F455508
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 500 | 237 | 499 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300005842|Ga0068858_100509511|Ga0068858_1005095111 |
| Length | 314 |
| Sequence | MFEETLKYSSPSDLLLPSSDLIHQTSDFTIFAQNLFMRKIIFTAIAAIILFTAGAQLKTPAPSPPQTIKQDFGLSAIELSYSRPGMKGRKIFGDLVPYGKIWRTGANNATTITFGDDVIIGGTKVPAGKYGLLTIPDKDNWTLIITKQLDITTNISAYKQDQDAVRVIVNPMKMKESMETFTMQFANIKPTSCELDLMWDNIAVAMPITTDVETKVMAQIDQLMNKDNRPYYNAALYYLENGKDLKQALVWFDKAAEQQPDAYWVQHQRANCLAKLGKKEEAKAAAEKSIALAKTAKNDDYVRLNEKLIAELNK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 151 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 152 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 153 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 154 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 155 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 157 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 160 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 161 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 162 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 172 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 173 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 174 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 175 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 176 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 177 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 178 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 179 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 180 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 197 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 198 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 210 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 211 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 212 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 213 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 214 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 215 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 216 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 217 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 218 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 219 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 221 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 224 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 226 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 227 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 232 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 233 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 234 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 235 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 236 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 237 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.4 |
| Nodule | 0 |
| Rhizoplane | 0.6 |
| Rhizosphere | 94.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5yngRDRAFT_c005374 | 3300000043 | Bacteria | 1182 |
| 2 | JGI24740J21852_10001007 | 3300001979 | Bacteria | 12592 |
| 3 | JGI25406J46586_10002945 | 3300003203 | Bacteria | 8029 |
| 4 | rootH2_10312659 | 3300003320 | Unclassified | 2025 |
| 5 | rootL2_10029339 | 3300003322 | Bacteria | 6434 |
| 6 | rootL2_10056830 | 3300003322 | Unclassified | 2507 |
| 7 | rootL2_10276368 | 3300003322 | Bacteria | 2893 |
| 8 | rootH1_10008400 | 3300003323 | Bacteria | 11999 |
| 9 | Ga0055531_10000023 | 3300003794 | Bacteria | 165025 |
| 10 | Ga0065714_10174544 | 3300005288 | Bacteria | 989 |
| 11 | Ga0065712_10085825 | 3300005290 | Bacteria | 2578 |
| 12 | Ga0065712_10095409 | 3300005290 | Bacteria | 2219 |
| 13 | Ga0065715_10198648 | 3300005293 | Bacteria | 1374 |
| 14 | Ga0065707_10115452 | 3300005295 | Bacteria | 2266 |
| 15 | Ga0070658_10016654 | 3300005327 | Bacteria | 5883 |
| 16 | Ga0070658_10229994 | 3300005327 | Bacteria | 1570 |
| 17 | Ga0070676_10009137 | 3300005328 | Bacteria | 5362 |
| 18 | Ga0070676_10033550 | 3300005328 | Bacteria | 2945 |
| 19 | Ga0070676_10048164 | 3300005328 | Bacteria | 2491 |
| 20 | Ga0070676_10145337 | 3300005328 | Bacteria | 1513 |
| 21 | Ga0070683_100000423 | 3300005329 | Bacteria | 29265 |
| 22 | Ga0070683_100002680 | 3300005329 | Bacteria | 14237 |
| 23 | Ga0070683_100331386 | 3300005329 | Bacteria | 1449 |
| 24 | Ga0070690_100005732 | 3300005330 | Bacteria | 6994 |
| 25 | Ga0070670_100176756 | 3300005331 | Bacteria | 1853 |
| 26 | Ga0070670_100222387 | 3300005331 | Unclassified | 1643 |
| 27 | Ga0070670_100537251 | 3300005331 | Bacteria | 1042 |
| 28 | Ga0070677_10052759 | 3300005333 | Bacteria | 1651 |
| 29 | Ga0068869_100009791 | 3300005334 | Bacteria | 6224 |
| 30 | Ga0068869_100040088 | 3300005334 | Bacteria | 3347 |
| 31 | Ga0068869_100330141 | 3300005334 | Unclassified | 1239 |
| 32 | Ga0068869_100342650 | 3300005334 | Bacteria | 1217 |
| 33 | Ga0068869_100376457 | 3300005334 | Bacteria | 1163 |
| 34 | Ga0070666_10012219 | 3300005335 | Bacteria | 5410 |
| 35 | Ga0070666_10071587 | 3300005335 | Unclassified | 2360 |
| 36 | Ga0070680_100001198 | 3300005336 | Bacteria | 18698 |
| 37 | Ga0070680_100019154 | 3300005336 | Bacteria | 5421 |
| 38 | Ga0070682_100002561 | 3300005337 | Bacteria | 10035 |
| 39 | Ga0070682_100206162 | 3300005337 | Bacteria | 1390 |
| 40 | Ga0068868_100002364 | 3300005338 | Bacteria | 13055 |
| 41 | Ga0068868_100032976 | 3300005338 | Unclassified | 3988 |
| 42 | Ga0068868_100080443 | 3300005338 | Bacteria | 2611 |
| 43 | Ga0070660_100000327 | 3300005339 | Bacteria | 31340 |
| 44 | Ga0070660_100075730 | 3300005339 | Bacteria | 2635 |
| 45 | Ga0070660_100211251 | 3300005339 | Unclassified | 1576 |
| 46 | Ga0070660_100231904 | 3300005339 | Unclassified | 1502 |
| 47 | Ga0070660_100520406 | 3300005339 | Bacteria | 991 |
| 48 | Ga0070689_100016085 | 3300005340 | Bacteria | 5472 |
| 49 | Ga0070691_10002873 | 3300005341 | Bacteria | 7715 |
| 50 | Ga0070691_10048182 | 3300005341 | Unclassified | 2027 |
| 51 | Ga0070661_100011314 | 3300005344 | Bacteria | 6217 |
| 52 | Ga0070661_100017005 | 3300005344 | Bacteria | 5152 |
| 53 | Ga0070668_100041743 | 3300005347 | Bacteria | 3515 |
| 54 | Ga0070668_100067191 | 3300005347 | Unclassified | 2784 |
| 55 | Ga0070669_100173806 | 3300005353 | Unclassified | 1681 |
| 56 | Ga0070669_100235893 | 3300005353 | Unclassified | 1451 |
| 57 | Ga0070669_100530863 | 3300005353 | Bacteria | 979 |
| 58 | Ga0070675_100003139 | 3300005354 | Bacteria | 12498 |
| 59 | Ga0070675_100007564 | 3300005354 | Bacteria | 8404 |
| 60 | Ga0070675_100023643 | 3300005354 | Bacteria | 4916 |
| 61 | Ga0070675_100042804 | 3300005354 | Bacteria | 3701 |
| 62 | Ga0070675_100096796 | 3300005354 | Bacteria | 2480 |
| 63 | Ga0070675_100658781 | 3300005354 | Bacteria | 952 |
| 64 | Ga0070671_100180369 | 3300005355 | Unclassified | 1787 |
| 65 | Ga0070671_100341663 | 3300005355 | Unclassified | 1277 |
| 66 | Ga0070674_100019811 | 3300005356 | Bacteria | 4282 |
| 67 | Ga0070674_100046034 | 3300005356 | Unclassified | 2983 |
| 68 | Ga0070674_100094711 | 3300005356 | Bacteria | 2163 |
| 69 | Ga0070673_100005056 | 3300005364 | Bacteria | 8412 |
| 70 | Ga0070673_100029290 | 3300005364 | Bacteria | 4105 |
| 71 | Ga0070673_100129431 | 3300005364 | Unclassified | 2116 |
| 72 | Ga0070688_100034086 | 3300005365 | Bacteria | 3081 |
| 73 | Ga0070688_100523708 | 3300005365 | Bacteria | 897 |
| 74 | Ga0070659_100001674 | 3300005366 | Bacteria | 15927 |
| 75 | Ga0070659_100038184 | 3300005366 | Bacteria | 3745 |
| 76 | Ga0070659_100232943 | 3300005366 | Unclassified | 1522 |
| 77 | Ga0070667_100005006 | 3300005367 | Bacteria | 11092 |
| 78 | Ga0070667_100138120 | 3300005367 | Bacteria | 2132 |
| 79 | Ga0070667_100142983 | 3300005367 | Unclassified | 2096 |
| 80 | Ga0070705_100164596 | 3300005440 | Bacteria | 1486 |
| 81 | Ga0070663_100011540 | 3300005455 | Bacteria | 5552 |
| 82 | Ga0070663_100087979 | 3300005455 | Bacteria | 2296 |
| 83 | Ga0070678_100001368 | 3300005456 | Bacteria | 12967 |
| 84 | Ga0070678_100085913 | 3300005456 | Unclassified | 2398 |
| 85 | Ga0070662_100016747 | 3300005457 | Bacteria | 4926 |
| 86 | Ga0070662_100032353 | 3300005457 | Bacteria | 3675 |
| 87 | Ga0070662_100066556 | 3300005457 | Unclassified | 2643 |
| 88 | Ga0070662_100139539 | 3300005457 | Bacteria | 1877 |
| 89 | Ga0070681_10011430 | 3300005458 | Bacteria | 8786 |
| 90 | Ga0070681_10092257 | 3300005458 | Bacteria | 2977 |
| 91 | Ga0070681_10566419 | 3300005458 | Bacteria | 1050 |
| 92 | Ga0068867_100006548 | 3300005459 | Bacteria | 8226 |
| 93 | Ga0068867_100127911 | 3300005459 | Bacteria | 1970 |
| 94 | Ga0068867_100141790 | 3300005459 | Bacteria | 1879 |
| 95 | Ga0070679_100002375 | 3300005530 | Bacteria | 17060 |
| 96 | Ga0070679_100008240 | 3300005530 | Bacteria | 9802 |
| 97 | Ga0070679_100029404 | 3300005530 | Bacteria | 5421 |
