Ga0307413_10110731 3300031824 Bacteria 1838
386 Ga0307413_10261997 3300031824 Unclassified 1289
387 Ga0307410_10132971 3300031852 Bacteria 1830
388 Ga0307416_100148598 3300032002 Bacteria 2145
389 Ga0307414_10320599 3300032004 Bacteria 1319
390 Ga0307411_10044571 3300032005 Unclassified 2847
391 Ga0307415_100291895 3300032126 Bacteria 1346
392 Ga0307415_100498524 3300032126 Unclassified 1064
393 Ga0373943_0239748 3300035170 Bacteria 1016
394 Ga0373933_0033678 3300035724 Bacteria 2982
395 Ga0373947_0266631 3300035725 Bacteria 1136
396 Ga0373937_0021441 3300036401 Bacteria 5799
397 Ga0373925_0303852 3300037068 Bacteria 1289
398 Ga0395899_0000248 3300037312 Bacteria 72047
399 Ga0395899_0005054 3300037312 Bacteria 10261
400 Ga0395899_0009240 3300037312 Bacteria 7569
401 Ga0395899_0030820 3300037312 Bacteria 4032
402 Ga0395899_0080548 3300037312 Bacteria 2370
403 Ga0395900_0003094 3300037418 Bacteria 18068
404 Ga0395900_0032987 3300037418 Bacteria 5329
405 Ga0395900_0069508 3300037418 Bacteria 3619
406 Ga0395900_0100488 3300037418 Bacteria 2971
407 Ga0395900_0199124 3300037418 Unclassified 2027
408 Ga0395900_0572737 3300037418 Bacteria 1072
409 Ga0395898_0000488 3300037466 Bacteria 78598
410 Ga0395898_0011250 3300037466 Bacteria 9311
411 Ga0395898_0038646 3300037466 Bacteria 4728
412 Ga0395898_0079886 3300037466 Bacteria 3154
413 Ga0395898_0113104 3300037466 Bacteria 2602
414 Ga0395905_0563600 3300037471 Unclassified 1040
415 Ga0395901_0008350 3300038443 Bacteria 10469
416 Ga0395901_0040340 3300038443 Bacteria 4834
417 Ga0395901_0049443 3300038443 Bacteria 4368
418 Ga0395901_0061427 3300038443 Bacteria 3910
419 Ga0395901_0120088 3300038443 Bacteria 2762
420 Ga0395901_0136372 3300038443 Bacteria 2579
421 Ga0395901_0587851 3300038443 Unclassified 1124
422 Ga0439465_0075074 3300041413 Bacteria 1138
423 Ga0451843_1500914 3300041509 Bacteria 1237
424 Ga0439433_0004931 3300041999 Bacteria 2868
425 Ga0439449_0002640 3300042007 Bacteria 6977
426 Ga0439449_0014818 3300042007 Bacteria 2930
427 Ga0439449_0084782 3300042007 Bacteria 1169
428 Ga0439462_0028350 3300042015 Bacteria 1480
429 Ga0439434_0035748 3300042435 Bacteria 1519
430 Ga0466957_0002726 3300044842 Bacteria 9551
431 Ga0466960_0248773 3300044901 Bacteria 987
432 Ga0495628_0009804 3300046516 Bacteria 8158
433 Ga0495630_0009666 3300046517 Bacteria 6936
434 Ga0495643_0013690 3300046522 Bacteria 4846
435 Ga0495652_0037370 3300046529 Bacteria 4213
436 Ga0495587_0066727 3300046536 Bacteria 2098
437 Ga0495645_0153481 3300046543 Bacteria 1598
438 Ga0495667_0084341 3300046559 Bacteria 2063
439 Ga0495634_0011993 3300046642 Bacteria 6284
440 Ga0495657_0038927 3300046675 Bacteria 3269
441 Ga0495649_0074992 3300046694 Unclassified 1812
442 Ga0495604_0100242 3300047317 Bacteria 2130
443 Ga0495672_0003113 3300047320 Bacteria 14477
444 Ga0495680_0148764 3300047322 Bacteria 1708
445 Ga0495686_0016555 3300047472 Bacteria 4998
446 Ga0495686_0064587 3300047472 Bacteria 2265
447 Ga0496101_0116598 3300048904 Bacteria 2015
448 Ga0496109_0853171 3300048912 Unclassified 849
449 Ga0496110_0292722 3300048913 Bacteria 1483
450 Ga0501298_001590 3300049521 Bacteria 3365
451 Ga0501031_0009520 3300049568 Bacteria 6323
452 Ga0501033_0193974 3300049570 Unclassified 1453
453 Ga0501036_0079314 3300049572 Bacteria 2777
454 Ga0501037_0462791 3300049573 Bacteria 864
455 Ga0501038_0003678 3300049574 Bacteria 14282
456 Ga0501039_0008667 3300049575 Bacteria 7747
457 Ga0501043_0075074 3300049579 Bacteria 2656
458 Ga0501047_0378215 3300049581 Bacteria 1251
459 Ga0501067_0041755 3300049583 Bacteria 2547
460 Ga0501072_0374565 3300049588 Bacteria 1130
461 Ga0501073_0098502 3300049589 Bacteria 2030
462 Ga0501073_0125168 3300049589 Bacteria 1782
463 Ga0501201_000885 3300049651 Unclassified 2815
464 Ga0501202_021000 3300049652 Unclassified 1301
465 Ga0501222_005775 3300049662 Unclassified 1666
466 Ga0501223_005703 3300049663 Unclassified 2604
467 Ga0501223_020859 3300049663 Unclassified 1283
468 Ga0501235_014029 3300049669 Unclassified 1766
469 Ga0501240_010582 3300049673 Unclassified 1227
470 Ga0501243_003948 3300049675 Unclassified 2214
471 Ga0501259_001100 3300049688 Bacteria 4518
472 Ga0501259_013269 3300049688 Bacteria 1382
473 Ga0501261_006403 3300049690 Unclassified 1497
474 Ga0501221_002410 3300049704 Bacteria 3088
475 Ga0501225_0006676 3300049705 Bacteria 3364
476 Ga0501225_0007109 3300049705 Unclassified 3252
477 Ga0501245_001286 3300049708 Bacteria 3227
478 Ga0501245_011720 3300049708 Unclassified 1279
479 Ga0501080_0492867 3300049742 Unclassified 1096
480 Ga0501080_0522921 3300049742 Unclassified 1058
481 Ga0501083_0090609 3300049744 Bacteria 2019