| 98 | Ga0070684_100000691 | 3300005535 | Bacteria | 23235 |
| 99 | Ga0070684_100001012 | 3300005535 | Bacteria | 20043 |
| 100 | Ga0070684_100065373 | 3300005535 | Unclassified | 3192 |
| 101 | Ga0070684_100142758 | 3300005535 | Bacteria | 2166 |
| 102 | Ga0068853_100000097 | 3300005539 | Bacteria | 59626 |
| 103 | Ga0068853_100042161 | 3300005539 | Bacteria | 3901 |
| 104 | Ga0068853_100102747 | 3300005539 | Bacteria | 2529 |
| 105 | Ga0068853_100107735 | 3300005539 | Bacteria | 2471 |
| 106 | Ga0070672_100047011 | 3300005543 | Bacteria | 3347 |
| 107 | Ga0070672_100116324 | 3300005543 | Unclassified | 2184 |
| 108 | Ga0070672_100120148 | 3300005543 | Bacteria | 2150 |
| 109 | Ga0070672_100379339 | 3300005543 | Bacteria | 1209 |
| 110 | Ga0070693_100003469 | 3300005547 | Bacteria | 7361 |
| 111 | Ga0070665_100040137 | 3300005548 | Bacteria | 4705 |
| 112 | Ga0068855_100003699 | 3300005563 | Bacteria | 18698 |
| 113 | Ga0068855_100016129 | 3300005563 | Bacteria | 8984 |
| 114 | Ga0068855_100024468 | 3300005563 | Bacteria | 7224 |
| 115 | Ga0068855_100205955 | 3300005563 | Unclassified | 2213 |
| 116 | Ga0070664_100000142 | 3300005564 | Bacteria | 49085 |
| 117 | Ga0070664_100008919 | 3300005564 | Bacteria | 8129 |
| 118 | Ga0070664_100111973 | 3300005564 | Bacteria | 2383 |
| 119 | Ga0070664_100277601 | 3300005564 | Unclassified | 1510 |
| 120 | Ga0068857_100010293 | 3300005577 | Bacteria | 8126 |
| 121 | Ga0068857_100047109 | 3300005577 | Bacteria | 3826 |
| 122 | Ga0068856_100544066 | 3300005614 | Bacteria | 1182 |
| 123 | Ga0068852_100161117 | 3300005616 | Bacteria | 2095 |
| 124 | Ga0068852_100172277 | 3300005616 | Bacteria | 2030 |
| 125 | Ga0068859_100056013 | 3300005617 | Bacteria | 3967 |
| 126 | Ga0068859_100069122 | 3300005617 | Bacteria | 3566 |
| 127 | Ga0068859_100073541 | 3300005617 | Bacteria | 3456 |
| 128 | Ga0068859_100083107 | 3300005617 | Bacteria | 3245 |
| 129 | Ga0068859_100142712 | 3300005617 | Bacteria | 2469 |
| 130 | Ga0068864_100026088 | 3300005618 | Bacteria | 4925 |
| 131 | Ga0068864_100088070 | 3300005618 | Bacteria | 2734 |
| 132 | Ga0068864_100204652 | 3300005618 | Bacteria | 1815 |
| 133 | Ga0068864_100378078 | 3300005618 | Bacteria | 1342 |
| 134 | Ga0068861_100074300 | 3300005719 | Bacteria | 2643 |
| 135 | Ga0068861_100114157 | 3300005719 | Bacteria | 2168 |
| 136 | Ga0068870_10021012 | 3300005840 | Unclassified | 3188 |
| 137 | Ga0068863_100043551 | 3300005841 | Bacteria | 4260 |
| 138 | Ga0068863_100085740 | 3300005841 | Bacteria | 2984 |
| 139 | Ga0068863_100159561 | 3300005841 | Bacteria | 2160 |
| 140 | Ga0068858_100215905 | 3300005842 | Bacteria | 1816 |
| 141 | Ga0068858_100232315 | 3300005842 | Unclassified | 1749 |
| 142 | Ga0068858_100509511 | 3300005842 | Bacteria | 1163 |
| 143 | Ga0068860_100024330 | 3300005843 | Bacteria | 5853 |
| 144 | Ga0068860_100086632 | 3300005843 | Unclassified | 2981 |
| 145 | Ga0068860_100113004 | 3300005843 | Bacteria | 2596 |
| 146 | Ga0068860_100251349 | 3300005843 | Bacteria | 1722 |
| 147 | Ga0068860_100324285 | 3300005843 | Bacteria | 1512 |
| 148 | Ga0068860_100474770 | 3300005843 | Bacteria | 1246 |
| 149 | Ga0068862_100001959 | 3300005844 | Bacteria | 18670 |
| 150 | Ga0068862_100502331 | 3300005844 | Unclassified | 1151 |
| 151 | Ga0068862_100670242 | 3300005844 | Bacteria | 1002 |
| 152 | Ga0081539_10000223 | 3300005985 | Bacteria | 133106 |
| 153 | Ga0075366_10026063 | 3300006195 | Bacteria | 3422 |
| 154 | Ga0097621_100018040 | 3300006237 | Bacteria | 5379 |
| 155 | Ga0097621_100291222 | 3300006237 | Bacteria | 1439 |
| 156 | Ga0097621_100383067 | 3300006237 | Bacteria | 1256 |
| 157 | Ga0097621_100402589 | 3300006237 | Bacteria | 1225 |
| 158 | Ga0068871_100005350 | 3300006358 | Bacteria | 8997 |
| 159 | Ga0068871_100196492 | 3300006358 | Bacteria | 1740 |
| 160 | Ga0068871_100210623 | 3300006358 | Bacteria | 1681 |
| 161 | Ga0068871_100224983 | 3300006358 | Unclassified | 1627 |
| 162 | Ga0068871_100365264 | 3300006358 | Unclassified | 1279 |
| 163 | Ga0075434_100349461 | 3300006871 | Unclassified | 1500 |
| 164 | Ga0068865_100035886 | 3300006881 | Bacteria | 3338 |
| 165 | Ga0068865_100069099 | 3300006881 | Unclassified | 2499 |
| 166 | Ga0068865_100414308 | 3300006881 | Bacteria | 1106 |
| 167 | Ga0097620_100056011 | 3300006931 | Bacteria | 3967 |
| 168 | Ga0097620_100069122 | 3300006931 | Bacteria | 3566 |
| 169 | Ga0097620_100073539 | 3300006931 | Bacteria | 3456 |
| 170 | Ga0097620_100083107 | 3300006931 | Bacteria | 3245 |
| 171 | Ga0097620_100142715 | 3300006931 | Bacteria | 2469 |
| 172 | Ga0075435_100439706 | 3300007076 | Unclassified | 1124 |
| 173 | Ga0105240_10003179 | 3300009093 | Bacteria | 25807 |
| 174 | Ga0105240_10281816 | 3300009093 | Bacteria | 1909 |
| 175 | Ga0105240_10843524 | 3300009093 | Unclassified | 990 |
| 176 | Ga0111539_10004437 | 3300009094 | Bacteria | 18334 |
| 177 | Ga0105247_10001854 | 3300009101 | Bacteria | 14787 |
| 178 | Ga0105247_10161615 | 3300009101 | Unclassified | 1483 |
| 179 | Ga0114129_10003132 | 3300009147 | Bacteria | 23207 |
| 180 | Ga0105243_10175891 | 3300009148 | Unclassified | 1857 |
| 181 | Ga0105241_10001894 | 3300009174 | Bacteria | 15861 |
| 182 | Ga0105241_10320592 | 3300009174 | Unclassified | 1336 |
| 183 | Ga0105242_10107033 | 3300009176 | Bacteria | 2378 |
| 184 | Ga0105242_10256168 | 3300009176 | Bacteria | 1579 |
| 185 | Ga0105237_10579076 | 3300009545 | Unclassified | 1129 |
| 186 | Ga0105249_10018201 | 3300009553 | Bacteria | 6245 |
| 187 | Ga0105249_10032022 | 3300009553 | Bacteria | 4756 |
| 188 | Ga0105249_10041703 | 3300009553 | Unclassified | 4173 |
| 189 | Ga0105249_10125066 | 3300009553 | Unclassified | 2448 |
| 190 | Ga0105249_10153748 | 3300009553 | Bacteria | 2217 |
| 191 | Ga0105249_10262884 | 3300009553 | Unclassified | 1716 |
| 192 | Ga0105239_10162226 | 3300010375 | Bacteria | 2498 |
| 193 | Ga0105246_10247782 | 3300011119 | Bacteria | 1412 |
| 194 | Ga0105246_10321066 | 3300011119 | Bacteria | 1258 |
| 195 | Ga0157373_10003686 | 3300013100 | Bacteria | 11585 |
| 196 | Ga0157373_10131443 | 3300013100 | Unclassified | 1760 |
| 197 | Ga0157373_10379492 | 3300013100 | Bacteria | 1011 |
| 198 | Ga0157371_10002613 | 3300013102 | Bacteria | 17094 |
| 199 | Ga0157371_10005272 | 3300013102 | Bacteria | 10955 |
| 200 | Ga0157371_10100240 | 3300013102 | Bacteria | 2054 |
| 201 | Ga0157371_10109674 | 3300013102 | Unclassified | 1959 |
| 202 | Ga0157370_10003505 | 3300013104 | Bacteria | 18395 |
| 203 | Ga0157370_10016434 | 3300013104 | Bacteria | 7492 |
| 204 | Ga0157370_10016745 | 3300013104 | Bacteria | 7417 |
| 205 | Ga0157370_10057181 | 3300013104 | Bacteria | 3710 |
| 206 | Ga0157369_10016679 | 3300013105 | Bacteria | 8257 |
| 207 | Ga0157374_10044715 | 3300013296 | Bacteria | 4093 |
| 208 | Ga0157374_10047048 | 3300013296 | Unclassified | 3998 |
| 209 | Ga0157374_10058591 | 3300013296 | Bacteria | 3599 |
| 210 | Ga0157374_10098136 | 3300013296 | Bacteria | 2804 |
| 211 | Ga0157378_10002018 | 3300013297 | Bacteria | 18170 |
| 212 | Ga0157378_10040760 | 3300013297 | Bacteria | 4119 |
| 213 | Ga0157378_10122119 | 3300013297 | Unclassified | 2402 |
| 214 | Ga0157378_10153519 | 3300013297 | Unclassified | 2147 |
| 215 | Ga0157378_10353834 | 3300013297 | Bacteria | 1435 |
| 216 | Ga0157378_10621912 | 3300013297 | Unclassified | 1093 |
| 217 | Ga0163162_10004947 | 3300013306 | Bacteria | 12840 |
| 218 | Ga0163162_10005423 | 3300013306 | Bacteria | 12326 |
| 219 | Ga0163162_10033370 | 3300013306 | Bacteria | 5115 |
| 220 | Ga0163162_10134704 | 3300013306 | Bacteria | 2581 |
| 221 | Ga0157372_10005839 | 3300013307 | Bacteria | 13108 |
| 222 | Ga0157372_10028977 | 3300013307 | Bacteria | 6040 |
| 223 | Ga0157372_10075466 | 3300013307 | Bacteria | 3804 |
| 224 | Ga0157372_10076436 | 3300013307 | Bacteria | 3780 |
| 225 | Ga0157372_10084008 | 3300013307 | Bacteria | 3607 |
| 226 | Ga0157372_10125821 | 3300013307 | Bacteria | 2947 |
| 227 | Ga0157372_10262999 | 3300013307 | Bacteria | 2004 |
| 228 | Ga0157372_10490330 | 3300013307 | Bacteria | 1433 |
| 229 | Ga0157375_10013870 | 3300013308 | Bacteria | 7185 |
| 230 | Ga0157375_10033998 | 3300013308 | Bacteria | 4852 |
| 231 | Ga0157375_10035028 | 3300013308 | Bacteria | 4788 |
| 232 | Ga0157375_10072442 | 3300013308 | Bacteria | 3462 |
| 233 | Ga0157375_10087008 | 3300013308 | Bacteria | 3176 |
| 234 | Ga0157375_10551459 | 3300013308 | Unclassified | 1314 |
| 235 | Ga0157375_10695079 | 3300013308 | Bacteria | 1171 |
| 236 | Ga0163163_10000488 | 3300014325 | Bacteria | 35858 |
| 237 | Ga0163163_10000652 | 3300014325 | Bacteria | 29704 |
| 238 | Ga0163163_10084622 | 3300014325 | Bacteria | 3178 |
| 239 | Ga0163163_10239120 | 3300014325 | Bacteria | 1865 |
| 240 | Ga0163163_10540834 | 3300014325 | Bacteria | 1227 |
| 241 | Ga0157380_10007645 | 3300014326 | Bacteria | 7684 |