482 Ga0501083_0151337 3300049744 Bacteria 1519
483 Ga0501241_002826 3300049758 Bacteria 3334
484 Ga0501241_022343 3300049758 Unclassified 1168
485 Ga0501044_0106568 3300049823 Unclassified 2815
486 Ga0501044_0608498 3300049823 Unclassified 985
487 Ga0501212_005665 3300049851 Unclassified 1657
488 nmdc:mga0k408_51102_c1 3300050493 Bacteria 2394
489 nmdc:mga05p37_6756_c1 3300050507 Bacteria 13525
490 nmdc:mga08y16_30416_c1 3300050511 Bacteria 5684
491 nmdc:mga0n895_17682_c1 3300050512 Bacteria 6578
492 Ga0495619_0117673 3300053085 Bacteria 1820
493 Ga0500646_0050936 3300053090 Bacteria 1195
494 Ga0500568_0003080 3300053139 Bacteria 9521
495 Ga0500588_0020601 3300053146 Bacteria 1769
496 Ga0500616_0005546 3300053153 Bacteria 8545
497 Ga0500622_0000110 3300053156 Bacteria 83911
498 Ga0500611_000031 3300053727 Bacteria 85821
499 Ga0501084_0153034 3300054114 Bacteria 1944

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0853171 Ga0496109_0853171_38_721 227
2 3300037418 Ga0395900_0003094 Ga0395900_0003094_15_785 231
3 3300013100 Ga0157373_10379492 Ga0157373_103794922 233
4 3300037312 Ga0395899_0000248 Ga0395899_0000248_52883_53704 245
5 3300037466 Ga0395898_0000488 Ga0395898_0000488_58764_59585 245
6 3300038443 Ga0395901_0008350 Ga0395901_0008350_2325_3146 245
7 3300009093 Ga0105240_10843524 Ga0105240_108435241 251
8 3300009093 Ga0105240_10281816 Ga0105240_102818161 252
9 3300013104 Ga0157370_10016434 Ga0157370_100164342 252
10 3300025913 Ga0207695_10271276 Ga0207695_102712761 252
11 3300005458 Ga0070681_10566419 Ga0070681_105664191 253
12 3300005327 Ga0070658_10229994 Ga0070658_102299942 254
13 3300005530 Ga0070679_100008240 Ga0070679_1000082409 254
14 3300013307 Ga0157372_10005839 Ga0157372_100058392 254
15 3300013307 Ga0157372_10262999 Ga0157372_102629992 254
16 3300025921 Ga0207652_10000010 Ga0207652_1000001070 254
17 3300037068 Ga0373925_0303852 Ga0373925_0303852_181_1098 254
18 3300037312 Ga0395899_0009240 Ga0395899_0009240_5530_6369 254
19 3300037312 Ga0395899_0080548 Ga0395899_0080548_1138_1983 254
20 3300037418 Ga0395900_0032987 Ga0395900_0032987_2031_2870 254
21 3300037466 Ga0395898_0113104 Ga0395898_0113104_1242_2081 254
22 3300038443 Ga0395901_0061427 Ga0395901_0061427_344_1183 254
23 3300038443 Ga0395901_0136372 Ga0395901_0136372_727_1572 254
24 3300005327 Ga0070658_10016654 Ga0070658_100166543 256
25 3300005336 Ga0070680_100019154 Ga0070680_1000191543 256
26 3300005455 Ga0070663_100087979 Ga0070663_1000879791 256
27 3300005458 Ga0070681_10092257 Ga0070681_100922571 256
28 3300005530 Ga0070679_100029404 Ga0070679_1000294043 256
29 3300005535 Ga0070684_100142758 Ga0070684_1001427582 256
30 3300005563 Ga0068855_100003699 Ga0068855_1000036993 256
31 3300013105 Ga0157369_10016679 Ga0157369_100166796 256
32 3300013307 Ga0157372_10028977 Ga0157372_100289773 256
33 3300025909 Ga0207705_10001125 Ga0207705_100011254 256
34 3300025912 Ga0207707_10204826 Ga0207707_102048262 256
35 3300025917 Ga0207660_10077004 Ga0207660_100770043 256
36 3300025921 Ga0207652_10000475 Ga0207652_100004753 256
37 3300025944 Ga0207661_10058673 Ga0207661_100586732 256
38 3300025949 Ga0207667_10002780 Ga0207667_1000278015 256
39 3300026067 Ga0207678_10009662 Ga0207678_100096625 256
40 3300035170 Ga0373943_0239748 Ga0373943_0239748_142_963 256
41 3300037312 Ga0395899_0005054 Ga0395899_0005054_3437_4282 256
42 3300037418 Ga0395900_0100488 Ga0395900_0100488_1311_2156 256
43 3300037466 Ga0395898_0011250 Ga0395898_0011250_3723_4568 256
44 3300038443 Ga0395901_0120088 Ga0395901_0120088_1425_2270 256
45 3300005455 Ga0070663_100011540 Ga0070663_1000115405 257
46 3300005539 Ga0068853_100107735 Ga0068853_1001077352 257
47 3300013307 Ga0157372_10075466 Ga0157372_100754663 257
48 3300026067 Ga0207678_10025244 Ga0207678_100252442 257
49 3300003322 rootL2_10029339 rootL2_100293391 259
50 3300005618 Ga0068864_100204652 Ga0068864_1002046522 259
51 3300009553 Ga0105249_10018201 Ga0105249_100182015 260
52 3300013297 Ga0157378_10621912 Ga0157378_106219122 260
53 3300013306 Ga0163162_10004947 Ga0163162_100049477 260
54 3300014968 Ga0157379_10010814 Ga0157379_100108146 260
55 3300025961 Ga0207712_10186980 Ga0207712_101869802 260
56 3300026088 Ga0207641_10062609 Ga0207641_100626093 260
57 3300005356 Ga0070674_100094711 Ga0070674_1000947112 263
58 3300005459 Ga0068867_100127911 Ga0068867_1001279112 263
59 3300031251 Ga0265327_10008788 Ga0265327_100087887 263
60 3300049570 Ga0501033_0193974 Ga0501033_0193974_447_1286 263
61 3300005329 Ga0070683_100002680 Ga0070683_1000026805 264
62 3300005334 Ga0068869_100009791 Ga0068869_1000097916 264
63 3300005340 Ga0070689_100016085 Ga0070689_1000160855 264