| 242 | Ga0157380_10065686 | 3300014326 | Bacteria | 2917 |
| 243 | Ga0157380_10237781 | 3300014326 | Unclassified | 1640 |
| 244 | Ga0157377_10024518 | 3300014745 | Bacteria | 3207 |
| 245 | Ga0157377_10135524 | 3300014745 | Bacteria | 1508 |
| 246 | Ga0157379_10010814 | 3300014968 | Bacteria | 7958 |
| 247 | Ga0157379_10022758 | 3300014968 | Bacteria | 5553 |
| 248 | Ga0157376_10018053 | 3300014969 | Bacteria | 5397 |
| 249 | Ga0163161_10133797 | 3300017792 | Bacteria | 1872 |
| 250 | Ga0163161_10291138 | 3300017792 | Bacteria | 1284 |
| 251 | Ga0209758_1004203 | 3300025297 | Bacteria | 12208 |
| 252 | Ga0207426_1000562 | 3300025302 | Bacteria | 50691 |
| 253 | Ga0209257_1000013 | 3300025304 | Bacteria | 1047305 |
| 254 | Ga0207697_10087786 | 3300025315 | Bacteria | 1316 |
| 255 | Ga0207682_10014067 | 3300025893 | Bacteria | 3118 |
| 256 | Ga0207682_10099465 | 3300025893 | Bacteria | 1270 |
| 257 | Ga0207642_10042814 | 3300025899 | Bacteria | 1992 |
| 258 | Ga0207710_10000652 | 3300025900 | Bacteria | 19617 |
| 259 | Ga0207710_10147480 | 3300025900 | Bacteria | 1139 |
| 260 | Ga0207688_10015054 | 3300025901 | Bacteria | 4197 |
| 261 | Ga0207680_10031078 | 3300025903 | Bacteria | 3021 |
| 262 | Ga0207647_10153615 | 3300025904 | Unclassified | 1344 |
| 263 | Ga0207645_10005287 | 3300025907 | Bacteria | 9398 |
| 264 | Ga0207645_10010099 | 3300025907 | Bacteria | 6497 |
| 265 | Ga0207645_10086897 | 3300025907 | Bacteria | 2009 |
| 266 | Ga0207645_10116440 | 3300025907 | Bacteria | 1733 |
| 267 | Ga0207643_10004981 | 3300025908 | Bacteria | 7108 |
| 268 | Ga0207643_10015733 | 3300025908 | Unclassified | 4120 |
| 269 | Ga0207643_10032156 | 3300025908 | Bacteria | 2928 |
| 270 | Ga0207705_10001125 | 3300025909 | Bacteria | 21755 |
| 271 | Ga0207705_10470291 | 3300025909 | Bacteria | 975 |
| 272 | Ga0207654_10001235 | 3300025911 | Bacteria | 13641 |
| 273 | Ga0207707_10000449 | 3300025912 | Bacteria | 42875 |
| 274 | Ga0207707_10062528 | 3300025912 | Bacteria | 3240 |
| 275 | Ga0207707_10204826 | 3300025912 | Unclassified | 1719 |
| 276 | Ga0207695_10017744 | 3300025913 | Bacteria | 8262 |
| 277 | Ga0207695_10271276 | 3300025913 | Unclassified | 1592 |
| 278 | Ga0207660_10077004 | 3300025917 | Bacteria | 2440 |
| 279 | Ga0207657_10000716 | 3300025919 | Bacteria | 35235 |
| 280 | Ga0207657_10167430 | 3300025919 | Unclassified | 1782 |
| 281 | Ga0207657_10172717 | 3300025919 | Bacteria | 1750 |
| 282 | Ga0207649_10001717 | 3300025920 | Bacteria | 12602 |
| 283 | Ga0207649_10022160 | 3300025920 | Bacteria | 3669 |
| 284 | Ga0207652_10000010 | 3300025921 | Bacteria | 247079 |
| 285 | Ga0207652_10000475 | 3300025921 | Bacteria | 41112 |
| 286 | Ga0207652_10004718 | 3300025921 | Bacteria | 11053 |
| 287 | Ga0207681_10002255 | 3300025923 | Bacteria | 12258 |
| 288 | Ga0207681_10252511 | 3300025923 | Bacteria | 1377 |
| 289 | Ga0207650_10100326 | 3300025925 | Bacteria | 2227 |
| 290 | Ga0207650_10154223 | 3300025925 | Bacteria | 1815 |
| 291 | Ga0207659_10024330 | 3300025926 | Bacteria | 4056 |
| 292 | Ga0207659_10098356 | 3300025926 | Bacteria | 2200 |
| 293 | Ga0207659_10108820 | 3300025926 | Bacteria | 2103 |
| 294 | Ga0207644_10197090 | 3300025931 | Bacteria | 1587 |
| 295 | Ga0207644_10211048 | 3300025931 | Bacteria | 1535 |
| 296 | Ga0207644_10375212 | 3300025931 | Bacteria | 1159 |
| 297 | Ga0207690_10024559 | 3300025932 | Bacteria | 3776 |
| 298 | Ga0207690_10254947 | 3300025932 | Bacteria | 1357 |
| 299 | Ga0207706_10005151 | 3300025933 | Bacteria | 12200 |
| 300 | Ga0207706_10043838 | 3300025933 | Bacteria | 3964 |
| 301 | Ga0207706_10053903 | 3300025933 | Bacteria | 3550 |
| 302 | Ga0207706_10074299 | 3300025933 | Bacteria | 2989 |
| 303 | Ga0207706_10120306 | 3300025933 | Unclassified | 2308 |
| 304 | Ga0207686_10196944 | 3300025934 | Unclassified | 1440 |
| 305 | Ga0207686_10237910 | 3300025934 | Bacteria | 1324 |
| 306 | Ga0207686_10337909 | 3300025934 | Unclassified | 1130 |
| 307 | Ga0207709_10147020 | 3300025935 | Unclassified | 1627 |
| 308 | Ga0207670_10019840 | 3300025936 | Bacteria | 4115 |
| 309 | Ga0207670_10052478 | 3300025936 | Unclassified | 2742 |
| 310 | Ga0207670_10154357 | 3300025936 | Bacteria | 1707 |
| 311 | Ga0207669_10034897 | 3300025937 | Bacteria | 2856 |
| 312 | Ga0207704_10044288 | 3300025938 | Unclassified | 2635 |
| 313 | Ga0207704_10144079 | 3300025938 | Unclassified | 1671 |
| 314 | Ga0207704_10198207 | 3300025938 | Bacteria | 1467 |
| 315 | Ga0207691_10003616 | 3300025940 | Bacteria | 15003 |
| 316 | Ga0207691_10027251 | 3300025940 | Bacteria | 5360 |
| 317 | Ga0207689_10003428 | 3300025942 | Bacteria | 14476 |
| 318 | Ga0207689_10013384 | 3300025942 | Bacteria | 7002 |
| 319 | Ga0207689_10234728 | 3300025942 | Bacteria | 1516 |
| 320 | Ga0207689_10350855 | 3300025942 | Bacteria | 1226 |
| 321 | Ga0207661_10000710 | 3300025944 | Bacteria | 21628 |
| 322 | Ga0207661_10058673 | 3300025944 | Bacteria | 3098 |
| 323 | Ga0207679_10000408 | 3300025945 | Bacteria | 30790 |
| 324 | Ga0207679_10228283 | 3300025945 | Unclassified | 1570 |
| 325 | Ga0207679_10263109 | 3300025945 | Bacteria | 1472 |
| 326 | Ga0207667_10002780 | 3300025949 | Bacteria | 21662 |
| 327 | Ga0207667_10113553 | 3300025949 | Bacteria | 2793 |
| 328 | Ga0207651_10015249 | 3300025960 | Bacteria | 4461 |
| 329 | Ga0207651_10030074 | 3300025960 | Bacteria | 3453 |
| 330 | Ga0207651_10160245 | 3300025960 | Bacteria | 1763 |
| 331 | Ga0207712_10066183 | 3300025961 | Bacteria | 2582 |
| 332 | Ga0207712_10186980 | 3300025961 | Bacteria | 1632 |
| 333 | Ga0207668_10082475 | 3300025972 | Bacteria | 2336 |
| 334 | Ga0207668_10121728 | 3300025972 | Bacteria | 1977 |
| 335 | Ga0207640_10559089 | 3300025981 | Bacteria | 962 |
| 336 | Ga0207658_10020159 | 3300025986 | Bacteria | 4618 |
| 337 | Ga0207658_10117466 | 3300025986 | Bacteria | 2114 |
| 338 | Ga0207658_10185065 | 3300025986 | Bacteria | 1727 |
| 339 | Ga0207658_10201441 | 3300025986 | Bacteria | 1662 |
| 340 | Ga0207658_10434197 | 3300025986 | Bacteria | 1160 |
| 341 | Ga0207677_10007017 | 3300026023 | Bacteria | 6198 |
| 342 | Ga0207677_10008637 | 3300026023 | Bacteria | 5703 |
| 343 | Ga0207677_10278247 | 3300026023 | Bacteria | 1372 |
| 344 | Ga0207703_10391357 | 3300026035 | Bacteria | 1288 |
| 345 | Ga0207703_10681454 | 3300026035 | Unclassified | 977 |
| 346 | Ga0207639_10002038 | 3300026041 | Bacteria | 13617 |
| 347 | Ga0207639_10032009 | 3300026041 | Bacteria | 3868 |
| 348 | Ga0207678_10009662 | 3300026067 | Bacteria | 8484 |
| 349 | Ga0207678_10025244 | 3300026067 | Bacteria | 5188 |
| 350 | Ga0207678_10115826 | 3300026067 | Bacteria | 2287 |
| 351 | Ga0207641_10034790 | 3300026088 | Bacteria | 4193 |
| 352 | Ga0207641_10062609 | 3300026088 | Bacteria | 3176 |
| 353 | Ga0207641_10570884 | 3300026088 | Bacteria | 1105 |
| 354 | Ga0207648_10020340 | 3300026089 | Bacteria | 5979 |
| 355 | Ga0207648_10026755 | 3300026089 | Bacteria | 5123 |
| 356 | Ga0207648_10030735 | 3300026089 | Bacteria | 4753 |
| 357 | Ga0207648_10055993 | 3300026089 | Unclassified | 3442 |
| 358 | Ga0207648_10367638 | 3300026089 | Bacteria | 1298 |
| 359 | Ga0207676_10007197 | 3300026095 | Bacteria | 7875 |
| 360 | Ga0207676_10188476 | 3300026095 | Unclassified | 1813 |
| 361 | Ga0207676_10519350 | 3300026095 | Bacteria | 1133 |
| 362 | Ga0207674_10004986 | 3300026116 | Bacteria | 15872 |
| 363 | Ga0207674_10169867 | 3300026116 | Unclassified | 2134 |
| 364 | Ga0207674_10403057 | 3300026116 | Bacteria | 1322 |
| 365 | Ga0207675_100002004 | 3300026118 | Bacteria | 20311 |
| 366 | Ga0207675_100042653 | 3300026118 | Unclassified | 4236 |
| 367 | Ga0207683_10004176 | 3300026121 | Bacteria | 12504 |
| 368 | Ga0207683_10042167 | 3300026121 | Bacteria | 3985 |
| 369 | Ga0207428_10035895 | 3300027907 | Bacteria | 4049 |
| 370 | Ga0268265_10006107 | 3300028380 | Bacteria | 8173 |
| 371 | Ga0268265_10190478 | 3300028380 | Unclassified | 1771 |
| 372 | Ga0268265_10199159 | 3300028380 | Bacteria | 1736 |
| 373 | Ga0268265_10306092 | 3300028380 | Unclassified | 1433 |
| 374 | Ga0268264_10026579 | 3300028381 | Unclassified | 4731 |
| 375 | Ga0268264_10034390 | 3300028381 | Unclassified | 4169 |
| 376 | Ga0268264_10133399 | 3300028381 | Bacteria | 2205 |
| 377 | Ga0268264_10246641 | 3300028381 | Bacteria | 1657 |
| 378 | Ga0307511_10005062 | 3300030521 | Bacteria | 13442 |
| 379 | Ga0265327_10000031 | 3300031251 | Bacteria | 325718 |
| 380 | Ga0265327_10008788 | 3300031251 | Bacteria | 7451 |
| 381 | Ga0307513_10046322 | 3300031456 | Bacteria | 4742 |
| 382 | Ga0307509_10134640 | 3300031507 | Bacteria | 2419 |
| 383 | Ga0307508_10000923 | 3300031616 | Bacteria | 34113 |
| 384 | Ga0307405_10185962 | 3300031731 | Bacteria | 1496 |
| 385 | Ga0307413_10110731 | 3300031824 | Bacteria | 1838 |
| 386 | Ga0307413_10261997 | 3300031824 | Unclassified | 1289 |
| 387 | Ga0307410_10132971 | 3300031852 | Bacteria | 1830 |