64 3300005344 Ga0070661_100011314 Ga0070661_1000113141 264
65 3300005354 Ga0070675_100007564 Ga0070675_1000075643 264
66 3300005457 Ga0070662_100032353 Ga0070662_1000323532 264
67 3300005535 Ga0070684_100000691 Ga0070684_10000069118 264
68 3300005543 Ga0070672_100116324 Ga0070672_1001163242 264
69 3300005564 Ga0070664_100008919 Ga0070664_1000089194 264
70 3300005577 Ga0068857_100047109 Ga0068857_1000471094 264
71 3300005616 Ga0068852_100172277 Ga0068852_1001722772 264
72 3300005617 Ga0068859_100073541 Ga0068859_1000735414 264
73 3300005618 Ga0068864_100026088 Ga0068864_1000260882 264
74 3300006931 Ga0097620_100073539 Ga0097620_1000735394 264
75 3300013296 Ga0157374_10058591 Ga0157374_100585913 264
76 3300013308 Ga0157375_10072442 Ga0157375_100724424 264
77 3300014325 Ga0163163_10000652 Ga0163163_100006529 264
78 3300017792 Ga0163161_10133797 Ga0163161_101337971 264
79 3300025912 Ga0207707_10062528 Ga0207707_100625282 265
80 3300025920 Ga0207649_10022160 Ga0207649_100221602 265
81 3300025926 Ga0207659_10108820 Ga0207659_101088203 265
82 3300025933 Ga0207706_10005151 Ga0207706_100051514 265
83 3300025936 Ga0207670_10019840 Ga0207670_100198404 265
84 3300025940 Ga0207691_10027251 Ga0207691_100272512 265
85 3300025942 Ga0207689_10003428 Ga0207689_100034286 265
86 3300026095 Ga0207676_10007197 Ga0207676_100071976 265
87 3300026116 Ga0207674_10004986 Ga0207674_100049866 265
88 3300028380 Ga0268265_10190478 Ga0268265_101904782 265
89 3300048913 Ga0496110_0292722 Ga0496110_0292722_301_1134 265
90 3300003320 rootH2_10312659 rootH2_103126592 267
91 3300005293 Ga0065715_10198648 Ga0065715_101986481 267
92 3300005353 Ga0070669_100530863 Ga0070669_1005308631 267
93 3300005354 Ga0070675_100023643 Ga0070675_1000236434 267
94 3300005356 Ga0070674_100046034 Ga0070674_1000460342 267
95 3300005364 Ga0070673_100005056 Ga0070673_1000050566 267
96 3300005459 Ga0068867_100141790 Ga0068867_1001417902 267
97 3300005543 Ga0070672_100047011 Ga0070672_1000470112 267
98 3300013308 Ga0157375_10035028 Ga0157375_100350284 267
99 3300025315 Ga0207697_10087786 Ga0207697_100877862 267
100 3300025926 Ga0207659_10024330 Ga0207659_100243302 267
101 3300025940 Ga0207691_10003616 Ga0207691_100036165 267
102 3300025960 Ga0207651_10030074 Ga0207651_100300742 267
103 3300025972 Ga0207668_10082475 Ga0207668_100824751 267
104 3300026089 Ga0207648_10055993 Ga0207648_100559932 267
105 3300005331 Ga0070670_100537251 Ga0070670_1005372511 268
106 3300005355 Ga0070671_100341663 Ga0070671_1003416631 268
107 3300006237 Ga0097621_100383067 Ga0097621_1003830672 268
108 3300006358 Ga0068871_100224983 Ga0068871_1002249831 268
109 3300017792 Ga0163161_10291138 Ga0163161_102911381 268
110 3300014325 Ga0163163_10000488 Ga0163163_1000048821 269
111 3300003323 rootH1_10008400 rootH1_1000840012 270
112 3300013306 Ga0163162_10033370 Ga0163162_100333702 270
113 3300013308 Ga0157375_10087008 Ga0157375_100870082 270
114 3300042007 Ga0439449_0014818 Ga0439449_0014818_460_1284 270
115 3300049705 Ga0501225_0006676 Ga0501225_0006676_1346_2170 270
116 3300031251 Ga0265327_10000031 Ga0265327_10000031255 271
117 3300035725 Ga0373947_0266631 Ga0373947_0266631_28_945 271
118 iso_pu_bacteria 2738541278 2738727129 271
119 3300025933 Ga0207706_10120306 Ga0207706_101203061 272
120 3300025936 Ga0207670_10052478 Ga0207670_100524783 272
121 3300026095 Ga0207676_10188476 Ga0207676_101884761 272
122 3300049573 Ga0501037_0462791 Ga0501037_0462791_15_833 272
123 3300005337 Ga0070682_100206162 Ga0070682_1002061622 273
124 3300005354 Ga0070675_100658781 Ga0070675_1006587811 273
125 3300006358 Ga0068871_100210623 Ga0068871_1002106233 273
126 3300005339 Ga0070660_100000327 Ga0070660_1000003276 274
127 3300005339 Ga0070660_100211251 Ga0070660_1002112512 274
128 3300005366 Ga0070659_100038184 Ga0070659_1000381844 274
129 3300005563 Ga0068855_100016129 Ga0068855_10001612913 274
130 3300005614 Ga0068856_100544066 Ga0068856_1005440661 274
131 3300013100 Ga0157373_10003686 Ga0157373_100036863 274
132 3300013102 Ga0157371_10002613 Ga0157371_1000261310 274
133 3300013102 Ga0157371_10005272 Ga0157371_1000527214 274
134 3300013104 Ga0157370_10057181 Ga0157370_100571813 274
135 3300013307 Ga0157372_10076436 Ga0157372_100764366 274
136 3300013307 Ga0157372_10084008 Ga0157372_100840083 274
137 3300025909 Ga0207705_10470291 Ga0207705_104702911 274
138 3300025919 Ga0207657_10000716 Ga0207657_100007165 274
139 3300025919 Ga0207657_10167430 Ga0207657_101674302 274
140 3300025932 Ga0207690_10024559 Ga0207690_100245592 274
141 3300026088 Ga0207641_10570884 Ga0207641_105708841 274
142 3300037312 Ga0395899_0030820 Ga0395899_0030820_2410_3249 274
143 3300037418 Ga0395900_0069508 Ga0395900_0069508_1753_2592 274
144 3300037418 Ga0395900_0199124 Ga0395900_0199124_405_1244 274
145 3300037418 Ga0395900_0572737 Ga0395900_0572737_78_917 274
146 3300037466 Ga0395898_0038646 Ga0395898_0038646_2410_3249 274
147 3300037466 Ga0395898_0079886 Ga0395898_0079886_403_1242 274
148 3300037471 Ga0395905_0563600 Ga0395905_0563600_51_890 274
149 3300038443 Ga0395901_0040340 Ga0395901_0040340_404_1243 274
150 3300038443 Ga0395901_0049443 Ga0395901_0049443_911_1750 274
151 3300049823 Ga0501044_0106568 Ga0501044_0106568_1928_2767 274
152 3300053139 Ga0500568_0003080 Ga0500568_0003080_1713_2558 274
153 3300041413 Ga0439465_0075074 Ga0439465_0075074_101_937 275
154 3300042007 Ga0439449_0084782 Ga0439449_0084782_77_913 275
155 3300049589 Ga0501073_0125168 Ga0501073_0125168_115_951 275
156 3300053156 Ga0500622_0000110 Ga0500622_0000110_11399_12235 275
157 3300001979 JGI24740J21852_10001007 JGI24740J21852_100010072 276
158 3300003203 JGI25406J46586_10002945 JGI25406J46586_100029452 276
159 3300003322 rootL2_10276368 rootL2_102763683 276
160 3300003794 Ga0055531_10000023 Ga0055531_10000023104 276
161 3300005288 Ga0065714_10174544 Ga0065714_101745441 276
162 3300005290 Ga0065712_10085825 Ga0065712_100858253 276
163 3300005290 Ga0065712_10095409 Ga0065712_100954092 276
164 3300005295 Ga0065707_10115452 Ga0065707_101154521 276
165 3300005328 Ga0070676_10009137 Ga0070676_100091374 276
166 3300005328 Ga0070676_10033550 Ga0070676_100335502 276
167 3300005331 Ga0070670_100176756 Ga0070670_1001767562 276
168 3300005331 Ga0070670_100222387 Ga0070670_1002223872 276
169 3300005333 Ga0070677_10052759 Ga0070677_100527592 276
170 3300005334 Ga0068869_100040088 Ga0068869_1000400883 276
171 3300005334 Ga0068869_100330141 Ga0068869_1003301411 276
172 3300005334 Ga0068869_100376457 Ga0068869_1003764571 276
173 3300005335 Ga0070666_10012219 Ga0070666_100122192 276
174 3300005347 Ga0070668_100041743 Ga0070668_1000417431 276
175 3300005347 Ga0070668_100067191 Ga0070668_1000671912 276
176 3300005353 Ga0070669_100173806 Ga0070669_1001738061 276
177 3300005353 Ga0070669_100235893 Ga0070669_1002358931 276
178 3300005354 Ga0070675_100003139 Ga0070675_1000031395 276
179 3300005354 Ga0070675_100042804 Ga0070675_1000428042 276
180 3300005356 Ga0070674_100019811 Ga0070674_1000198113 276
181 3300005364 Ga0070673_100029290 Ga0070673_1000292902 276
182 3300005364 Ga0070673_100129431 Ga0070673_1001294312 276
183 3300005365 Ga0070688_100034086 Ga0070688_1000340862 276
184 3300005366 Ga0070659_100232943 Ga0070659_1002329431 276
185 3300005367 Ga0070667_100138120 Ga0070667_1001381202 276
186 3300005367 Ga0070667_100142983 Ga0070667_1001429832 276
187 3300005440 Ga0070705_100164596 Ga0070705_1001645961 276
188 3300005456 Ga0070678_100001368 Ga0070678_10000136811 276
189 3300005457 Ga0070662_100066556 Ga0070662_1000665562 276
190 3300005539 Ga0068853_100042161 Ga0068853_1000421612 276
191 3300005543 Ga0070672_100120148 Ga0070672_1001201482 276
192 3300005543 Ga0070672_100379339 Ga0070672_1003793391 276
193 3300005548 Ga0070665_100040137 Ga0070665_1000401373 276
194 3300005617 Ga0068859_100056013 Ga0068859_1000560132 276
195 3300005617 Ga0068859_100069122 Ga0068859_1000691225 276
196 3300005617 Ga0068859_100083107 Ga0068859_1000831074 276
197 3300005618 Ga0068864_100378078 Ga0068864_1003780782 276
198 3300005719 Ga0068861_100074300 Ga0068861_1000743002 276
199 3300005719 Ga0068861_100114157 Ga0068861_1001141571 276
200 3300005840 Ga0068870_10021012 Ga0068870_100210123 276
201 3300005841 Ga0068863_100159561 Ga0068863_1001595612 276
202 3300005842 Ga0068858_100509511 Ga0068858_1005095111 276
203 3300005843 Ga0068860_100113004 Ga0068860_1001130043 276
204 3300005843 Ga0068860_100251349 Ga0068860_1002513492 276
205 3300005843 Ga0068860_100324285 Ga0068860_1003242852 276
206 3300005843 Ga0068860_100474770 Ga0068860_1004747702 276
207 3300005844 Ga0068862_100001959 Ga0068862_10000195910 276
208 3300005844 Ga0068862_100502331 Ga0068862_1005023311 276
209 3300005844 Ga0068862_100670242 Ga0068862_1006702421 276
210 3300005985 Ga0081539_10000223 Ga0081539_10000223102 276
211 3300006195 Ga0075366_10026063 Ga0075366_100260632 276
212 3300006237 Ga0097621_100018040 Ga0097621_1000180405 276
213 3300006237 Ga0097621_100402589 Ga0097621_1004025892 276
214 3300006358 Ga0068871_100005350 Ga0068871_1000053506 276
215 3300006358 Ga0068871_100196492 Ga0068871_1001964923 276
216 3300006358 Ga0068871_100365264 Ga0068871_1003652641 276
217 3300006881 Ga0068865_100035886 Ga0068865_1000358862 276
218 3300006881 Ga0068865_100414308 Ga0068865_1004143081 276