| 388 | Ga0307416_100148598 | 3300032002 | Bacteria | 2145 |
| 389 | Ga0307414_10320599 | 3300032004 | Bacteria | 1319 |
| 390 | Ga0307411_10044571 | 3300032005 | Unclassified | 2847 |
| 391 | Ga0307415_100291895 | 3300032126 | Bacteria | 1346 |
| 392 | Ga0307415_100498524 | 3300032126 | Unclassified | 1064 |
| 393 | Ga0373943_0239748 | 3300035170 | Bacteria | 1016 |
| 394 | Ga0373933_0033678 | 3300035724 | Bacteria | 2982 |
| 395 | Ga0373947_0266631 | 3300035725 | Bacteria | 1136 |
| 396 | Ga0373937_0021441 | 3300036401 | Bacteria | 5799 |
| 397 | Ga0373925_0303852 | 3300037068 | Bacteria | 1289 |
| 398 | Ga0395899_0000248 | 3300037312 | Bacteria | 72047 |
| 399 | Ga0395899_0005054 | 3300037312 | Bacteria | 10261 |
| 400 | Ga0395899_0009240 | 3300037312 | Bacteria | 7569 |
| 401 | Ga0395899_0030820 | 3300037312 | Bacteria | 4032 |
| 402 | Ga0395899_0080548 | 3300037312 | Bacteria | 2370 |
| 403 | Ga0395900_0003094 | 3300037418 | Bacteria | 18068 |
| 404 | Ga0395900_0032987 | 3300037418 | Bacteria | 5329 |
| 405 | Ga0395900_0069508 | 3300037418 | Bacteria | 3619 |
| 406 | Ga0395900_0100488 | 3300037418 | Bacteria | 2971 |
| 407 | Ga0395900_0199124 | 3300037418 | Unclassified | 2027 |
| 408 | Ga0395900_0572737 | 3300037418 | Bacteria | 1072 |
| 409 | Ga0395898_0000488 | 3300037466 | Bacteria | 78598 |
| 410 | Ga0395898_0011250 | 3300037466 | Bacteria | 9311 |
| 411 | Ga0395898_0038646 | 3300037466 | Bacteria | 4728 |
| 412 | Ga0395898_0079886 | 3300037466 | Bacteria | 3154 |
| 413 | Ga0395898_0113104 | 3300037466 | Bacteria | 2602 |
| 414 | Ga0395905_0563600 | 3300037471 | Unclassified | 1040 |
| 415 | Ga0395901_0008350 | 3300038443 | Bacteria | 10469 |
| 416 | Ga0395901_0040340 | 3300038443 | Bacteria | 4834 |
| 417 | Ga0395901_0049443 | 3300038443 | Bacteria | 4368 |
| 418 | Ga0395901_0061427 | 3300038443 | Bacteria | 3910 |
| 419 | Ga0395901_0120088 | 3300038443 | Bacteria | 2762 |
| 420 | Ga0395901_0136372 | 3300038443 | Bacteria | 2579 |
| 421 | Ga0395901_0587851 | 3300038443 | Unclassified | 1124 |
| 422 | Ga0439465_0075074 | 3300041413 | Bacteria | 1138 |
| 423 | Ga0451843_1500914 | 3300041509 | Bacteria | 1237 |
| 424 | Ga0439433_0004931 | 3300041999 | Bacteria | 2868 |
| 425 | Ga0439449_0002640 | 3300042007 | Bacteria | 6977 |
| 426 | Ga0439449_0014818 | 3300042007 | Bacteria | 2930 |
| 427 | Ga0439449_0084782 | 3300042007 | Bacteria | 1169 |
| 428 | Ga0439462_0028350 | 3300042015 | Bacteria | 1480 |
| 429 | Ga0439434_0035748 | 3300042435 | Bacteria | 1519 |
| 430 | Ga0466957_0002726 | 3300044842 | Bacteria | 9551 |
| 431 | Ga0466960_0248773 | 3300044901 | Bacteria | 987 |
| 432 | Ga0495628_0009804 | 3300046516 | Bacteria | 8158 |
| 433 | Ga0495630_0009666 | 3300046517 | Bacteria | 6936 |
| 434 | Ga0495643_0013690 | 3300046522 | Bacteria | 4846 |
| 435 | Ga0495652_0037370 | 3300046529 | Bacteria | 4213 |
| 436 | Ga0495587_0066727 | 3300046536 | Bacteria | 2098 |
| 437 | Ga0495645_0153481 | 3300046543 | Bacteria | 1598 |
| 438 | Ga0495667_0084341 | 3300046559 | Bacteria | 2063 |
| 439 | Ga0495634_0011993 | 3300046642 | Bacteria | 6284 |
| 440 | Ga0495657_0038927 | 3300046675 | Bacteria | 3269 |
| 441 | Ga0495649_0074992 | 3300046694 | Unclassified | 1812 |
| 442 | Ga0495604_0100242 | 3300047317 | Bacteria | 2130 |
| 443 | Ga0495672_0003113 | 3300047320 | Bacteria | 14477 |
| 444 | Ga0495680_0148764 | 3300047322 | Bacteria | 1708 |
| 445 | Ga0495686_0016555 | 3300047472 | Bacteria | 4998 |
| 446 | Ga0495686_0064587 | 3300047472 | Bacteria | 2265 |
| 447 | Ga0496101_0116598 | 3300048904 | Bacteria | 2015 |
| 448 | Ga0496109_0853171 | 3300048912 | Unclassified | 849 |
| 449 | Ga0496110_0292722 | 3300048913 | Bacteria | 1483 |
| 450 | Ga0501298_001590 | 3300049521 | Bacteria | 3365 |
| 451 | Ga0501031_0009520 | 3300049568 | Bacteria | 6323 |
| 452 | Ga0501033_0193974 | 3300049570 | Unclassified | 1453 |
| 453 | Ga0501036_0079314 | 3300049572 | Bacteria | 2777 |
| 454 | Ga0501037_0462791 | 3300049573 | Bacteria | 864 |
| 455 | Ga0501038_0003678 | 3300049574 | Bacteria | 14282 |
| 456 | Ga0501039_0008667 | 3300049575 | Bacteria | 7747 |
| 457 | Ga0501043_0075074 | 3300049579 | Bacteria | 2656 |
| 458 | Ga0501047_0378215 | 3300049581 | Bacteria | 1251 |
| 459 | Ga0501067_0041755 | 3300049583 | Bacteria | 2547 |
| 460 | Ga0501072_0374565 | 3300049588 | Bacteria | 1130 |
| 461 | Ga0501073_0098502 | 3300049589 | Bacteria | 2030 |
| 462 | Ga0501073_0125168 | 3300049589 | Bacteria | 1782 |
| 463 | Ga0501201_000885 | 3300049651 | Unclassified | 2815 |
| 464 | Ga0501202_021000 | 3300049652 | Unclassified | 1301 |
| 465 | Ga0501222_005775 | 3300049662 | Unclassified | 1666 |
| 466 | Ga0501223_005703 | 3300049663 | Unclassified | 2604 |
| 467 | Ga0501223_020859 | 3300049663 | Unclassified | 1283 |
| 468 | Ga0501235_014029 | 3300049669 | Unclassified | 1766 |
| 469 | Ga0501240_010582 | 3300049673 | Unclassified | 1227 |
| 470 | Ga0501243_003948 | 3300049675 | Unclassified | 2214 |
| 471 | Ga0501259_001100 | 3300049688 | Bacteria | 4518 |
| 472 | Ga0501259_013269 | 3300049688 | Bacteria | 1382 |
| 473 | Ga0501261_006403 | 3300049690 | Unclassified | 1497 |
| 474 | Ga0501221_002410 | 3300049704 | Bacteria | 3088 |
| 475 | Ga0501225_0006676 | 3300049705 | Bacteria | 3364 |
| 476 | Ga0501225_0007109 | 3300049705 | Unclassified | 3252 |
| 477 | Ga0501245_001286 | 3300049708 | Bacteria | 3227 |
| 478 | Ga0501245_011720 | 3300049708 | Unclassified | 1279 |
| 479 | Ga0501080_0492867 | 3300049742 | Unclassified | 1096 |
| 480 | Ga0501080_0522921 | 3300049742 | Unclassified | 1058 |
| 481 | Ga0501083_0090609 | 3300049744 | Bacteria | 2019 |
| 482 | Ga0501083_0151337 | 3300049744 | Bacteria | 1519 |
| 483 | Ga0501241_002826 | 3300049758 | Bacteria | 3334 |
| 484 | Ga0501241_022343 | 3300049758 | Unclassified | 1168 |
| 485 | Ga0501044_0106568 | 3300049823 | Unclassified | 2815 |
| 486 | Ga0501044_0608498 | 3300049823 | Unclassified | 985 |
| 487 | Ga0501212_005665 | 3300049851 | Unclassified | 1657 |
| 488 | nmdc:mga0k408_51102_c1 | 3300050493 | Bacteria | 2394 |
| 489 | nmdc:mga05p37_6756_c1 | 3300050507 | Bacteria | 13525 |
| 490 | nmdc:mga08y16_30416_c1 | 3300050511 | Bacteria | 5684 |
| 491 | nmdc:mga0n895_17682_c1 | 3300050512 | Bacteria | 6578 |
| 492 | Ga0495619_0117673 | 3300053085 | Bacteria | 1820 |
| 493 | Ga0500646_0050936 | 3300053090 | Bacteria | 1195 |
| 494 | Ga0500568_0003080 | 3300053139 | Bacteria | 9521 |
| 495 | Ga0500588_0020601 | 3300053146 | Bacteria | 1769 |
| 496 | Ga0500616_0005546 | 3300053153 | Bacteria | 8545 |
| 497 | Ga0500622_0000110 | 3300053156 | Bacteria | 83911 |
| 498 | Ga0500611_000031 | 3300053727 | Bacteria | 85821 |
| 499 | Ga0501084_0153034 | 3300054114 | Bacteria | 1944 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048912 | Ga0496109_0853171 | Ga0496109_0853171_38_721 | 227 |
| 2 | 3300037418 | Ga0395900_0003094 | Ga0395900_0003094_15_785 | 231 |
| 3 | 3300013100 | Ga0157373_10379492 | Ga0157373_103794922 | 233 |
| 4 | 3300037312 | Ga0395899_0000248 | Ga0395899_0000248_52883_53704 | 245 |
| 5 | 3300037466 | Ga0395898_0000488 | Ga0395898_0000488_58764_59585 | 245 |
| 6 | 3300038443 | Ga0395901_0008350 | Ga0395901_0008350_2325_3146 | 245 |
| 7 | 3300009093 | Ga0105240_10843524 | Ga0105240_108435241 | 251 |
| 8 | 3300009093 | Ga0105240_10281816 | Ga0105240_102818161 | 252 |
| 9 | 3300013104 | Ga0157370_10016434 | Ga0157370_100164342 | 252 |
| 10 | 3300025913 | Ga0207695_10271276 | Ga0207695_102712761 | 252 |
| 11 | 3300005458 | Ga0070681_10566419 | Ga0070681_105664191 | 253 |
| 12 | 3300005327 | Ga0070658_10229994 | Ga0070658_102299942 | 254 |
| 13 | 3300005530 | Ga0070679_100008240 | Ga0070679_1000082409 | 254 |
| 14 | 3300013307 | Ga0157372_10005839 | Ga0157372_100058392 | 254 |
| 15 | 3300013307 | Ga0157372_10262999 | Ga0157372_102629992 | 254 |
| 16 | 3300025921 | Ga0207652_10000010 | Ga0207652_1000001070 | 254 |
| 17 | 3300037068 | Ga0373925_0303852 | Ga0373925_0303852_181_1098 | 254 |
| 18 | 3300037312 | Ga0395899_0009240 | Ga0395899_0009240_5530_6369 | 254 |
| 19 | 3300037312 | Ga0395899_0080548 | Ga0395899_0080548_1138_1983 | 254 |
| 20 | 3300037418 | Ga0395900_0032987 | Ga0395900_0032987_2031_2870 | 254 |
| 21 | 3300037466 | Ga0395898_0113104 | Ga0395898_0113104_1242_2081 | 254 |
| 22 | 3300038443 | Ga0395901_0061427 | Ga0395901_0061427_344_1183 | 254 |
| 23 | 3300038443 | Ga0395901_0136372 | Ga0395901_0136372_727_1572 | 254 |
| 24 | 3300005327 | Ga0070658_10016654 | Ga0070658_100166543 | 256 |
| 25 | 3300005336 | Ga0070680_100019154 | Ga0070680_1000191543 | 256 |
| 26 | 3300005455 | Ga0070663_100087979 | Ga0070663_1000879791 | 256 |
| 27 | 3300005458 | Ga0070681_10092257 | Ga0070681_100922571 | 256 |
| 28 | 3300005530 | Ga0070679_100029404 | Ga0070679_1000294043 | 256 |
| 29 | 3300005535 | Ga0070684_100142758 | Ga0070684_1001427582 | 256 |