219 3300006931 Ga0097620_100056011 Ga0097620_1000560112 276
220 3300006931 Ga0097620_100069122 Ga0097620_1000691225 276
221 3300006931 Ga0097620_100083107 Ga0097620_1000831074 276
222 3300009094 Ga0111539_10004437 Ga0111539_100044375 276
223 3300009101 Ga0105247_10001854 Ga0105247_100018545 276
224 3300009148 Ga0105243_10175891 Ga0105243_101758912 276
225 3300009176 Ga0105242_10107033 Ga0105242_101070332 276
226 3300009545 Ga0105237_10579076 Ga0105237_105790762 276
227 3300009553 Ga0105249_10032022 Ga0105249_100320222 276
228 3300009553 Ga0105249_10041703 Ga0105249_100417032 276
229 3300009553 Ga0105249_10125066 Ga0105249_101250662 276
230 3300009553 Ga0105249_10153748 Ga0105249_101537482 276
231 3300009553 Ga0105249_10262884 Ga0105249_102628842 276
232 3300011119 Ga0105246_10247782 Ga0105246_102477821 276
233 3300011119 Ga0105246_10321066 Ga0105246_103210662 276
234 3300013104 Ga0157370_10016745 Ga0157370_100167454 276
235 3300013296 Ga0157374_10098136 Ga0157374_100981362 276
236 3300013297 Ga0157378_10353834 Ga0157378_103538341 276
237 3300013306 Ga0163162_10134704 Ga0163162_101347042 276
238 3300013308 Ga0157375_10013870 Ga0157375_100138708 276
239 3300013308 Ga0157375_10551459 Ga0157375_105514591 276
240 3300013308 Ga0157375_10695079 Ga0157375_106950792 276
241 3300014325 Ga0163163_10239120 Ga0163163_102391202 276
242 3300014326 Ga0157380_10007645 Ga0157380_100076452 276
243 3300014326 Ga0157380_10237781 Ga0157380_102377812 276
244 3300014745 Ga0157377_10135524 Ga0157377_101355242 276
245 3300025297 Ga0209758_1004203 Ga0209758_10042038 276
246 3300025302 Ga0207426_1000562 Ga0207426_100056224 276
247 3300025304 Ga0209257_1000013 Ga0209257_1000013544 276
248 3300025893 Ga0207682_10014067 Ga0207682_100140671 276
249 3300025893 Ga0207682_10099465 Ga0207682_100994651 276
250 3300025900 Ga0207710_10000652 Ga0207710_100006527 276
251 3300025901 Ga0207688_10015054 Ga0207688_100150544 276
252 3300025903 Ga0207680_10031078 Ga0207680_100310782 276
253 3300025904 Ga0207647_10153615 Ga0207647_101536152 276
254 3300025907 Ga0207645_10010099 Ga0207645_100100996 276
255 3300025907 Ga0207645_10086897 Ga0207645_100868972 276
256 3300025907 Ga0207645_10116440 Ga0207645_101164402 276
257 3300025908 Ga0207643_10004981 Ga0207643_100049816 276
258 3300025908 Ga0207643_10015733 Ga0207643_100157333 276
259 3300025908 Ga0207643_10032156 Ga0207643_100321562 276
260 3300025923 Ga0207681_10002255 Ga0207681_100022558 276
261 3300025923 Ga0207681_10252511 Ga0207681_102525112 276
262 3300025925 Ga0207650_10154223 Ga0207650_101542231 276
263 3300025926 Ga0207659_10098356 Ga0207659_100983561 276
264 3300025933 Ga0207706_10074299 Ga0207706_100742992 276
265 3300025934 Ga0207686_10196944 Ga0207686_101969442 276
266 3300025934 Ga0207686_10237910 Ga0207686_102379102 276
267 3300025934 Ga0207686_10337909 Ga0207686_103379091 276
268 3300025935 Ga0207709_10147020 Ga0207709_101470202 276
269 3300025936 Ga0207670_10154357 Ga0207670_101543571 276
270 3300025938 Ga0207704_10044288 Ga0207704_100442881 276
271 3300025938 Ga0207704_10198207 Ga0207704_101982071 276
272 3300025942 Ga0207689_10013384 Ga0207689_100133842 276
273 3300025942 Ga0207689_10234728 Ga0207689_102347282 276
274 3300025945 Ga0207679_10228283 Ga0207679_102282832 276
275 3300025960 Ga0207651_10015249 Ga0207651_100152494 276
276 3300025961 Ga0207712_10066183 Ga0207712_100661832 276
277 3300025972 Ga0207668_10121728 Ga0207668_101217282 276
278 3300025986 Ga0207658_10020159 Ga0207658_100201593 276
279 3300025986 Ga0207658_10201441 Ga0207658_102014411 276
280 3300025986 Ga0207658_10434197 Ga0207658_104341971 276
281 3300026035 Ga0207703_10391357 Ga0207703_103913571 276
282 3300026035 Ga0207703_10681454 Ga0207703_106814541 276
283 3300026041 Ga0207639_10032009 Ga0207639_100320094 276
284 3300026089 Ga0207648_10026755 Ga0207648_100267555 276
285 3300026089 Ga0207648_10030735 Ga0207648_100307352 276
286 3300026095 Ga0207676_10519350 Ga0207676_105193501 276
287 3300026118 Ga0207675_100002004 Ga0207675_1000020046 276
288 3300026118 Ga0207675_100042653 Ga0207675_1000426532 276
289 3300026121 Ga0207683_10004176 Ga0207683_100041767 276
290 3300027907 Ga0207428_10035895 Ga0207428_100358952 276
291 3300028380 Ga0268265_10006107 Ga0268265_100061075 276
292 3300028380 Ga0268265_10199159 Ga0268265_101991591 276
293 3300028380 Ga0268265_10306092 Ga0268265_103060922 276
294 3300028381 Ga0268264_10034390 Ga0268264_100343904 276
295 3300028381 Ga0268264_10133399 Ga0268264_101333992 276
296 3300028381 Ga0268264_10246641 Ga0268264_102466413 276
297 3300031824 Ga0307413_10110731 Ga0307413_101107313 276
298 3300032004 Ga0307414_10320599 Ga0307414_103205992 276