| 30 | 3300005563 | Ga0068855_100003699 | Ga0068855_1000036993 | 256 |
| 31 | 3300013105 | Ga0157369_10016679 | Ga0157369_100166796 | 256 |
| 32 | 3300013307 | Ga0157372_10028977 | Ga0157372_100289773 | 256 |
| 33 | 3300025909 | Ga0207705_10001125 | Ga0207705_100011254 | 256 |
| 34 | 3300025912 | Ga0207707_10204826 | Ga0207707_102048262 | 256 |
| 35 | 3300025917 | Ga0207660_10077004 | Ga0207660_100770043 | 256 |
| 36 | 3300025921 | Ga0207652_10000475 | Ga0207652_100004753 | 256 |
| 37 | 3300025944 | Ga0207661_10058673 | Ga0207661_100586732 | 256 |
| 38 | 3300025949 | Ga0207667_10002780 | Ga0207667_1000278015 | 256 |
| 39 | 3300026067 | Ga0207678_10009662 | Ga0207678_100096625 | 256 |
| 40 | 3300035170 | Ga0373943_0239748 | Ga0373943_0239748_142_963 | 256 |
| 41 | 3300037312 | Ga0395899_0005054 | Ga0395899_0005054_3437_4282 | 256 |
| 42 | 3300037418 | Ga0395900_0100488 | Ga0395900_0100488_1311_2156 | 256 |
| 43 | 3300037466 | Ga0395898_0011250 | Ga0395898_0011250_3723_4568 | 256 |
| 44 | 3300038443 | Ga0395901_0120088 | Ga0395901_0120088_1425_2270 | 256 |
| 45 | 3300005455 | Ga0070663_100011540 | Ga0070663_1000115405 | 257 |
| 46 | 3300005539 | Ga0068853_100107735 | Ga0068853_1001077352 | 257 |
| 47 | 3300013307 | Ga0157372_10075466 | Ga0157372_100754663 | 257 |
| 48 | 3300026067 | Ga0207678_10025244 | Ga0207678_100252442 | 257 |
| 49 | 3300003322 | rootL2_10029339 | rootL2_100293391 | 259 |
| 50 | 3300005618 | Ga0068864_100204652 | Ga0068864_1002046522 | 259 |
| 51 | 3300009553 | Ga0105249_10018201 | Ga0105249_100182015 | 260 |
| 52 | 3300013297 | Ga0157378_10621912 | Ga0157378_106219122 | 260 |
| 53 | 3300013306 | Ga0163162_10004947 | Ga0163162_100049477 | 260 |
| 54 | 3300014968 | Ga0157379_10010814 | Ga0157379_100108146 | 260 |
| 55 | 3300025961 | Ga0207712_10186980 | Ga0207712_101869802 | 260 |
| 56 | 3300026088 | Ga0207641_10062609 | Ga0207641_100626093 | 260 |
| 57 | 3300005356 | Ga0070674_100094711 | Ga0070674_1000947112 | 263 |
| 58 | 3300005459 | Ga0068867_100127911 | Ga0068867_1001279112 | 263 |
| 59 | 3300031251 | Ga0265327_10008788 | Ga0265327_100087887 | 263 |
| 60 | 3300049570 | Ga0501033_0193974 | Ga0501033_0193974_447_1286 | 263 |
| 61 | 3300005329 | Ga0070683_100002680 | Ga0070683_1000026805 | 264 |
| 62 | 3300005334 | Ga0068869_100009791 | Ga0068869_1000097916 | 264 |
| 63 | 3300005340 | Ga0070689_100016085 | Ga0070689_1000160855 | 264 |
| 64 | 3300005344 | Ga0070661_100011314 | Ga0070661_1000113141 | 264 |
| 65 | 3300005354 | Ga0070675_100007564 | Ga0070675_1000075643 | 264 |
| 66 | 3300005457 | Ga0070662_100032353 | Ga0070662_1000323532 | 264 |
| 67 | 3300005535 | Ga0070684_100000691 | Ga0070684_10000069118 | 264 |
| 68 | 3300005543 | Ga0070672_100116324 | Ga0070672_1001163242 | 264 |
| 69 | 3300005564 | Ga0070664_100008919 | Ga0070664_1000089194 | 264 |
| 70 | 3300005577 | Ga0068857_100047109 | Ga0068857_1000471094 | 264 |
| 71 | 3300005616 | Ga0068852_100172277 | Ga0068852_1001722772 | 264 |
| 72 | 3300005617 | Ga0068859_100073541 | Ga0068859_1000735414 | 264 |
| 73 | 3300005618 | Ga0068864_100026088 | Ga0068864_1000260882 | 264 |
| 74 | 3300006931 | Ga0097620_100073539 | Ga0097620_1000735394 | 264 |
| 75 | 3300013296 | Ga0157374_10058591 | Ga0157374_100585913 | 264 |
| 76 | 3300013308 | Ga0157375_10072442 | Ga0157375_100724424 | 264 |
| 77 | 3300014325 | Ga0163163_10000652 | Ga0163163_100006529 | 264 |
| 78 | 3300017792 | Ga0163161_10133797 | Ga0163161_101337971 | 264 |
| 79 | 3300025912 | Ga0207707_10062528 | Ga0207707_100625282 | 265 |
| 80 | 3300025920 | Ga0207649_10022160 | Ga0207649_100221602 | 265 |
| 81 | 3300025926 | Ga0207659_10108820 | Ga0207659_101088203 | 265 |
| 82 | 3300025933 | Ga0207706_10005151 | Ga0207706_100051514 | 265 |
| 83 | 3300025936 | Ga0207670_10019840 | Ga0207670_100198404 | 265 |
| 84 | 3300025940 | Ga0207691_10027251 | Ga0207691_100272512 | 265 |
| 85 | 3300025942 | Ga0207689_10003428 | Ga0207689_100034286 | 265 |
| 86 | 3300026095 | Ga0207676_10007197 | Ga0207676_100071976 | 265 |
| 87 | 3300026116 | Ga0207674_10004986 | Ga0207674_100049866 | 265 |
| 88 | 3300028380 | Ga0268265_10190478 | Ga0268265_101904782 | 265 |
| 89 | 3300048913 | Ga0496110_0292722 | Ga0496110_0292722_301_1134 | 265 |
| 90 | 3300003320 | rootH2_10312659 | rootH2_103126592 | 267 |
| 91 | 3300005293 | Ga0065715_10198648 | Ga0065715_101986481 | 267 |
| 92 | 3300005353 | Ga0070669_100530863 | Ga0070669_1005308631 | 267 |
| 93 | 3300005354 | Ga0070675_100023643 | Ga0070675_1000236434 | 267 |
| 94 | 3300005356 | Ga0070674_100046034 | Ga0070674_1000460342 | 267 |
| 95 | 3300005364 | Ga0070673_100005056 | Ga0070673_1000050566 | 267 |
| 96 | 3300005459 | Ga0068867_100141790 | Ga0068867_1001417902 | 267 |
| 97 | 3300005543 | Ga0070672_100047011 | Ga0070672_1000470112 | 267 |
| 98 | 3300013308 | Ga0157375_10035028 | Ga0157375_100350284 | 267 |
| 99 | 3300025315 | Ga0207697_10087786 | Ga0207697_100877862 | 267 |
| 100 | 3300025926 | Ga0207659_10024330 | Ga0207659_100243302 | 267 |
| 101 | 3300025940 | Ga0207691_10003616 | Ga0207691_100036165 | 267 |
| 102 | 3300025960 | Ga0207651_10030074 | Ga0207651_100300742 | 267 |
| 103 | 3300025972 | Ga0207668_10082475 | Ga0207668_100824751 | 267 |
| 104 | 3300026089 | Ga0207648_10055993 | Ga0207648_100559932 | 267 |
| 105 | 3300005331 | Ga0070670_100537251 | Ga0070670_1005372511 | 268 |
| 106 | 3300005355 | Ga0070671_100341663 | Ga0070671_1003416631 | 268 |
| 107 | 3300006237 | Ga0097621_100383067 | Ga0097621_1003830672 | 268 |
| 108 | 3300006358 | Ga0068871_100224983 | Ga0068871_1002249831 | 268 |
| 109 | 3300017792 | Ga0163161_10291138 | Ga0163161_102911381 | 268 |
| 110 | 3300014325 | Ga0163163_10000488 | Ga0163163_1000048821 | 269 |
| 111 | 3300003323 | rootH1_10008400 | rootH1_1000840012 | 270 |
| 112 | 3300013306 | Ga0163162_10033370 | Ga0163162_100333702 | 270 |
| 113 | 3300013308 | Ga0157375_10087008 | Ga0157375_100870082 | 270 |
| 114 | 3300042007 | Ga0439449_0014818 | Ga0439449_0014818_460_1284 | 270 |
| 115 | 3300049705 | Ga0501225_0006676 | Ga0501225_0006676_1346_2170 | 270 |
| 116 | 3300031251 | Ga0265327_10000031 | Ga0265327_10000031255 | 271 |
| 117 | 3300035725 | Ga0373947_0266631 | Ga0373947_0266631_28_945 | 271 |
| 118 | iso_pu_bacteria | 2738541278 | 2738727129 | 271 |
| 119 | 3300025933 | Ga0207706_10120306 | Ga0207706_101203061 | 272 |
| 120 | 3300025936 | Ga0207670_10052478 | Ga0207670_100524783 | 272 |
| 121 | 3300026095 | Ga0207676_10188476 | Ga0207676_101884761 | 272 |
| 122 | 3300049573 | Ga0501037_0462791 | Ga0501037_0462791_15_833 | 272 |
| 123 | 3300005337 | Ga0070682_100206162 | Ga0070682_1002061622 | 273 |
| 124 | 3300005354 | Ga0070675_100658781 | Ga0070675_1006587811 | 273 |
| 125 | 3300006358 | Ga0068871_100210623 | Ga0068871_1002106233 | 273 |
| 126 | 3300005339 | Ga0070660_100000327 | Ga0070660_1000003276 | 274 |
| 127 | 3300005339 | Ga0070660_100211251 | Ga0070660_1002112512 | 274 |
| 128 | 3300005366 | Ga0070659_100038184 | Ga0070659_1000381844 | 274 |
| 129 | 3300005563 | Ga0068855_100016129 | Ga0068855_10001612913 | 274 |
| 130 | 3300005614 | Ga0068856_100544066 | Ga0068856_1005440661 | 274 |
| 131 | 3300013100 | Ga0157373_10003686 | Ga0157373_100036863 | 274 |
| 132 | 3300013102 | Ga0157371_10002613 | Ga0157371_1000261310 | 274 |
| 133 | 3300013102 | Ga0157371_10005272 | Ga0157371_1000527214 | 274 |
| 134 | 3300013104 | Ga0157370_10057181 | Ga0157370_100571813 | 274 |
| 135 | 3300013307 | Ga0157372_10076436 | Ga0157372_100764366 | 274 |
| 136 | 3300013307 | Ga0157372_10084008 | Ga0157372_100840083 | 274 |
| 137 | 3300025909 | Ga0207705_10470291 | Ga0207705_104702911 | 274 |
| 138 | 3300025919 | Ga0207657_10000716 | Ga0207657_100007165 | 274 |
| 139 | 3300025919 | Ga0207657_10167430 | Ga0207657_101674302 | 274 |
| 140 | 3300025932 | Ga0207690_10024559 | Ga0207690_100245592 | 274 |
| 141 | 3300026088 | Ga0207641_10570884 | Ga0207641_105708841 | 274 |
| 142 | 3300037312 | Ga0395899_0030820 | Ga0395899_0030820_2410_3249 | 274 |
| 143 | 3300037418 | Ga0395900_0069508 | Ga0395900_0069508_1753_2592 | 274 |
| 144 | 3300037418 | Ga0395900_0199124 | Ga0395900_0199124_405_1244 | 274 |
| 145 | 3300037418 | Ga0395900_0572737 | Ga0395900_0572737_78_917 | 274 |
| 146 | 3300037466 | Ga0395898_0038646 | Ga0395898_0038646_2410_3249 | 274 |
| 147 | 3300037466 | Ga0395898_0079886 | Ga0395898_0079886_403_1242 | 274 |
| 148 | 3300037471 | Ga0395905_0563600 | Ga0395905_0563600_51_890 | 274 |
| 149 | 3300038443 | Ga0395901_0040340 | Ga0395901_0040340_404_1243 | 274 |
| 150 | 3300038443 | Ga0395901_0049443 | Ga0395901_0049443_911_1750 | 274 |
| 151 | 3300049823 | Ga0501044_0106568 | Ga0501044_0106568_1928_2767 | 274 |
| 152 | 3300053139 | Ga0500568_0003080 | Ga0500568_0003080_1713_2558 | 274 |
| 153 | 3300041413 | Ga0439465_0075074 | Ga0439465_0075074_101_937 | 275 |
| 154 | 3300042007 | Ga0439449_0084782 | Ga0439449_0084782_77_913 | 275 |
| 155 | 3300049589 | Ga0501073_0125168 | Ga0501073_0125168_115_951 | 275 |
| 156 | 3300053156 | Ga0500622_0000110 | Ga0500622_0000110_11399_12235 | 275 |
| 157 | 3300001979 | JGI24740J21852_10001007 | JGI24740J21852_100010072 | 276 |
| 158 | 3300003203 | JGI25406J46586_10002945 | JGI25406J46586_100029452 | 276 |
| 159 | 3300003322 | rootL2_10276368 | rootL2_102763683 | 276 |
| 160 | 3300003794 | Ga0055531_10000023 | Ga0055531_10000023104 | 276 |
| 161 | 3300005288 | Ga0065714_10174544 | Ga0065714_101745441 | 276 |
| 162 | 3300005290 | Ga0065712_10085825 | Ga0065712_100858253 | 276 |
| 163 | 3300005290 | Ga0065712_10095409 | Ga0065712_100954092 | 276 |
| 164 | 3300005295 | Ga0065707_10115452 | Ga0065707_101154521 | 276 |
| 165 | 3300005328 | Ga0070676_10009137 | Ga0070676_100091374 | 276 |
| 166 | 3300005328 | Ga0070676_10033550 | Ga0070676_100335502 | 276 |
| 167 | 3300005331 | Ga0070670_100176756 | Ga0070670_1001767562 | 276 |
| 168 | 3300005331 | Ga0070670_100222387 | Ga0070670_1002223872 | 276 |
| 169 | 3300005333 | Ga0070677_10052759 | Ga0070677_100527592 | 276 |
| 170 | 3300005334 | Ga0068869_100040088 | Ga0068869_1000400883 | 276 |
| 171 | 3300005334 | Ga0068869_100330141 | Ga0068869_1003301411 | 276 |
| 172 | 3300005334 | Ga0068869_100376457 | Ga0068869_1003764571 | 276 |
| 173 | 3300005335 | Ga0070666_10012219 | Ga0070666_100122192 | 276 |
| 174 | 3300005347 | Ga0070668_100041743 | Ga0070668_1000417431 | 276 |
| 175 | 3300005347 | Ga0070668_100067191 | Ga0070668_1000671912 | 276 |
| 176 | 3300005353 | Ga0070669_100173806 | Ga0070669_1001738061 | 276 |
| 177 | 3300005353 | Ga0070669_100235893 | Ga0070669_1002358931 | 276 |
| 178 | 3300005354 | Ga0070675_100003139 | Ga0070675_1000031395 | 276 |
| 179 | 3300005354 | Ga0070675_100042804 | Ga0070675_1000428042 | 276 |
| 180 | 3300005356 | Ga0070674_100019811 | Ga0070674_1000198113 | 276 |
| 181 | 3300005364 | Ga0070673_100029290 | Ga0070673_1000292902 | 276 |
| 182 | 3300005364 | Ga0070673_100129431 | Ga0070673_1001294312 | 276 |
| 183 | 3300005365 | Ga0070688_100034086 | Ga0070688_1000340862 | 276 |
| 184 | 3300005366 | Ga0070659_100232943 | Ga0070659_1002329431 | 276 |
| 185 | 3300005367 | Ga0070667_100138120 | Ga0070667_1001381202 | 276 |
| 186 | 3300005367 | Ga0070667_100142983 | Ga0070667_1001429832 | 276 |
| 187 | 3300005440 | Ga0070705_100164596 | Ga0070705_1001645961 | 276 |
| 188 | 3300005456 | Ga0070678_100001368 | Ga0070678_10000136811 | 276 |
| 189 | 3300005457 | Ga0070662_100066556 | Ga0070662_1000665562 | 276 |
| 190 | 3300005539 | Ga0068853_100042161 | Ga0068853_1000421612 | 276 |
| 191 | 3300005543 | Ga0070672_100120148 | Ga0070672_1001201482 | 276 |
| 192 | 3300005543 | Ga0070672_100379339 | Ga0070672_1003793391 | 276 |
| 193 | 3300005548 | Ga0070665_100040137 | Ga0070665_1000401373 | 276 |
| 194 | 3300005617 | Ga0068859_100056013 | Ga0068859_1000560132 | 276 |
| 195 | 3300005617 | Ga0068859_100069122 | Ga0068859_1000691225 | 276 |
| 196 | 3300005617 | Ga0068859_100083107 | Ga0068859_1000831074 | 276 |
| 197 | 3300005618 | Ga0068864_100378078 | Ga0068864_1003780782 | 276 |
| 198 | 3300005719 | Ga0068861_100074300 | Ga0068861_1000743002 | 276 |
| 199 | 3300005719 | Ga0068861_100114157 | Ga0068861_1001141571 | 276 |
| 200 | 3300005840 | Ga0068870_10021012 | Ga0068870_100210123 | 276 |
| 201 | 3300005841 | Ga0068863_100159561 | Ga0068863_1001595612 | 276 |
| 202 | 3300005842 | Ga0068858_100509511 | Ga0068858_1005095111 | 276 |
| 203 | 3300005843 | Ga0068860_100113004 | Ga0068860_1001130043 | 276 |
| 204 | 3300005843 | Ga0068860_100251349 | Ga0068860_1002513492 | 276 |
| 205 | 3300005843 | Ga0068860_100324285 | Ga0068860_1003242852 | 276 |
| 206 | 3300005843 | Ga0068860_100474770 | Ga0068860_1004747702 | 276 |
| 207 | 3300005844 | Ga0068862_100001959 | Ga0068862_10000195910 | 276 |
| 208 | 3300005844 | Ga0068862_100502331 | Ga0068862_1005023311 | 276 |
| 209 | 3300005844 | Ga0068862_100670242 | Ga0068862_1006702421 | 276 |
| 210 | 3300005985 | Ga0081539_10000223 | Ga0081539_10000223102 | 276 |
| 211 | 3300006195 | Ga0075366_10026063 | Ga0075366_100260632 | 276 |
| 212 | 3300006237 | Ga0097621_100018040 | Ga0097621_1000180405 | 276 |
| 213 | 3300006237 | Ga0097621_100402589 | Ga0097621_1004025892 | 276 |
| 214 | 3300006358 | Ga0068871_100005350 | Ga0068871_1000053506 | 276 |
| 215 | 3300006358 | Ga0068871_100196492 | Ga0068871_1001964923 | 276 |
| 216 | 3300006358 | Ga0068871_100365264 | Ga0068871_1003652641 | 276 |
| 217 | 3300006881 | Ga0068865_100035886 | Ga0068865_1000358862 | 276 |
| 218 | 3300006881 | Ga0068865_100414308 | Ga0068865_1004143081 | 276 |
| 219 | 3300006931 | Ga0097620_100056011 | Ga0097620_1000560112 | 276 |
| 220 | 3300006931 | Ga0097620_100069122 | Ga0097620_1000691225 | 276 |
| 221 | 3300006931 | Ga0097620_100083107 | Ga0097620_1000831074 | 276 |
| 222 | 3300009094 | Ga0111539_10004437 | Ga0111539_100044375 | 276 |
| 223 | 3300009101 | Ga0105247_10001854 | Ga0105247_100018545 | 276 |
| 224 | 3300009148 | Ga0105243_10175891 | Ga0105243_101758912 | 276 |
| 225 | 3300009176 | Ga0105242_10107033 | Ga0105242_101070332 | 276 |
| 226 | 3300009545 | Ga0105237_10579076 | Ga0105237_105790762 | 276 |
| 227 | 3300009553 | Ga0105249_10032022 | Ga0105249_100320222 | 276 |
| 228 | 3300009553 | Ga0105249_10041703 | Ga0105249_100417032 | 276 |
| 229 | 3300009553 | Ga0105249_10125066 | Ga0105249_101250662 | 276 |
| 230 | 3300009553 | Ga0105249_10153748 | Ga0105249_101537482 | 276 |
| 231 | 3300009553 | Ga0105249_10262884 | Ga0105249_102628842 | 276 |
| 232 | 3300011119 | Ga0105246_10247782 | Ga0105246_102477821 | 276 |
| 233 | 3300011119 | Ga0105246_10321066 | Ga0105246_103210662 | 276 |
| 234 | 3300013104 | Ga0157370_10016745 | Ga0157370_100167454 | 276 |
| 235 | 3300013296 | Ga0157374_10098136 | Ga0157374_100981362 | 276 |
| 236 | 3300013297 | Ga0157378_10353834 | Ga0157378_103538341 | 276 |
| 237 | 3300013306 | Ga0163162_10134704 | Ga0163162_101347042 | 276 |
| 238 | 3300013308 | Ga0157375_10013870 | Ga0157375_100138708 | 276 |
| 239 | 3300013308 | Ga0157375_10551459 | Ga0157375_105514591 | 276 |
| 240 | 3300013308 | Ga0157375_10695079 | Ga0157375_106950792 | 276 |
| 241 | 3300014325 | Ga0163163_10239120 | Ga0163163_102391202 | 276 |
| 242 | 3300014326 | Ga0157380_10007645 | Ga0157380_100076452 | 276 |
| 243 | 3300014326 | Ga0157380_10237781 | Ga0157380_102377812 | 276 |
| 244 | 3300014745 | Ga0157377_10135524 | Ga0157377_101355242 | 276 |
| 245 | 3300025297 | Ga0209758_1004203 | Ga0209758_10042038 | 276 |
| 246 | 3300025302 | Ga0207426_1000562 | Ga0207426_100056224 | 276 |
| 247 | 3300025304 | Ga0209257_1000013 | Ga0209257_1000013544 | 276 |
| 248 | 3300025893 | Ga0207682_10014067 | Ga0207682_100140671 | 276 |
| 249 | 3300025893 | Ga0207682_10099465 | Ga0207682_100994651 | 276 |
| 250 | 3300025900 | Ga0207710_10000652 | Ga0207710_100006527 | 276 |
| 251 | 3300025901 | Ga0207688_10015054 | Ga0207688_100150544 | 276 |
| 252 | 3300025903 | Ga0207680_10031078 | Ga0207680_100310782 | 276 |
| 253 | 3300025904 | Ga0207647_10153615 | Ga0207647_101536152 | 276 |
| 254 | 3300025907 | Ga0207645_10010099 | Ga0207645_100100996 | 276 |
| 255 | 3300025907 | Ga0207645_10086897 | Ga0207645_100868972 | 276 |
| 256 | 3300025907 | Ga0207645_10116440 | Ga0207645_101164402 | 276 |
| 257 | 3300025908 | Ga0207643_10004981 | Ga0207643_100049816 | 276 |
| 258 | 3300025908 | Ga0207643_10015733 | Ga0207643_100157333 | 276 |
| 259 | 3300025908 | Ga0207643_10032156 | Ga0207643_100321562 | 276 |
| 260 | 3300025923 | Ga0207681_10002255 | Ga0207681_100022558 | 276 |
| 261 | 3300025923 | Ga0207681_10252511 | Ga0207681_102525112 | 276 |
| 262 | 3300025925 | Ga0207650_10154223 | Ga0207650_101542231 | 276 |
| 263 | 3300025926 | Ga0207659_10098356 | Ga0207659_100983561 | 276 |
| 264 | 3300025933 | Ga0207706_10074299 | Ga0207706_100742992 | 276 |
| 265 | 3300025934 | Ga0207686_10196944 | Ga0207686_101969442 | 276 |
| 266 | 3300025934 | Ga0207686_10237910 | Ga0207686_102379102 | 276 |
| 267 | 3300025934 | Ga0207686_10337909 | Ga0207686_103379091 | 276 |
| 268 | 3300025935 | Ga0207709_10147020 | Ga0207709_101470202 | 276 |
| 269 | 3300025936 | Ga0207670_10154357 | Ga0207670_101543571 | 276 |
| 270 | 3300025938 | Ga0207704_10044288 | Ga0207704_100442881 | 276 |
| 271 | 3300025938 | Ga0207704_10198207 | Ga0207704_101982071 | 276 |
| 272 | 3300025942 | Ga0207689_10013384 | Ga0207689_100133842 | 276 |
| 273 | 3300025942 | Ga0207689_10234728 | Ga0207689_102347282 | 276 |
| 274 | 3300025945 | Ga0207679_10228283 | Ga0207679_102282832 | 276 |
| 275 | 3300025960 | Ga0207651_10015249 | Ga0207651_100152494 | 276 |
| 276 | 3300025961 | Ga0207712_10066183 | Ga0207712_100661832 | 276 |
| 277 | 3300025972 | Ga0207668_10121728 | Ga0207668_101217282 | 276 |
| 278 | 3300025986 | Ga0207658_10020159 | Ga0207658_100201593 | 276 |
| 279 | 3300025986 | Ga0207658_10201441 | Ga0207658_102014411 | 276 |