299 3300032126 Ga0307415_100498524 Ga0307415_1004985241 276
300 3300042435 Ga0439434_0035748 Ga0439434_0035748_138_974 276
301 3300044842 Ga0466957_0002726 Ga0466957_0002726_2789_3631 276
302 3300046522 Ga0495643_0013690 Ga0495643_0013690_1336_2181 276
303 3300047320 Ga0495672_0003113 Ga0495672_0003113_10458_11288 276
304 3300047472 Ga0495686_0016555 Ga0495686_0016555_686_1525 276
305 3300047472 Ga0495686_0064587 Ga0495686_0064587_321_1160 276
306 3300048904 Ga0496101_0116598 Ga0496101_0116598_897_1739 276
307 3300049708 Ga0501245_011720 Ga0501245_011720_291_1124 276
308 3300049744 Ga0501083_0151337 Ga0501083_0151337_25_864 276
309 3300049758 Ga0501241_002826 Ga0501241_002826_1854_2696 276
310 3300050493 nmdc:mga0k408_51102_c1 nmdc:mga0k408_51102_c1_1222_2052 276
311 3300050511 nmdc:mga08y16_30416_c1 nmdc:mga08y16_30416_c1_2335_3180 276
312 3300053090 Ga0500646_0050936 Ga0500646_0050936_38_877 276
313 3300053727 Ga0500611_000031 Ga0500611_000031_19705_20535 276
314 3300000043 ARcpr5yngRDRAFT_c005374 ARcpr5yngRDRAFT_0053742 277
315 3300003322 rootL2_10056830 rootL2_100568302 277
316 3300005328 Ga0070676_10048164 Ga0070676_100481642 277
317 3300005328 Ga0070676_10145337 Ga0070676_101453372 277
318 3300005329 Ga0070683_100000423 Ga0070683_10000042312 277
319 3300005329 Ga0070683_100331386 Ga0070683_1003313862 277
320 3300005330 Ga0070690_100005732 Ga0070690_1000057324 277
321 3300005334 Ga0068869_100342650 Ga0068869_1003426502 277
322 3300005335 Ga0070666_10071587 Ga0070666_100715872 277
323 3300005336 Ga0070680_100001198 Ga0070680_1000011986 277
324 3300005337 Ga0070682_100002561 Ga0070682_1000025615 277
325 3300005338 Ga0068868_100002364 Ga0068868_1000023648 277
326 3300005338 Ga0068868_100032976 Ga0068868_1000329765 277
327 3300005338 Ga0068868_100080443 Ga0068868_1000804433 277
328 3300005339 Ga0070660_100075730 Ga0070660_1000757301 277
329 3300005339 Ga0070660_100231904 Ga0070660_1002319042 277
330 3300005339 Ga0070660_100520406 Ga0070660_1005204061 277
331 3300005341 Ga0070691_10002873 Ga0070691_100028735 277
332 3300005341 Ga0070691_10048182 Ga0070691_100481822 277
333 3300005344 Ga0070661_100017005 Ga0070661_1000170053 277
334 3300005354 Ga0070675_100096796 Ga0070675_1000967962 277
335 3300005355 Ga0070671_100180369 Ga0070671_1001803692 277
336 3300005365 Ga0070688_100523708 Ga0070688_1005237081 277
337 3300005366 Ga0070659_100001674 Ga0070659_1000016746 277
338 3300005367 Ga0070667_100005006 Ga0070667_1000050066 277
339 3300005456 Ga0070678_100085913 Ga0070678_1000859132 277
340 3300005457 Ga0070662_100016747 Ga0070662_1000167472 277
341 3300005457 Ga0070662_100139539 Ga0070662_1001395392 277
342 3300005458 Ga0070681_10011430 Ga0070681_100114303 277
343 3300005459 Ga0068867_100006548 Ga0068867_1000065483 277
344 3300005530 Ga0070679_100002375 Ga0070679_10000237510 277
345 3300005535 Ga0070684_100001012 Ga0070684_1000010124 277
346 3300005535 Ga0070684_100065373 Ga0070684_1000653733 277
347 3300005539 Ga0068853_100000097 Ga0068853_10000009718 277
348 3300005539 Ga0068853_100102747 Ga0068853_1001027472 277
349 3300005547 Ga0070693_100003469 Ga0070693_1000034693 277
350 3300005563 Ga0068855_100024468 Ga0068855_1000244686 277
351 3300005563 Ga0068855_100205955 Ga0068855_1002059552 277
352 3300005564 Ga0070664_100000142 Ga0070664_10000014237 277
353 3300005564 Ga0070664_100111973 Ga0070664_1001119732 277
354 3300005564 Ga0070664_100277601 Ga0070664_1002776012 277
355 3300005577 Ga0068857_100010293 Ga0068857_1000102937 277
356 3300005616 Ga0068852_100161117 Ga0068852_1001611173 277
357 3300005617 Ga0068859_100142712 Ga0068859_1001427122 277
358 3300005618 Ga0068864_100088070 Ga0068864_1000880702 277
359 3300005841 Ga0068863_100043551 Ga0068863_1000435511 277
360 3300005841 Ga0068863_100085740 Ga0068863_1000857403 277
361 3300005842 Ga0068858_100215905 Ga0068858_1002159051 277
362 3300005842 Ga0068858_100232315 Ga0068858_1002323152 277
363 3300005843 Ga0068860_100024330 Ga0068860_1000243302 277
364 3300005843 Ga0068860_100086632 Ga0068860_1000866322 277
365 3300006237 Ga0097621_100291222 Ga0097621_1002912222 277
366 3300006871 Ga0075434_100349461 Ga0075434_1003494611 277
367 3300006881 Ga0068865_100069099 Ga0068865_1000690993 277
368 3300006931 Ga0097620_100142715 Ga0097620_1001427152 277
369 3300007076 Ga0075435_100439706 Ga0075435_1004397062 277
370 3300009093 Ga0105240_10003179 Ga0105240_100031795 277
371 3300009101 Ga0105247_10161615 Ga0105247_101616151 277
372 3300009147 Ga0114129_10003132 Ga0114129_1000313212 277
373 3300009174 Ga0105241_10001894 Ga0105241_1000189410 277
374 3300009174 Ga0105241_10320592 Ga0105241_103205921 277
375 3300009176 Ga0105242_10256168 Ga0105242_102561681 277
376 3300010375 Ga0105239_10162226 Ga0105239_101622261 277
377 3300013100 Ga0157373_10131443 Ga0157373_101314431 277
378 3300013102 Ga0157371_10100240 Ga0157371_101002402 277
379 3300013102 Ga0157371_10109674 Ga0157371_101096742 277
380 3300013104 Ga0157370_10003505 Ga0157370_1000350510 277
381 3300013296 Ga0157374_10044715 Ga0157374_100447153 277
382 3300013296 Ga0157374_10047048 Ga0157374_100470483 277
383 3300013297 Ga0157378_10002018 Ga0157378_1000201819 277
384 3300013297 Ga0157378_10040760 Ga0157378_100407603 277
385 3300013297 Ga0157378_10122119 Ga0157378_101221192 277
386 3300013297 Ga0157378_10153519 Ga0157378_101535192 277
387 3300013306 Ga0163162_10005423 Ga0163162_100054237 277
388 3300013307 Ga0157372_10125821 Ga0157372_101258212 277
389 3300013307 Ga0157372_10490330 Ga0157372_104903302 277
390 3300013308 Ga0157375_10033998 Ga0157375_100339983 277
391 3300014325 Ga0163163_10084622 Ga0163163_100846224 277
392 3300014325 Ga0163163_10540834 Ga0163163_105408341 277
393 3300014326 Ga0157380_10065686 Ga0157380_100656863 277
394 3300014745 Ga0157377_10024518 Ga0157377_100245183 277
395 3300014968 Ga0157379_10022758 Ga0157379_100227582 277
396 3300014969 Ga0157376_10018053 Ga0157376_100180532 277
397 3300025899 Ga0207642_10042814 Ga0207642_100428143 277
398 3300025900 Ga0207710_10147480 Ga0207710_101474802 277
399 3300025907 Ga0207645_10005287 Ga0207645_100052878 277
400 3300025911 Ga0207654_10001235 Ga0207654_1000123510 277
401 3300025912 Ga0207707_10000449 Ga0207707_1000044925 277
402 3300025913 Ga0207695_10017744 Ga0207695_100177443 277
403 3300025919 Ga0207657_10172717 Ga0207657_101727172 277
404 3300025920 Ga0207649_10001717 Ga0207649_100017173 277
405 3300025921 Ga0207652_10004718 Ga0207652_100047185 277
406 3300025925 Ga0207650_10100326 Ga0207650_101003262 277
407 3300025931 Ga0207644_10197090 Ga0207644_101970902 277
408 3300025931 Ga0207644_10211048 Ga0207644_102110482 277
409 3300025931 Ga0207644_10375212 Ga0207644_103752121 277
410 3300025932 Ga0207690_10254947 Ga0207690_102549472 277
411 3300025933 Ga0207706_10043838 Ga0207706_100438384 277
412 3300025933 Ga0207706_10053903 Ga0207706_100539032 277
413 3300025937 Ga0207669_10034897 Ga0207669_100348972 277
414 3300025938 Ga0207704_10144079 Ga0207704_101440792 277
415 3300025942 Ga0207689_10350855 Ga0207689_103508552 277
416 3300025944 Ga0207661_10000710 Ga0207661_100007109 277
417 3300025945 Ga0207679_10000408 Ga0207679_1000040810 277
418 3300025945 Ga0207679_10263109 Ga0207679_102631092 277
419 3300025949 Ga0207667_10113553 Ga0207667_101135533 277
420 3300025960 Ga0207651_10160245 Ga0207651_101602452 277
421 3300025981 Ga0207640_10559089 Ga0207640_105590891 277
422 3300025986 Ga0207658_10117466 Ga0207658_101174661 277
423 3300025986 Ga0207658_10185065 Ga0207658_101850652 277
424 3300026023 Ga0207677_10007017 Ga0207677_100070174 277
425 3300026023 Ga0207677_10008637 Ga0207677_100086374 277
426 3300026023 Ga0207677_10278247 Ga0207677_102782471 277
427 3300026041 Ga0207639_10002038 Ga0207639_100020389 277
428 3300026067 Ga0207678_10115826 Ga0207678_101158262 277
429 3300026088 Ga0207641_10034790 Ga0207641_100347902 277
430 3300026089 Ga0207648_10020340 Ga0207648_100203405 277
431 3300026089 Ga0207648_10367638 Ga0207648_103676381 277
432 3300026116 Ga0207674_10169867 Ga0207674_101698672 277
433 3300026116 Ga0207674_10403057 Ga0207674_104030572 277
434 3300026121 Ga0207683_10042167 Ga0207683_100421673 277
435 3300028381 Ga0268264_10026579 Ga0268264_100265792 277
436 3300030521 Ga0307511_10005062 Ga0307511_1000506210 277
437 3300031456 Ga0307513_10046322 Ga0307513_100463225 277
438 3300031507 Ga0307509_10134640 Ga0307509_101346402 277
439 3300031616 Ga0307508_10000923 Ga0307508_1000092326 277
440 3300031731 Ga0307405_10185962 Ga0307405_101859621 277
441 3300031824 Ga0307413_10261997 Ga0307413_102619971 277
442 3300031852 Ga0307410_10132971 Ga0307410_101329711 277
443 3300032002 Ga0307416_100148598 Ga0307416_1001485982 277
444 3300032005 Ga0307411_10044571 Ga0307411_100445711 277
445 3300032126 Ga0307415_100291895 Ga0307415_1002918952 277
446 3300035724 Ga0373933_0033678 Ga0373933_0033678_1089_1922 277
447 3300036401 Ga0373937_0021441 Ga0373937_0021441_2148_2981 277
448 3300038443 Ga0395901_0587851 Ga0395901_0587851_141_1043 277
449 3300041509 Ga0451843_1500914 Ga0451843_1500914_149_982 277
450 3300041999 Ga0439433_0004931 Ga0439433_0004931_650_1486 277
451 3300042007 Ga0439449_0002640 Ga0439449_0002640_4563_5399 277
452 3300042015 Ga0439462_0028350 Ga0439462_0028350_622_1458 277
453 3300044901 Ga0466960_0248773 Ga0466960_0248773_123_962 277
454 3300046516 Ga0495628_0009804 Ga0495628_0009804_3547_4380 277
455 3300046517 Ga0495630_0009666 Ga0495630_0009666_1308_2141 277
456 3300046529 Ga0495652_0037370 Ga0495652_0037370_1707_2540 277
457 3300046536 Ga0495587_0066727 Ga0495587_0066727_57_890 277
458 3300046543 Ga0495645_0153481 Ga0495645_0153481_722_1555 277
459 3300046559 Ga0495667_0084341 Ga0495667_0084341_683_1516 277
460 3300046642 Ga0495634_0011993 Ga0495634_0011993_4433_5266 277
461 3300046675 Ga0495657_0038927 Ga0495657_0038927_2051_2884 277
462 3300046694 Ga0495649_0074992 Ga0495649_0074992_804_1637 277
463 3300047317 Ga0495604_0100242 Ga0495604_0100242_1164_1997 277
464 3300047322 Ga0495680_0148764 Ga0495680_0148764_614_1447 277
465 3300049521 Ga0501298_001590 Ga0501298_001590_2200_3036 277
466 3300049568 Ga0501031_0009520 Ga0501031_0009520_4534_5367 277
467 3300049572 Ga0501036_0079314 Ga0501036_0079314_668_1501 277
468 3300049574 Ga0501038_0003678 Ga0501038_0003678_8517_9350 277
469 3300049575 Ga0501039_0008667 Ga0501039_0008667_3758_4591 277
470 3300049579 Ga0501043_0075074 Ga0501043_0075074_203_1039 277
471 3300049581 Ga0501047_0378215 Ga0501047_0378215_217_1050 277
472 3300049583 Ga0501067_0041755 Ga0501067_0041755_1406_2242 277
473 3300049588 Ga0501072_0374565 Ga0501072_0374565_130_963 277
474 3300049589 Ga0501073_0098502 Ga0501073_0098502_227_1063 277
475 3300049651 Ga0501201_000885 Ga0501201_000885_1705_2541 277
476 3300049652 Ga0501202_021000 Ga0501202_021000_379_1215 277
477 3300049662 Ga0501222_005775 Ga0501222_005775_530_1366 277
478 3300049663 Ga0501223_005703 Ga0501223_005703_764_1600 277
479 3300049663 Ga0501223_020859 Ga0501223_020859_144_980 277
480 3300049669 Ga0501235_014029 Ga0501235_014029_726_1562 277
481 3300049673 Ga0501240_010582 Ga0501240_010582_248_1084 277
482 3300049675 Ga0501243_003948 Ga0501243_003948_704_1540 277
483 3300049688 Ga0501259_001100 Ga0501259_001100_1758_2594 277
484 3300049688 Ga0501259_013269 Ga0501259_013269_450_1286 277
485 3300049690 Ga0501261_006403 Ga0501261_006403_534_1370 277
486 3300049704 Ga0501221_002410 Ga0501221_002410_1780_2616 277
487 3300049705 Ga0501225_0007109 Ga0501225_0007109_2259_3095 277
488 3300049708 Ga0501245_001286 Ga0501245_001286_2326_3162 277
489 3300049742 Ga0501080_0492867 Ga0501080_0492867_118_951 277
490 3300049742 Ga0501080_0522921 Ga0501080_0522921_37_873 277
491 3300049744 Ga0501083_0090609 Ga0501083_0090609_342_1178 277
492 3300049758 Ga0501241_022343 Ga0501241_022343_253_1089 277
493 3300049823 Ga0501044_0608498 Ga0501044_0608498_118_954 277
494 3300049851 Ga0501212_005665 Ga0501212_005665_269_1105 277
495 3300050507 nmdc:mga05p37_6756_c1 nmdc:mga05p37_6756_c1_1521_2366 277
496 3300050512 nmdc:mga0n895_17682_c1 nmdc:mga0n895_17682_c1_1928_2761 277
497 3300053085 Ga0495619_0117673 Ga0495619_0117673_561_1394 277
498 3300053146 Ga0500588_0020601 Ga0500588_0020601_844_1677 277
499 3300053153 Ga0500616_0005546 Ga0500616_0005546_1284_2117 277
500 3300054114 Ga0501084_0153034 Ga0501084_0153034_380_1216 277

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11138

DUF2911

Protein of unknown function (DUF2911)

63

208

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.98 195 256
5lyn-assembly1.cif.gz_B structure of the tpr domain of sgt2 in complex with yeast ssa1 peptide fragment 0.9773 195 256
4ja7-assembly1.cif.gz_A rat pp5 co-crystallized with p5sa-2 0.9724 195 258
8fwd-assembly1.cif.gz_0 fast and versatile sequence- independent protein docking for nanomaterials design using rpxdock 0.971 195 256
2vyi-assembly2.cif.gz_B crystal structure of the tpr domain of human sgt 0.969 195 256
ID Description Score Start End Superfamily
af_E7F2R1_574_748_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9889 195 256 1.25.40.10
af_Q54DA8_379_491_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9882 195 256 1.25.40.10
af_Q49AM3_302_415_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9871 195 256 1.25.40.10
af_Q6PGP7_564_723_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9862 195 256 1.25.40.10
af_A0A144A2J9_376_497_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9831 195 256 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A7C1LWV8-F1-model_v4 DUF2911 domain-containing protein 0.9599 72 175
AF-A0A090VRC2-F1-model_v4 DUF2911 domain-containing protein 0.9589 67 174
AF-A0A2V8UUE4-F1-model_v4 DUF2911 domain-containing protein 0.9422 83 175
AF-A0A090VRC2-F1-model_v4 DUF2911 domain-containing protein 0.9418 67 174
AF-A0A7Y4WZA8-F1-model_v4 DUF2911 domain-containing protein 0.9412 28 175

Feature Viewer

pLDDT pTM Quality
89.21 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map