| 280 | 3300025986 | Ga0207658_10434197 | Ga0207658_104341971 | 276 |
| 281 | 3300026035 | Ga0207703_10391357 | Ga0207703_103913571 | 276 |
| 282 | 3300026035 | Ga0207703_10681454 | Ga0207703_106814541 | 276 |
| 283 | 3300026041 | Ga0207639_10032009 | Ga0207639_100320094 | 276 |
| 284 | 3300026089 | Ga0207648_10026755 | Ga0207648_100267555 | 276 |
| 285 | 3300026089 | Ga0207648_10030735 | Ga0207648_100307352 | 276 |
| 286 | 3300026095 | Ga0207676_10519350 | Ga0207676_105193501 | 276 |
| 287 | 3300026118 | Ga0207675_100002004 | Ga0207675_1000020046 | 276 |
| 288 | 3300026118 | Ga0207675_100042653 | Ga0207675_1000426532 | 276 |
| 289 | 3300026121 | Ga0207683_10004176 | Ga0207683_100041767 | 276 |
| 290 | 3300027907 | Ga0207428_10035895 | Ga0207428_100358952 | 276 |
| 291 | 3300028380 | Ga0268265_10006107 | Ga0268265_100061075 | 276 |
| 292 | 3300028380 | Ga0268265_10199159 | Ga0268265_101991591 | 276 |
| 293 | 3300028380 | Ga0268265_10306092 | Ga0268265_103060922 | 276 |
| 294 | 3300028381 | Ga0268264_10034390 | Ga0268264_100343904 | 276 |
| 295 | 3300028381 | Ga0268264_10133399 | Ga0268264_101333992 | 276 |
| 296 | 3300028381 | Ga0268264_10246641 | Ga0268264_102466413 | 276 |
| 297 | 3300031824 | Ga0307413_10110731 | Ga0307413_101107313 | 276 |
| 298 | 3300032004 | Ga0307414_10320599 | Ga0307414_103205992 | 276 |
| 299 | 3300032126 | Ga0307415_100498524 | Ga0307415_1004985241 | 276 |
| 300 | 3300042435 | Ga0439434_0035748 | Ga0439434_0035748_138_974 | 276 |
| 301 | 3300044842 | Ga0466957_0002726 | Ga0466957_0002726_2789_3631 | 276 |
| 302 | 3300046522 | Ga0495643_0013690 | Ga0495643_0013690_1336_2181 | 276 |
| 303 | 3300047320 | Ga0495672_0003113 | Ga0495672_0003113_10458_11288 | 276 |
| 304 | 3300047472 | Ga0495686_0016555 | Ga0495686_0016555_686_1525 | 276 |
| 305 | 3300047472 | Ga0495686_0064587 | Ga0495686_0064587_321_1160 | 276 |
| 306 | 3300048904 | Ga0496101_0116598 | Ga0496101_0116598_897_1739 | 276 |
| 307 | 3300049708 | Ga0501245_011720 | Ga0501245_011720_291_1124 | 276 |
| 308 | 3300049744 | Ga0501083_0151337 | Ga0501083_0151337_25_864 | 276 |
| 309 | 3300049758 | Ga0501241_002826 | Ga0501241_002826_1854_2696 | 276 |
| 310 | 3300050493 | nmdc:mga0k408_51102_c1 | nmdc:mga0k408_51102_c1_1222_2052 | 276 |
| 311 | 3300050511 | nmdc:mga08y16_30416_c1 | nmdc:mga08y16_30416_c1_2335_3180 | 276 |
| 312 | 3300053090 | Ga0500646_0050936 | Ga0500646_0050936_38_877 | 276 |
| 313 | 3300053727 | Ga0500611_000031 | Ga0500611_000031_19705_20535 | 276 |
| 314 | 3300000043 | ARcpr5yngRDRAFT_c005374 | ARcpr5yngRDRAFT_0053742 | 277 |
| 315 | 3300003322 | rootL2_10056830 | rootL2_100568302 | 277 |
| 316 | 3300005328 | Ga0070676_10048164 | Ga0070676_100481642 | 277 |
| 317 | 3300005328 | Ga0070676_10145337 | Ga0070676_101453372 | 277 |
| 318 | 3300005329 | Ga0070683_100000423 | Ga0070683_10000042312 | 277 |
| 319 | 3300005329 | Ga0070683_100331386 | Ga0070683_1003313862 | 277 |
| 320 | 3300005330 | Ga0070690_100005732 | Ga0070690_1000057324 | 277 |
| 321 | 3300005334 | Ga0068869_100342650 | Ga0068869_1003426502 | 277 |
| 322 | 3300005335 | Ga0070666_10071587 | Ga0070666_100715872 | 277 |
| 323 | 3300005336 | Ga0070680_100001198 | Ga0070680_1000011986 | 277 |
| 324 | 3300005337 | Ga0070682_100002561 | Ga0070682_1000025615 | 277 |
| 325 | 3300005338 | Ga0068868_100002364 | Ga0068868_1000023648 | 277 |
| 326 | 3300005338 | Ga0068868_100032976 | Ga0068868_1000329765 | 277 |
| 327 | 3300005338 | Ga0068868_100080443 | Ga0068868_1000804433 | 277 |
| 328 | 3300005339 | Ga0070660_100075730 | Ga0070660_1000757301 | 277 |
| 329 | 3300005339 | Ga0070660_100231904 | Ga0070660_1002319042 | 277 |
| 330 | 3300005339 | Ga0070660_100520406 | Ga0070660_1005204061 | 277 |
| 331 | 3300005341 | Ga0070691_10002873 | Ga0070691_100028735 | 277 |
| 332 | 3300005341 | Ga0070691_10048182 | Ga0070691_100481822 | 277 |
| 333 | 3300005344 | Ga0070661_100017005 | Ga0070661_1000170053 | 277 |
| 334 | 3300005354 | Ga0070675_100096796 | Ga0070675_1000967962 | 277 |
| 335 | 3300005355 | Ga0070671_100180369 | Ga0070671_1001803692 | 277 |
| 336 | 3300005365 | Ga0070688_100523708 | Ga0070688_1005237081 | 277 |
| 337 | 3300005366 | Ga0070659_100001674 | Ga0070659_1000016746 | 277 |
| 338 | 3300005367 | Ga0070667_100005006 | Ga0070667_1000050066 | 277 |
| 339 | 3300005456 | Ga0070678_100085913 | Ga0070678_1000859132 | 277 |
| 340 | 3300005457 | Ga0070662_100016747 | Ga0070662_1000167472 | 277 |
| 341 | 3300005457 | Ga0070662_100139539 | Ga0070662_1001395392 | 277 |
| 342 | 3300005458 | Ga0070681_10011430 | Ga0070681_100114303 | 277 |
| 343 | 3300005459 | Ga0068867_100006548 | Ga0068867_1000065483 | 277 |
| 344 | 3300005530 | Ga0070679_100002375 | Ga0070679_10000237510 | 277 |
| 345 | 3300005535 | Ga0070684_100001012 | Ga0070684_1000010124 | 277 |
| 346 | 3300005535 | Ga0070684_100065373 | Ga0070684_1000653733 | 277 |
| 347 | 3300005539 | Ga0068853_100000097 | Ga0068853_10000009718 | 277 |
| 348 | 3300005539 | Ga0068853_100102747 | Ga0068853_1001027472 | 277 |
| 349 | 3300005547 | Ga0070693_100003469 | Ga0070693_1000034693 | 277 |
| 350 | 3300005563 | Ga0068855_100024468 | Ga0068855_1000244686 | 277 |
| 351 | 3300005563 | Ga0068855_100205955 | Ga0068855_1002059552 | 277 |
| 352 | 3300005564 | Ga0070664_100000142 | Ga0070664_10000014237 | 277 |
| 353 | 3300005564 | Ga0070664_100111973 | Ga0070664_1001119732 | 277 |
| 354 | 3300005564 | Ga0070664_100277601 | Ga0070664_1002776012 | 277 |
| 355 | 3300005577 | Ga0068857_100010293 | Ga0068857_1000102937 | 277 |
| 356 | 3300005616 | Ga0068852_100161117 | Ga0068852_1001611173 | 277 |
| 357 | 3300005617 | Ga0068859_100142712 | Ga0068859_1001427122 | 277 |
| 358 | 3300005618 | Ga0068864_100088070 | Ga0068864_1000880702 | 277 |
| 359 | 3300005841 | Ga0068863_100043551 | Ga0068863_1000435511 | 277 |
| 360 | 3300005841 | Ga0068863_100085740 | Ga0068863_1000857403 | 277 |
| 361 | 3300005842 | Ga0068858_100215905 | Ga0068858_1002159051 | 277 |
| 362 | 3300005842 | Ga0068858_100232315 | Ga0068858_1002323152 | 277 |
| 363 | 3300005843 | Ga0068860_100024330 | Ga0068860_1000243302 | 277 |
| 364 | 3300005843 | Ga0068860_100086632 | Ga0068860_1000866322 | 277 |
| 365 | 3300006237 | Ga0097621_100291222 | Ga0097621_1002912222 | 277 |
| 366 | 3300006871 | Ga0075434_100349461 | Ga0075434_1003494611 | 277 |
| 367 | 3300006881 | Ga0068865_100069099 | Ga0068865_1000690993 | 277 |
| 368 | 3300006931 | Ga0097620_100142715 | Ga0097620_1001427152 | 277 |
| 369 | 3300007076 | Ga0075435_100439706 | Ga0075435_1004397062 | 277 |
| 370 | 3300009093 | Ga0105240_10003179 | Ga0105240_100031795 | 277 |
| 371 | 3300009101 | Ga0105247_10161615 | Ga0105247_101616151 | 277 |
| 372 | 3300009147 | Ga0114129_10003132 | Ga0114129_1000313212 | 277 |
| 373 | 3300009174 | Ga0105241_10001894 | Ga0105241_1000189410 | 277 |
| 374 | 3300009174 | Ga0105241_10320592 | Ga0105241_103205921 | 277 |
| 375 | 3300009176 | Ga0105242_10256168 | Ga0105242_102561681 | 277 |
| 376 | 3300010375 | Ga0105239_10162226 | Ga0105239_101622261 | 277 |
| 377 | 3300013100 | Ga0157373_10131443 | Ga0157373_101314431 | 277 |
| 378 | 3300013102 | Ga0157371_10100240 | Ga0157371_101002402 | 277 |
| 379 | 3300013102 | Ga0157371_10109674 | Ga0157371_101096742 | 277 |
| 380 | 3300013104 | Ga0157370_10003505 | Ga0157370_1000350510 | 277 |
| 381 | 3300013296 | Ga0157374_10044715 | Ga0157374_100447153 | 277 |
| 382 | 3300013296 | Ga0157374_10047048 | Ga0157374_100470483 | 277 |
| 383 | 3300013297 | Ga0157378_10002018 | Ga0157378_1000201819 | 277 |
| 384 | 3300013297 | Ga0157378_10040760 | Ga0157378_100407603 | 277 |
| 385 | 3300013297 | Ga0157378_10122119 | Ga0157378_101221192 | 277 |
| 386 | 3300013297 | Ga0157378_10153519 | Ga0157378_101535192 | 277 |
| 387 | 3300013306 | Ga0163162_10005423 | Ga0163162_100054237 | 277 |
| 388 | 3300013307 | Ga0157372_10125821 | Ga0157372_101258212 | 277 |
| 389 | 3300013307 | Ga0157372_10490330 | Ga0157372_104903302 | 277 |
| 390 | 3300013308 | Ga0157375_10033998 | Ga0157375_100339983 | 277 |
| 391 | 3300014325 | Ga0163163_10084622 | Ga0163163_100846224 | 277 |
| 392 | 3300014325 | Ga0163163_10540834 | Ga0163163_105408341 | 277 |
| 393 | 3300014326 | Ga0157380_10065686 | Ga0157380_100656863 | 277 |
| 394 | 3300014745 | Ga0157377_10024518 | Ga0157377_100245183 | 277 |
| 395 | 3300014968 | Ga0157379_10022758 | Ga0157379_100227582 | 277 |
| 396 | 3300014969 | Ga0157376_10018053 | Ga0157376_100180532 | 277 |
| 397 | 3300025899 | Ga0207642_10042814 | Ga0207642_100428143 | 277 |
| 398 | 3300025900 | Ga0207710_10147480 | Ga0207710_101474802 | 277 |
| 399 | 3300025907 | Ga0207645_10005287 | Ga0207645_100052878 | 277 |
| 400 | 3300025911 | Ga0207654_10001235 | Ga0207654_1000123510 | 277 |
| 401 | 3300025912 | Ga0207707_10000449 | Ga0207707_1000044925 | 277 |
| 402 | 3300025913 | Ga0207695_10017744 | Ga0207695_100177443 | 277 |
| 403 | 3300025919 | Ga0207657_10172717 | Ga0207657_101727172 | 277 |
| 404 | 3300025920 | Ga0207649_10001717 | Ga0207649_100017173 | 277 |
| 405 | 3300025921 | Ga0207652_10004718 | Ga0207652_100047185 | 277 |
| 406 | 3300025925 | Ga0207650_10100326 | Ga0207650_101003262 | 277 |
| 407 | 3300025931 | Ga0207644_10197090 | Ga0207644_101970902 | 277 |
| 408 | 3300025931 | Ga0207644_10211048 | Ga0207644_102110482 | 277 |
| 409 | 3300025931 | Ga0207644_10375212 | Ga0207644_103752121 | 277 |
| 410 | 3300025932 | Ga0207690_10254947 | Ga0207690_102549472 | 277 |
| 411 | 3300025933 | Ga0207706_10043838 | Ga0207706_100438384 | 277 |
| 412 | 3300025933 | Ga0207706_10053903 | Ga0207706_100539032 | 277 |
| 413 | 3300025937 | Ga0207669_10034897 | Ga0207669_100348972 | 277 |
| 414 | 3300025938 | Ga0207704_10144079 | Ga0207704_101440792 | 277 |
| 415 | 3300025942 | Ga0207689_10350855 | Ga0207689_103508552 | 277 |
| 416 | 3300025944 | Ga0207661_10000710 | Ga0207661_100007109 | 277 |
| 417 | 3300025945 | Ga0207679_10000408 | Ga0207679_1000040810 | 277 |
| 418 | 3300025945 | Ga0207679_10263109 | Ga0207679_102631092 | 277 |
| 419 | 3300025949 | Ga0207667_10113553 | Ga0207667_101135533 | 277 |
| 420 | 3300025960 | Ga0207651_10160245 | Ga0207651_101602452 | 277 |
| 421 | 3300025981 | Ga0207640_10559089 | Ga0207640_105590891 | 277 |
| 422 | 3300025986 | Ga0207658_10117466 | Ga0207658_101174661 | 277 |
| 423 | 3300025986 | Ga0207658_10185065 | Ga0207658_101850652 | 277 |
| 424 | 3300026023 | Ga0207677_10007017 | Ga0207677_100070174 | 277 |
| 425 | 3300026023 | Ga0207677_10008637 | Ga0207677_100086374 | 277 |
| 426 | 3300026023 | Ga0207677_10278247 | Ga0207677_102782471 | 277 |
| 427 | 3300026041 | Ga0207639_10002038 | Ga0207639_100020389 | 277 |
| 428 | 3300026067 | Ga0207678_10115826 | Ga0207678_101158262 | 277 |
| 429 | 3300026088 | Ga0207641_10034790 | Ga0207641_100347902 | 277 |
| 430 | 3300026089 | Ga0207648_10020340 | Ga0207648_100203405 | 277 |
| 431 | 3300026089 | Ga0207648_10367638 | Ga0207648_103676381 | 277 |
| 432 | 3300026116 | Ga0207674_10169867 | Ga0207674_101698672 | 277 |
| 433 | 3300026116 | Ga0207674_10403057 | Ga0207674_104030572 | 277 |
| 434 | 3300026121 | Ga0207683_10042167 | Ga0207683_100421673 | 277 |
| 435 | 3300028381 | Ga0268264_10026579 | Ga0268264_100265792 | 277 |
| 436 | 3300030521 | Ga0307511_10005062 | Ga0307511_1000506210 | 277 |
| 437 | 3300031456 | Ga0307513_10046322 | Ga0307513_100463225 | 277 |
| 438 | 3300031507 | Ga0307509_10134640 | Ga0307509_101346402 | 277 |
| 439 | 3300031616 | Ga0307508_10000923 | Ga0307508_1000092326 | 277 |
| 440 | 3300031731 | Ga0307405_10185962 | Ga0307405_101859621 | 277 |
| 441 | 3300031824 | Ga0307413_10261997 | Ga0307413_102619971 | 277 |
| 442 | 3300031852 | Ga0307410_10132971 | Ga0307410_101329711 | 277 |
| 443 | 3300032002 | Ga0307416_100148598 | Ga0307416_1001485982 | 277 |
| 444 | 3300032005 | Ga0307411_10044571 | Ga0307411_100445711 | 277 |
| 445 | 3300032126 | Ga0307415_100291895 | Ga0307415_1002918952 | 277 |
| 446 | 3300035724 | Ga0373933_0033678 | Ga0373933_0033678_1089_1922 | 277 |
| 447 | 3300036401 | Ga0373937_0021441 | Ga0373937_0021441_2148_2981 | 277 |
| 448 | 3300038443 | Ga0395901_0587851 | Ga0395901_0587851_141_1043 | 277 |
| 449 | 3300041509 | Ga0451843_1500914 | Ga0451843_1500914_149_982 | 277 |
| 450 | 3300041999 | Ga0439433_0004931 | Ga0439433_0004931_650_1486 | 277 |
| 451 | 3300042007 | Ga0439449_0002640 | Ga0439449_0002640_4563_5399 | 277 |
| 452 | 3300042015 | Ga0439462_0028350 | Ga0439462_0028350_622_1458 | 277 |
| 453 | 3300044901 | Ga0466960_0248773 | Ga0466960_0248773_123_962 | 277 |
| 454 | 3300046516 | Ga0495628_0009804 | Ga0495628_0009804_3547_4380 | 277 |
| 455 | 3300046517 | Ga0495630_0009666 | Ga0495630_0009666_1308_2141 | 277 |
| 456 | 3300046529 | Ga0495652_0037370 | Ga0495652_0037370_1707_2540 | 277 |
| 457 | 3300046536 | Ga0495587_0066727 | Ga0495587_0066727_57_890 | 277 |
| 458 | 3300046543 | Ga0495645_0153481 | Ga0495645_0153481_722_1555 | 277 |
| 459 | 3300046559 | Ga0495667_0084341 | Ga0495667_0084341_683_1516 | 277 |
| 460 | 3300046642 | Ga0495634_0011993 | Ga0495634_0011993_4433_5266 | 277 |
| 461 | 3300046675 | Ga0495657_0038927 | Ga0495657_0038927_2051_2884 | 277 |
| 462 | 3300046694 | Ga0495649_0074992 | Ga0495649_0074992_804_1637 | 277 |
| 463 | 3300047317 | Ga0495604_0100242 | Ga0495604_0100242_1164_1997 | 277 |
| 464 | 3300047322 | Ga0495680_0148764 | Ga0495680_0148764_614_1447 | 277 |
| 465 | 3300049521 | Ga0501298_001590 | Ga0501298_001590_2200_3036 | 277 |
| 466 | 3300049568 | Ga0501031_0009520 | Ga0501031_0009520_4534_5367 | 277 |
| 467 | 3300049572 | Ga0501036_0079314 | Ga0501036_0079314_668_1501 | 277 |
| 468 | 3300049574 | Ga0501038_0003678 | Ga0501038_0003678_8517_9350 | 277 |
| 469 | 3300049575 | Ga0501039_0008667 | Ga0501039_0008667_3758_4591 | 277 |
| 470 | 3300049579 | Ga0501043_0075074 | Ga0501043_0075074_203_1039 | 277 |
| 471 | 3300049581 | Ga0501047_0378215 | Ga0501047_0378215_217_1050 | 277 |
| 472 | 3300049583 | Ga0501067_0041755 | Ga0501067_0041755_1406_2242 | 277 |
| 473 | 3300049588 | Ga0501072_0374565 | Ga0501072_0374565_130_963 | 277 |
| 474 | 3300049589 | Ga0501073_0098502 | Ga0501073_0098502_227_1063 | 277 |
| 475 | 3300049651 | Ga0501201_000885 | Ga0501201_000885_1705_2541 | 277 |
| 476 | 3300049652 | Ga0501202_021000 | Ga0501202_021000_379_1215 | 277 |
| 477 | 3300049662 | Ga0501222_005775 | Ga0501222_005775_530_1366 | 277 |
| 478 | 3300049663 | Ga0501223_005703 | Ga0501223_005703_764_1600 | 277 |
| 479 | 3300049663 | Ga0501223_020859 | Ga0501223_020859_144_980 | 277 |
| 480 | 3300049669 | Ga0501235_014029 | Ga0501235_014029_726_1562 | 277 |
| 481 | 3300049673 | Ga0501240_010582 | Ga0501240_010582_248_1084 | 277 |
| 482 | 3300049675 | Ga0501243_003948 | Ga0501243_003948_704_1540 | 277 |
| 483 | 3300049688 | Ga0501259_001100 | Ga0501259_001100_1758_2594 | 277 |
| 484 | 3300049688 | Ga0501259_013269 | Ga0501259_013269_450_1286 | 277 |
| 485 | 3300049690 | Ga0501261_006403 | Ga0501261_006403_534_1370 | 277 |
| 486 | 3300049704 | Ga0501221_002410 | Ga0501221_002410_1780_2616 | 277 |
| 487 | 3300049705 | Ga0501225_0007109 | Ga0501225_0007109_2259_3095 | 277 |
| 488 | 3300049708 | Ga0501245_001286 | Ga0501245_001286_2326_3162 | 277 |
| 489 | 3300049742 | Ga0501080_0492867 | Ga0501080_0492867_118_951 | 277 |
| 490 | 3300049742 | Ga0501080_0522921 | Ga0501080_0522921_37_873 | 277 |
| 491 | 3300049744 | Ga0501083_0090609 | Ga0501083_0090609_342_1178 | 277 |
| 492 | 3300049758 | Ga0501241_022343 | Ga0501241_022343_253_1089 | 277 |
| 493 | 3300049823 | Ga0501044_0608498 | Ga0501044_0608498_118_954 | 277 |
| 494 | 3300049851 | Ga0501212_005665 | Ga0501212_005665_269_1105 | 277 |
| 495 | 3300050507 | nmdc:mga05p37_6756_c1 | nmdc:mga05p37_6756_c1_1521_2366 | 277 |
| 496 | 3300050512 | nmdc:mga0n895_17682_c1 | nmdc:mga0n895_17682_c1_1928_2761 | 277 |
| 497 | 3300053085 | Ga0495619_0117673 | Ga0495619_0117673_561_1394 | 277 |
| 498 | 3300053146 | Ga0500588_0020601 | Ga0500588_0020601_844_1677 | 277 |
| 499 | 3300053153 | Ga0500616_0005546 | Ga0500616_0005546_1284_2117 | 277 |
| 500 | 3300054114 | Ga0501084_0153034 | Ga0501084_0153034_380_1216 | 277 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2avp-assembly1.cif.gz_A | crystal structure of an 8 repeat consensus tpr superhelix | 0.98 | 195 | 256 |
| 5lyn-assembly1.cif.gz_B | structure of the tpr domain of sgt2 in complex with yeast ssa1 peptide fragment | 0.9773 | 195 | 256 |
| 4ja7-assembly1.cif.gz_A | rat pp5 co-crystallized with p5sa-2 | 0.9724 | 195 | 258 |
| 8fwd-assembly1.cif.gz_0 | fast and versatile sequence- independent protein docking for nanomaterials design using rpxdock | 0.971 | 195 | 256 |
| 2vyi-assembly2.cif.gz_B | crystal structure of the tpr domain of human sgt | 0.969 | 195 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E7F2R1_574_748_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9889 | 195 | 256 | 1.25.40.10 |
| af_Q54DA8_379_491_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9882 | 195 | 256 | 1.25.40.10 |
| af_Q49AM3_302_415_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9871 | 195 | 256 | 1.25.40.10 |
| af_Q6PGP7_564_723_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9862 | 195 | 256 | 1.25.40.10 |
| af_A0A144A2J9_376_497_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9831 | 195 | 256 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C1LWV8-F1-model_v4 | DUF2911 domain-containing protein | 0.9599 | 72 | 175 |
|
| AF-A0A090VRC2-F1-model_v4 | DUF2911 domain-containing protein | 0.9589 | 67 | 174 |
|
| AF-A0A2V8UUE4-F1-model_v4 | DUF2911 domain-containing protein | 0.9422 | 83 | 175 |
|
| AF-A0A090VRC2-F1-model_v4 | DUF2911 domain-containing protein | 0.9418 | 67 | 174 |
|
| AF-A0A7Y4WZA8-F1-model_v4 | DUF2911 domain-containing protein | 0.9412 | 28 | 175 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar