F455261

General Info

Members Datasets Scaffolds Average Seq Length
498 293 996 152

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0578272|Ga0496109_0578272_417_941
Length 174
Sequence LRTEPAVPSPAEVPAERPPRLLWRLTAVRHAQRAYTGEGARLYGGRWNHPGVPLVYTSLTLSLAALELFVHLDGDIAPDHLAARAAELPGDLAIPVLEIADLPGNWRTYPAPERLKDLGTAWARSGASLALSVPSAVVPRERNVLLSPAHPDFARLRVLPPEGFSFDPRMWKGK

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
165 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
203 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
204 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
208 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
209 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
280 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
285 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
286 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
287 2738543023 Pedobacter sp. OK628 Isolate Unclassified
288 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
289 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
290 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
291 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
292 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
293 2919688452 Pararheinheimera soli 4138 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 0
Isolates 2.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 3.01
Rhizosphere 91.37
Stem 0
Stem Tuber 0
Unclassified 25.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0578272 3300048912 Bacteria 1059
2 JGI24735J21928_10001896 3300002067 Bacteria 7340
3 JGI24744J21845_10009370 3300002077 Bacteria 2009
4 rootL2_10382749 3300003322 Unclassified 1114
5 rootH1_10086282 3300003323 Bacteria 2473
6 rootH1_10151173 3300003323 Bacteria 2667
7 Ga0065715_10323141 3300005293 Unclassified 998
8 Ga0070658_10019649 3300005327 Bacteria 5409
9 Ga0070658_10087431 3300005327 Unclassified 2565
10 Ga0070658_10165329 3300005327 Bacteria 1857
11 Ga0070676_10693337 3300005328 Unclassified 743
12 Ga0070676_10928784 3300005328 Bacteria 649
13 Ga0070690_100026821 3300005330 Bacteria 3557
14 Ga0070690_100184106 3300005330 Unclassified 1444
15 Ga0070690_100265331 3300005330 Bacteria 1219
16 Ga0070670_100003636 3300005331 Bacteria 12842
17 Ga0070670_100952553 3300005331 Bacteria 779
18 Ga0070670_101024876 3300005331 Unclassified 751
19 Ga0070677_10004548 3300005333 Bacteria 4530
20 Ga0070666_10000468 3300005335 Bacteria 24401
21 Ga0070666_10068426 3300005335 Unclassified 2413
22 Ga0070680_100001989 3300005336 Bacteria 15039
23 Ga0070680_100961191 3300005336 Unclassified 737
24 Ga0070680_101437912 3300005336 Bacteria 597
25 Ga0070682_100000010 3300005337 Bacteria 280957
26 Ga0070682_100002487 3300005337 Bacteria 10181
27 Ga0070660_100536577 3300005339 Bacteria 975
28 Ga0070689_100014564 3300005340 Bacteria 5715
29 Ga0070689_100016783 3300005340 Bacteria 5365
30 Ga0070689_100674015 3300005340 Unclassified 901
31 Ga0070689_101512503 3300005340 Unclassified 608
32 Ga0070691_10003740 3300005341 Bacteria 6870
33 Ga0070687_100381062 3300005343 Unclassified 919
34 Ga0070687_100414917 3300005343 Bacteria 886
35 Ga0070668_100075983 3300005347 Unclassified 2623
36 Ga0070669_100000592 3300005353 Bacteria 26958
37 Ga0070669_100214589 3300005353 Bacteria 1519
38 Ga0070669_100402474 3300005353 Unclassified 1120
39 Ga0070675_100054754 3300005354 Unclassified 3282
40 Ga0070675_100393413 3300005354 Unclassified 1235
41 Ga0070675_100447359 3300005354 Unclassified 1158
42 Ga0070674_100032176 3300005356 Unclassified 3481
43 Ga0070674_100079684 3300005356 Bacteria 2337
44 Ga0070673_100008656 3300005364 Bacteria 6781
45 Ga0070673_100074723 3300005364 Bacteria 2732
46 Ga0070673_100445371 3300005364 Bacteria 1164
47 Ga0070688_100036681 3300005365 Bacteria 2983
48 Ga0070659_100069452 3300005366 Bacteria 2796
49 Ga0070667_100000933 3300005367 Bacteria 26935
50 Ga0070709_10167156 3300005434 Bacteria 1534
51 Ga0070714_100009086 3300005435 Bacteria 7793
52 Ga0070714_101158180 3300005435 Bacteria 754
53 Ga0070710_10303052 3300005437 Unclassified 1043
54 Ga0070711_100012155 3300005439 Bacteria 5372
55 Ga0070705_100059743 3300005440 Bacteria 2258
56 Ga0070700_100060583 3300005441 Unclassified 2386
57 Ga0070694_100218863 3300005444 Unclassified 1427
58 Ga0070694_100254495 3300005444 Unclassified 1330
59 Ga0070708_100216583 3300005445 Unclassified 1795
60 Ga0070663_100020844 3300005455 Bacteria 4346
61 Ga0070663_100104492 3300005455 Unclassified 2119
62 Ga0070663_100816961 3300005455 Unclassified 800
63 Ga0070678_100226609 3300005456 Bacteria 1556
64 Ga0070678_100292517 3300005456 Bacteria 1381
65 Ga0070662_100280810 3300005457 Bacteria 1348
66 Ga0070662_100585872 3300005457 Unclassified 937
67 Ga0070681_10006547 3300005458 Bacteria 11339
68 Ga0070681_10346928 3300005458 Unclassified 1395
69 Ga0068867_100007908 3300005459 Bacteria 7512
70 Ga0068867_100009570 3300005459 Bacteria 6833
71 Ga0070685_10024577 3300005466 Bacteria 3310
72 Ga0070685_10290300 3300005466 Unclassified 1098
73 Ga0070685_10549786 3300005466 Bacteria 824
74 Ga0070706_100260826 3300005467 Bacteria 1618
75 Ga0070707_100315966 3300005468 Bacteria 1518
76 Ga0070707_100939507 3300005468 Unclassified 830
77 Ga0070698_101026048 3300005471 Unclassified 772
78 Ga0070699_100152750 3300005518 Unclassified 2043
79 Ga0070699_100284768 3300005518 Bacteria 1481
80 Ga0070679_100048063 3300005530 Bacteria 4252
81 Ga0070684_100206791 3300005535 Bacteria 1789
82 Ga0070684_100256671 3300005535 Unclassified 1598
83 Ga0070684_101217273 3300005535 Unclassified 708
84 Ga0070684_101362175 3300005535 Bacteria 668
85 Ga0068853_100022286 3300005539 Bacteria 5289
86 Ga0070672_100098148 3300005543 Bacteria 2372
87 Ga0070672_100158447 3300005543 Bacteria 1876
88 Ga0070672_100334255 3300005543 Unclassified 1289
89 Ga0070672_101833806 3300005543 Unclassified 545
90 Ga0070686_100125113 3300005544 Bacteria 1770
91 Ga0070686_100524079 3300005544 Unclassified 923
92 Ga0070695_100326568 3300005545 Bacteria 1142
93 Ga0070695_100361763 3300005545 Bacteria 1090
94 Ga0070695_101008563 3300005545 Bacteria 677
95 Ga0070693_100027059 3300005547 Bacteria 3103
96 Ga0070693_100031406 3300005547 Bacteria 2910
97 Ga0070665_100001037 3300005548 Bacteria 34807
98 Ga0070665_100004988 3300005548 Bacteria 13769
99 Ga0070665_100005270 3300005548 Bacteria 13362
100 Ga0070704_100423711 3300005549 Bacteria 1140
101 Ga0070704_100864360 3300005549 Unclassified 811
102 Ga0068855_100056423 3300005563 Bacteria 4609
103 Ga0070664_100179359 3300005564 Unclassified 1882
104 Ga0070664_100213688 3300005564 Bacteria 1724
105 Ga0070664_100714634 3300005564 Bacteria 934
106 Ga0068854_100164862 3300005578 Bacteria 1719
107 Ga0068856_100007207 3300005614 Bacteria 10847
108 Ga0068856_100376872 3300005614 Unclassified 1438
109 Ga0068859_100009101 3300005617 Bacteria 10028
110 Ga0068859_101973822 3300005617 Unclassified 644
111 Ga0068864_100066424 3300005618 Bacteria 3130
112 Ga0068864_100077212 3300005618 Bacteria 2912
113 Ga0068864_100126776 3300005618 Bacteria 2288
114 Ga0068861_100339823 3300005719 Bacteria 1314
115 Ga0068870_10017245 3300005840 Bacteria 3466
116 Ga0068863_100419547 3300005841 Bacteria 1311
117 Ga0068863_101160540 3300005841 Bacteria 778
118 Ga0068858_100000173 3300005842 Bacteria 68371
119 Ga0068858_100081104 3300005842 Bacteria 3015
120 Ga0068858_100698370 3300005842 Bacteria 987
121 Ga0068858_101676695 3300005842 Unclassified 628
122 Ga0068860_100000332 3300005843 Bacteria 64247
123 Ga0068860_100319885 3300005843 Unclassified 1523
124 Ga0068862_100146758 3300005844 Unclassified 2097
125 Ga0068862_100638835 3300005844 Bacteria 1025
126 Ga0068862_100894939 3300005844 Unclassified 872
127 Ga0081538_10034193 3300005981 Bacteria 3365
128 Ga0081540_1041602 3300005983 Bacteria 2380
129 Ga0070717_10000116 3300006028 Bacteria 62656
130 Ga0070716_100290473 3300006173 Unclassified 1132
131 Ga0097621_100186324 3300006237 Bacteria 1795
132 Ga0068871_100101177 3300006358 Unclassified 2415
133 Ga0068871_100681638 3300006358 Bacteria 940
134 Ga0075428_100172076 3300006844 Bacteria 2347
135 Ga0075431_100100203 3300006847 Plasmid 2989
136 Ga0075433_10002512 3300006852 Bacteria 13955
137 Ga0075434_100007957 3300006871 Bacteria 9825
138 Ga0075434_101068420 3300006871 Unclassified 821
139 Ga0075434_101140930 3300006871 Unclassified 792
140 Ga0068865_100052764 3300006881 Bacteria 2819
141 Ga0068865_100179489 3300006881 Bacteria 1629
142 Ga0068865_100792818 3300006881 Unclassified 817
143 Ga0075436_100002494 3300006914 Bacteria 12662
144 Ga0075436_100008579 3300006914 Bacteria 6984
145 Ga0097620_100009100 3300006931 Bacteria 10028
146 Ga0097620_101974065 3300006931 Unclassified 644
147 Ga0075435_100011915 3300007076 Bacteria 6421
148 Ga0075435_100014339 3300007076 Bacteria 5920
149 Ga0075435_100020667 3300007076 Bacteria 5052
150 Ga0075435_100252148 3300007076 Unclassified 1503
151 Ga0075435_100404301 3300007076 Bacteria 1175
152 Ga0075435_101151934 3300007076 Unclassified 678
153 Ga0099794_10047895 3300007265 Unclassified 2051
154 Ga0099795_10064345 3300007788 Bacteria 1369
155 Ga0105240_10002143 3300009093 Bacteria 32241
156 Ga0105240_11593325 3300009093 Unclassified 683
157 Ga0105240_11741406 3300009093 Bacteria 650
158 Ga0111539_10108937 3300009094 Bacteria 3251
159 Ga0105245_10002774 3300009098 Bacteria 15755
160 Ga0105245_10008519 3300009098 Bacteria 8943
161 Ga0105245_10053121 3300009098 Bacteria 3636
162 Ga0105245_10079274 3300009098 Bacteria 2998
163 Ga0105245_12809720 3300009098 Unclassified 539
164 Ga0105247_10186015 3300009101 Bacteria 1389
165 Ga0114129_10179672 3300009147 Bacteria 2881
166 Ga0114129_10820307 3300009147 Bacteria 1185
167 Ga0114129_12383422 3300009147 Unclassified 634
168 Ga0105241_10000785 3300009174 Bacteria 24123
169 Ga0105248_12114933 3300009177 Unclassified 640
170 Ga0105237_10030430 3300009545 Bacteria 5483
171 Ga0105238_12322898 3300009551 Unclassified 571
172 Ga0105249_10044314 3300009553 Bacteria 4046
173 Ga0105249_10510805 3300009553 Bacteria 1248
174 Ga0105249_11123079 3300009553 Unclassified 856
175 Ga0099796_10205386 3300010159 Unclassified 801
176 Ga0105239_11063595 3300010375 Bacteria 931
177 Ga0105246_11035567 3300011119 Unclassified 745
178 Ga0157373_10001243 3300013100 Bacteria 19483
179 Ga0157373_10023270 3300013100 Bacteria 4492
180 Ga0157371_11031016 3300013102 Unclassified 629
181 Ga0157370_10000092 3300013104 Bacteria 101669
182 Ga0157370_10006791 3300013104 Bacteria 12551
183 Ga0157370_10660564 3300013104 Bacteria 955
184 Ga0157370_11079407 3300013104 Bacteria 726
185 Ga0157369_10027291 3300013105 Bacteria 6331
186 Ga0157369_10203285 3300013105 Unclassified 2078
187 Ga0157369_10669815 3300013105 Bacteria 1069
188 Ga0157374_11735272 3300013296 Unclassified 649
189 Ga0157378_10062244 3300013297 Bacteria 3332
190 Ga0157378_10505433 3300013297 Bacteria 1208
191 Ga0157378_10825715 3300013297 Bacteria 954
192 Ga0163162_10008021 3300013306 Bacteria 10302
193 Ga0163162_10770027 3300013306 Bacteria 1081
194 Ga0157372_12747759 3300013307 Unclassified 565
195 Ga0157375_10000316 3300013308 Bacteria 43333
196 Ga0157375_10000738 3300013308 Bacteria 28750
197 Ga0157375_11055559 3300013308 Unclassified 950
198 Ga0157375_11085291 3300013308 Bacteria 937
199 Ga0163163_10102475 3300014325 Bacteria 2886
200 Ga0163163_10805524 3300014325 Bacteria 1003
201 Ga0157380_10091968 3300014326 Bacteria 2506
202 Ga0157380_10101102 3300014326 Unclassified 2402
203 Ga0157380_10734146 3300014326 Unclassified 997
204 Ga0157380_11639680 3300014326 Unclassified 699
205 Ga0157380_11710023 3300014326 Unclassified 687
206 Ga0157377_10285985 3300014745 Bacteria 1083
207 Ga0157379_10005899 3300014968 Bacteria 10542
208 Ga0157376_10008253 3300014969 Bacteria 7501
209 Ga0163161_10091207 3300017792 Unclassified 2255
210 Ga0213874_10308530 3300021377 Unclassified 597
211 Ga0213875_10036233 3300021388 Bacteria 2326
212 Ga0207697_10008552 3300025315 Bacteria 4471
213 Ga0207682_10003618 3300025893 Bacteria 6674
214 Ga0207688_10249058 3300025901 Bacteria 1076
215 Ga0207688_10379929 3300025901 Unclassified 874
216 Ga0207680_10005994 3300025903 Bacteria 5844
217 Ga0207680_10415209 3300025903 Bacteria 952
218 Ga0207647_10259854 3300025904 Bacteria 994
219 Ga0207645_10014084 3300025907 Bacteria 5359
220 Ga0207645_10537061 3300025907 Unclassified 793
221 Ga0207643_10006968 3300025908 Bacteria 6063
222 Ga0207705_10031419 3300025909 Bacteria 3791
223 Ga0207705_10046924 3300025909 Unclassified 3106
224 Ga0207654_10004216 3300025911 Bacteria 7257
225 Ga0207707_10001095 3300025912 Bacteria 25842
226 Ga0207695_10020335 3300025913 Bacteria 7607
227 Ga0207695_10621897 3300025913 Unclassified 961
228 Ga0207695_11021752 3300025913 Unclassified 706
229 Ga0207671_10080864 3300025914 Bacteria 2436
230 Ga0207663_10144644 3300025916 Unclassified 1660
231 Ga0207660_10018758 3300025917 Bacteria 4617
232 Ga0207657_10978540 3300025919 Bacteria 650
233 Ga0207657_11003459 3300025919 Unclassified 640
234 Ga0207652_10004110 3300025921 Bacteria 11877
235 Ga0207681_10000021 3300025923 Bacteria 236982
236 Ga0207681_10153458 3300025923 Bacteria 1728
237 Ga0207681_10259344 3300025923 Unclassified 1360
238 Ga0207650_10211564 3300025925 Bacteria 1557
239 Ga0207650_10450004 3300025925 Bacteria 1072
240 Ga0207659_10201174 3300025926 Bacteria 1591
241 Ga0207659_10340668 3300025926 Unclassified 1242
242 Ga0207659_10376594 3300025926 Unclassified 1183
243 Ga0207659_10487486 3300025926 Bacteria 1042
244 Ga0207659_10490276 3300025926 Bacteria 1039
245 Ga0207687_10000895 3300025927 Bacteria 20256
246 Ga0207687_10001951 3300025927 Bacteria 14193
247 Ga0207687_10473754 3300025927 Unclassified 1041
248 Ga0207687_11672956 3300025927 Unclassified 546
249 Ga0207700_10003343 3300025928 Bacteria 9299
250 Ga0207690_10215084 3300025932 Bacteria 1468
251 Ga0207706_10014460 3300025933 Bacteria 7152
252 Ga0207670_10004678 3300025936 Bacteria 7419
253 Ga0207670_10055802 3300025936 Bacteria 2671
254 Ga0207670_10245062 3300025936 Bacteria 1382
255 Ga0207670_10496180 3300025936 Unclassified 991
256 Ga0207669_10089389 3300025937 Bacteria 2000
257 Ga0207669_10537062 3300025937 Bacteria 941
258 Ga0207704_10047479 3300025938 Bacteria 2567
259 Ga0207665_10138445 3300025939 Bacteria 1734
260 Ga0207691_10001234 3300025940 Bacteria 25513
261 Ga0207691_10008481 3300025940 Bacteria 9870
262 Ga0207691_10419302 3300025940 Bacteria 1141
263 Ga0207691_11222487 3300025940 Unclassified 622
264 Ga0207661_11030600 3300025944 Bacteria 758
265 Ga0207679_10185419 3300025945 Bacteria 1725
266 Ga0207679_10518889 3300025945 Bacteria 1065
267 Ga0207667_10036187 3300025949 Bacteria 5292
268 Ga0207667_10373963 3300025949 Bacteria 1452
269 Ga0207651_10021474 3300025960 Bacteria 3925
270 Ga0207651_10279312 3300025960 Bacteria 1379
271 Ga0207651_10369435 3300025960 Bacteria 1213
272 Ga0207651_11000105 3300025960 Bacteria 747
273 Ga0207712_10474365 3300025961 Bacteria 1065
274 Ga0207668_10224972 3300025972 Unclassified 1509
275 Ga0207668_11475482 3300025972 Bacteria 613
276 Ga0207640_10477426 3300025981 Bacteria 1033
277 Ga0207658_10017762 3300025986 Bacteria 4901
278 Ga0207703_10000196 3300026035 Bacteria 70463
279 Ga0207703_10017929 3300026035 Bacteria 5529
280 Ga0207703_11423831 3300026035 Unclassified 667
281 Ga0207639_10010679 3300026041 Bacteria 6360
282 Ga0207678_10033071 3300026067 Bacteria 4506
283 Ga0207678_10288864 3300026067 Bacteria 1408
284 Ga0207708_10044060 3300026075 Bacteria 3400
285 Ga0207702_10019256 3300026078 Bacteria 5647
286 Ga0207702_10326918 3300026078 Unclassified 1462
287 Ga0207641_10039789 3300026088 Bacteria 3933
288 Ga0207641_10657284 3300026088 Bacteria 1030
289 Ga0207648_10009036 3300026089 Bacteria 9586
290 Ga0207648_10013181 3300026089 Bacteria 7703
291 Ga0207676_10103379 3300026095 Bacteria 2367
292 Ga0207676_10110525 3300026095 Bacteria 2299
293 Ga0207676_10144778 3300026095 Bacteria 2039
294 Ga0207675_100037123 3300026118 Bacteria 4545
295 Ga0207683_10009080 3300026121 Bacteria 8471
296 Ga0268266_10001955 3300028379 Bacteria 23162
297 Ga0268265_10128402 3300028380 Unclassified 2102
298 Ga0268264_10009001 3300028381 Bacteria 8282
299 Ga0268264_11024810 3300028381 Bacteria 832
300 Ga0265326_10002271 3300028558 Bacteria 6508
301 Ga0307515_10000092 3300028794 Bacteria 212425
302 Ga0265338_10082734 3300028800 Bacteria 2687
303 Ga0265324_10147072 3300029957 Unclassified 800
304 Ga0265324_10151565 3300029957 Bacteria 787
305 Ga0307511_10024468 3300030521 Bacteria 5595
306 Ga0265332_10051539 3300031238 Unclassified 1768
307 Ga0265320_10043254 3300031240 Bacteria 2228
308 Ga0265325_10018112 3300031241 Bacteria 3906
309 Ga0265340_10054793 3300031247 Bacteria 1923
310 Ga0265339_10005340 3300031249 Bacteria 8556
311 Ga0265339_10036005 3300031249 Bacteria 2771
312 Ga0265327_10262833 3300031251 Bacteria 766
313 Ga0265316_10074188 3300031344 Bacteria 2619
314 Ga0265316_10083229 3300031344 Unclassified 2451
315 Ga0307513_10359188 3300031456 Unclassified 1202
316 Ga0307408_100000017 3300031548 Bacteria 355890
317 Ga0265313_10154474 3300031595 Bacteria 978
318 Ga0265314_10073623 3300031711 Bacteria 2277
319 Ga0265314_10694231 3300031711 Bacteria 515
320 Ga0316576_10684985 3300031727 Unclassified 744
321 Ga0307405_10501757 3300031731 Unclassified 973
322 Ga0316577_10015057 3300031733 Unclassified 4251
323 Ga0307413_10053349 3300031824 Bacteria 2447
324 Ga0307413_10324158 3300031824 Bacteria 1178
325 Ga0307413_11085754 3300031824 Bacteria 690
326 Ga0307410_10000096 3300031852 Bacteria 30297
327 Ga0307407_10007423 3300031903 Bacteria 4965
328 Ga0307409_100000090 3300031995 Bacteria 32438
329 Ga0307416_100000034 3300032002 Bacteria 155632
330 Ga0307416_102107760 3300032002 Bacteria 666
331 Ga0307411_10139895 3300032005 Bacteria 1783
332 Ga0307415_101225068 3300032126 Bacteria 708
333 Ga0316580_10032773 3300032139 Bacteria 1608
334 Ga0373945_0023469 3300035116 Bacteria 2131
335 Ga0373945_0059585 3300035116 Unclassified 1422
336 Ga0373943_0911349 3300035170 Unclassified 525
337 Ga0373946_0141684 3300035171 Bacteria 1115
338 Ga0373935_0047539 3300035692 Bacteria 2714
339 Ga0373935_0059582 3300035692 Plasmid 2441
340 Ga0373927_0063423 3300035695 Bacteria 2390
341 Ga0373947_0039319 3300035725 Bacteria 2814
342 Ga0373947_0142987 3300035725 Unclassified 1536
343 Ga0373937_0147572 3300036401 Bacteria 2202
344 Ga0373937_1532539 3300036401 Unclassified 614
345 Ga0316582_0008226 3300036647 Bacteria 5594
346 Ga0316582_0142366 3300036647 Bacteria 1617
347 Ga0373925_0055982 3300037068 Bacteria 2953
348 Ga0373925_0300273 3300037068 Bacteria 1296
349 Ga0373925_0371583 3300037068 Bacteria 1163
350 Ga0395899_0497078 3300037312 Bacteria 792
351 Ga0395900_0288063 3300037418 Bacteria 1632
352 Ga0395905_0054307 3300037471 Bacteria 3749
353 Ga0316581_0080583 3300037588 Unclassified 1001
354 Ga0436364_0070910 3300037853 Bacteria 1254
355 Ga0436364_0195633 3300037853 Bacteria 2749
356 Ga0436364_0610994 3300037853 Bacteria 6758
357 Ga0400485_17332 3300038735 Bacteria 1366
358 Ga0400488_53871 3300038741 Bacteria 5721
359 Ga0400486_17491 3300038742 Bacteria 1625
360 Ga0436365_1341648 3300039437 Bacteria 705
361 Ga0436365_1403723 3300039437 Bacteria 1110
362 Ga0436365_1470772 3300039437 Bacteria 978
363 Ga0436363_0362871 3300039450 Unclassified 1064
364 Ga0436363_1339355 3300039450 Bacteria 1782
365 Ga0451802_0649758 3300041460 Bacteria 831
366 Ga0451837_0155546 3300041494 Bacteria 5893
367 Ga0439441_000391 3300042001 Bacteria 4586
368 Ga0451577_0200668 3300042876 Bacteria 1801
369 Ga0451577_0744984 3300042876 Bacteria 886
370 Ga0466969_0286974 3300044656 Bacteria 745
371 Ga0466963_0022084 3300044694 Unclassified 4026
372 Ga0466963_0141744 3300044694 Bacteria 1665
373 Ga0466963_0513002 3300044694 Unclassified 846
374 Ga0466971_0298803 3300044719 Bacteria 773
375 Ga0466957_0261513 3300044842 Unclassified 1153
376 Ga0466959_0527442 3300045049 Bacteria 797
377 Ga0466959_0844132 3300045049 Unclassified 612
378 Ga0451576_0118611 3300045051 Bacteria 2755
379 Ga0466958_0259431 3300045836 Unclassified 1112
380 Ga0466967_0004648 3300045976 Bacteria 9313
381 Ga0466967_0336551 3300045976 Bacteria 1459
382 Ga0466967_0696381 3300045976 Unclassified 1006
383 Ga0495629_0001612 3300046459 Bacteria 17724
384 Ga0495650_0092524 3300046471 Bacteria 1148
385 Ga0495662_0039490 3300046476 Bacteria 2280
386 Ga0495594_0433068 3300046499 Bacteria 748
387 Ga0495628_0001060 3300046516 Bacteria 25206
388 Ga0495630_0126436 3300046517 Unclassified 1940
389 Ga0495652_0381717 3300046529 Bacteria 1002
390 Ga0495645_0158255 3300046543 Unclassified 1568
391 Ga0495667_0628431 3300046559 Unclassified 668
392 Ga0495613_0483631 3300046689 Bacteria 835
393 Ga0495674_0461993 3300047319 Bacteria 1019
394 Ga0495675_0333818 3300047444 Bacteria 895
395 Ga0495673_0003542 3300047469 Bacteria 10276
396 Ga0496100_0014759 3300048903 Bacteria 4544
397 Ga0496100_0969861 3300048903 Bacteria 669
398 Ga0496101_0178735 3300048904 Bacteria 1633
399 Ga0496102_0003676 3300048905 Bacteria 12971
400 Ga0496103_0108033 3300048906 Bacteria 1765
401 Ga0496104_0069476 3300048907 Bacteria 3348
402 Ga0496106_0339385 3300048909 Bacteria 1206
403 Ga0496107_0272990 3300048910 Bacteria 1258
404 Ga0496108_0057825 3300048911 Bacteria 3258
405 Ga0496109_0100633 3300048912 Bacteria 2682
406 Ga0496110_0053697 3300048913 Bacteria 3543
407 Ga0496113_0459355 3300048916 Bacteria 1023
408 Ga0496115_0011922 3300048918 Bacteria 6527
409 Ga0501031_0000794 3300049568 Bacteria 18986
410 Ga0501031_0004464 3300049568 Bacteria 9075
411 Ga0501032_0023193 3300049569 Bacteria 4294
412 Ga0501032_0129648 3300049569 Bacteria 1664
413 Ga0501033_0000047 3300049570 Bacteria 122884
414 Ga0501034_0036106 3300049571 Bacteria 5010
415 Ga0501034_0101420 3300049571 Bacteria 2872
416 Ga0501034_0345145 3300049571 Bacteria 1418
417 Ga0501036_0035968 3300049572 Bacteria 4190
418 Ga0501036_0047798 3300049572 Bacteria 3623
419 Ga0501037_0000062 3300049573 Bacteria 97779
420 Ga0501037_0059892 3300049573 Bacteria 2777
421 Ga0501038_0006075 3300049574 Bacteria 11174
422 Ga0501038_0120056 3300049574 Bacteria 2169
423 Ga0501038_0129233 3300049574 Bacteria 2076
424 Ga0501039_0000768 3300049575 Bacteria 23066
425 Ga0501039_0016067 3300049575 Bacteria 5733
426 Ga0501040_0086543 3300049576 Bacteria 2176
427 Ga0501042_0013196 3300049578 Bacteria 5625
428 Ga0501043_0000273 3300049579 Bacteria 46526
429 Ga0501043_0000490 3300049579 Bacteria 35507
430 Ga0501043_0334358 3300049579 Bacteria 1153
431 Ga0501046_0014333 3300049580 Bacteria 6694
432 Ga0501047_0007640 3300049581 Bacteria 10181
433 Ga0501047_0076147 3300049581 Bacteria 3229
434 Ga0501047_0495232 3300049581 Bacteria 1049
435 Ga0501047_0959341 3300049581 Unclassified 668
436 Ga0501067_0006973 3300049583 Bacteria 6269
437 Ga0501067_0077171 3300049583 Bacteria 1846
438 Ga0501068_0202813 3300049584 Bacteria 1258
439 Ga0501069_0031791 3300049585 Bacteria 2904
440 Ga0501070_0000879 3300049586 Bacteria 27249
441 Ga0501070_0268180 3300049586 Bacteria 1394
442 Ga0501071_0087031 3300049587 Bacteria 2292
443 Ga0501072_0319391 3300049588 Unclassified 1234
444 Ga0501073_0009006 3300049589 Bacteria 7370
445 Ga0501074_0034691 3300049590 Unclassified 3657
446 Ga0501074_0334105 3300049590 Bacteria 1076
447 Ga0501075_0174253 3300049591 Bacteria 1642
448 Ga0501252_041171 3300049682 Unclassified 671
449 Ga0501079_0336530 3300049741 Bacteria 1182
450 Ga0501080_0120352 3300049742 Bacteria 2433
451 Ga0501080_0308296 3300049742 Unclassified 1435
452 Ga0501080_0668195 3300049742 Bacteria 918
453 Ga0501081_0162119 3300049743 Bacteria 1611
454 Ga0501083_0255210 3300049744 Unclassified 1141
455 Ga0501035_0000004 3300049822 Bacteria 403650
456 Ga0501035_0225724 3300049822 Bacteria 1598
457 Ga0501044_0001842 3300049823 Bacteria 24647
458 Ga0501044_0121526 3300049823 Bacteria 2612
459 Ga0501044_0228293 3300049823 Bacteria 1810
460 Ga0501044_1472953 3300049823 Bacteria 546
461 nmdc:mga05p37_1710110_c1 3300050507 Bacteria 613
462 nmdc:mga05p37_789224_c1 3300050507 Bacteria 1041
463 nmdc:mga06r32_403460_c1 3300050510 Unclassified 1349
464 nmdc:mga08y16_447676_c1 3300050511 Bacteria 1317
465 nmdc:mga0n895_3179_c2 3300050512 Bacteria 7741
466 nmdc:mga0n895_580263_c1 3300050512 Unclassified 1125
467 nmdc:mga0rr50_15349_c1 3300050513 Bacteria 5054
468 nmdc:mga0rr50_27284_c1 3300050513 Unclassified 3996
469 nmdc:mga0rr50_3468_c1 3300050513 Bacteria 9080
470 nmdc:mga0rr50_45749_c1 3300050513 Bacteria 3219
471 nmdc:mga0rr50_652195_c1 3300050513 Unclassified 898
472 nmdc:mga08x19_1878_c1 3300050514 Bacteria 12870
473 nmdc:mga08x19_2678_c1 3300050514 Bacteria 10765
474 nmdc:mga08x19_4082_c1 3300050514 Bacteria 8665
475 nmdc:mga08x19_746041_c1 3300050514 Bacteria 695
476 nmdc:mga0a205_440402_c1 3300050515 Bacteria 1164
477 nmdc:mga0a205_542_c1 3300050515 Bacteria 29825
478 nmdc:mga0sz30_421538_c1 3300050516 Bacteria 598
479 Ga0495655_0013564 3300053083 Bacteria 1688
480 Ga0495655_0024060 3300053083 Bacteria 1411
481 Ga0501084_0025011 3300054114 Bacteria 4982
482 Ga0501084_0464867 3300054114 Unclassified 1070
483 Ga0501082_0133192 3300060353 Bacteria 2156
484 Ga0501082_1012681 3300060353 Unclassified 726
485 Ga0466962_0068982 3300061719 Bacteria 1689
486 Ga0530510_0113014 3300061734 Bacteria 1990
487 Ga0530510_0236090 3300061734 Unclassified 1361
488 Ga0530510_0239181 3300061734 Unclassified 1351
489 2652976680 2651869818 Bacteria 5864031
490 2691331823 2690315857 Bacteria 4396207
491 2739302405 2738543023 Bacteria 6767879
492 2740995329 2740891818 Bacteria 6711283
493 2857508965 2857504554 Bacteria 5369913
494 2900641914 2900634093 Bacteria 10263517
495 2910250061 2910245624 Bacteria 6935613
496 2910250078 2910245624 Bacteria 6935613
497 2919537116 2919534386 Bacteria 4577686
498 2919689495 2919688452 Bacteria 4595932
499 Ga0496109_0578272
500 JGI24735J21928_10001896
501 JGI24744J21845_10009370
502 rootL2_10382749
503 rootH1_10086282
504 rootH1_10151173
505 Ga0065715_10323141
506 Ga0070658_10019649
507 Ga0070658_10087431
508 Ga0070658_10165329
509 Ga0070676_10693337
510 Ga0070676_10928784
511 Ga0070690_100026821
512 Ga0070690_100184106
513 Ga0070690_100265331
514 Ga0070670_100003636
515 Ga0070670_100952553
516 Ga0070670_101024876
517 Ga0070677_10004548
518 Ga0070666_10000468
519 Ga0070666_10068426
520 Ga0070680_100001989
521 Ga0070680_100961191
522 Ga0070680_101437912
523 Ga0070682_100000010
524 Ga0070682_100002487
525 Ga0070660_100536577
526 Ga0070689_100014564
527 Ga0070689_100016783
528 Ga0070689_100674015
529 Ga0070689_101512503
530 Ga0070691_10003740
531 Ga0070687_100381062
532 Ga0070687_100414917
533 Ga0070668_100075983
534 Ga0070669_100000592
535 Ga0070669_100214589
536 Ga0070669_100402474
537 Ga0070675_100054754
538 Ga0070675_100393413
539 Ga0070675_100447359
540 Ga0070674_100032176
541 Ga0070674_100079684
542 Ga0070673_100008656
543 Ga0070673_100074723
544 Ga0070673_100445371
545 Ga0070688_100036681
546 Ga0070659_100069452
547 Ga0070667_100000933
548 Ga0070709_10167156
549 Ga0070714_100009086
550 Ga0070714_101158180
551 Ga0070710_10303052
552 Ga0070711_100012155
553 Ga0070705_100059743
554 Ga0070700_100060583
555 Ga0070694_100218863
556 Ga0070694_100254495
557 Ga0070708_100216583
558 Ga0070663_100020844
559 Ga0070663_100104492
560 Ga0070663_100816961
561 Ga0070678_100226609
562 Ga0070678_100292517
563 Ga0070662_100280810
564 Ga0070662_100585872
565 Ga0070681_10006547
566 Ga0070681_10346928
567 Ga0068867_100007908
568 Ga0068867_100009570
569 Ga0070685_10024577
570 Ga0070685_10290300
571 Ga0070685_10549786
572 Ga0070706_100260826
573 Ga0070707_100315966
574 Ga0070707_100939507
575 Ga0070698_101026048
576 Ga0070699_100152750
577 Ga0070699_100284768
578 Ga0070679_100048063
579 Ga0070684_100206791
580 Ga0070684_100256671
581 Ga0070684_101217273
582 Ga0070684_101362175
583 Ga0068853_100022286
584 Ga0070672_100098148
585 Ga0070672_100158447
586 Ga0070672_100334255
587 Ga0070672_101833806
588 Ga0070686_100125113
589 Ga0070686_100524079
590 Ga0070695_100326568
591 Ga0070695_100361763
592 Ga0070695_101008563
593 Ga0070693_100027059
594 Ga0070693_100031406
595 Ga0070665_100001037
596 Ga0070665_100004988
597 Ga0070665_100005270
598 Ga0070704_100423711
599 Ga0070704_100864360
600 Ga0068855_100056423
601 Ga0070664_100179359
602 Ga0070664_100213688
603 Ga0070664_100714634
604 Ga0068854_100164862
605 Ga0068856_100007207
606 Ga0068856_100376872
607 Ga0068859_100009101
608 Ga0068859_101973822
609 Ga0068864_100066424
610 Ga0068864_100077212
611 Ga0068864_100126776
612 Ga0068861_100339823
613 Ga0068870_10017245
614 Ga0068863_100419547
615 Ga0068863_101160540
616 Ga0068858_100000173
617 Ga0068858_100081104
618 Ga0068858_100698370
619 Ga0068858_101676695
620 Ga0068860_100000332
621 Ga0068860_100319885
622 Ga0068862_100146758
623 Ga0068862_100638835
624 Ga0068862_100894939
625 Ga0081538_10034193
626 Ga0081540_1041602
627 Ga0070717_10000116
628 Ga0070716_100290473
629 Ga0097621_100186324
630 Ga0068871_100101177
631 Ga0068871_100681638
632 Ga0075428_100172076
633 Ga0075431_100100203
634 Ga0075433_10002512
635 Ga0075434_100007957
636 Ga0075434_101068420
637 Ga0075434_101140930
638 Ga0068865_100052764
639 Ga0068865_100179489
640 Ga0068865_100792818
641 Ga0075436_100002494
642 Ga0075436_100008579
643 Ga0097620_100009100
644 Ga0097620_101974065
645 Ga0075435_100011915
646 Ga0075435_100014339
647 Ga0075435_100020667
648 Ga0075435_100252148
649 Ga0075435_100404301
650 Ga0075435_101151934
651 Ga0099794_10047895
652 Ga0099795_10064345
653 Ga0105240_10002143
654 Ga0105240_11593325
655 Ga0105240_11741406
656 Ga0111539_10108937
657 Ga0105245_10002774
658 Ga0105245_10008519
659 Ga0105245_10053121
660 Ga0105245_10079274
661 Ga0105245_12809720
662 Ga0105247_10186015
663 Ga0114129_10179672
664 Ga0114129_10820307
665 Ga0114129_12383422
666 Ga0105241_10000785
667 Ga0105248_12114933
668 Ga0105237_10030430
669 Ga0105238_12322898
670 Ga0105249_10044314
671 Ga0105249_10510805
672 Ga0105249_11123079
673 Ga0099796_10205386
674 Ga0105239_11063595
675 Ga0105246_11035567
676 Ga0157373_10001243
677 Ga0157373_10023270
678 Ga0157371_11031016
679 Ga0157370_10000092
680 Ga0157370_10006791
681 Ga0157370_10660564
682 Ga0157370_11079407
683 Ga0157369_10027291
684 Ga0157369_10203285
685 Ga0157369_10669815
686 Ga0157374_11735272
687 Ga0157378_10062244
688 Ga0157378_10505433
689 Ga0157378_10825715
690 Ga0163162_10008021
691 Ga0163162_10770027
692 Ga0157372_12747759
693 Ga0157375_10000316
694 Ga0157375_10000738
695 Ga0157375_11055559
696 Ga0157375_11085291
697 Ga0163163_10102475
698 Ga0163163_10805524
699 Ga0157380_10091968
700 Ga0157380_10101102
701 Ga0157380_10734146
702 Ga0157380_11639680
703 Ga0157380_11710023
704 Ga0157377_10285985
705 Ga0157379_10005899
706 Ga0157376_10008253
707 Ga0163161_10091207
708 Ga0213874_10308530
709 Ga0213875_10036233
710 Ga0207697_10008552
711 Ga0207682_10003618
712 Ga0207688_10249058
713 Ga0207688_10379929
714 Ga0207680_10005994
715 Ga0207680_10415209
716 Ga0207647_10259854
717 Ga0207645_10014084
718 Ga0207645_10537061
719 Ga0207643_10006968
720 Ga0207705_10031419
721 Ga0207705_10046924
722 Ga0207654_10004216
723 Ga0207707_10001095
724 Ga0207695_10020335
725 Ga0207695_10621897
726 Ga0207695_11021752
727 Ga0207671_10080864
728 Ga0207663_10144644
729 Ga0207660_10018758
730 Ga0207657_10978540
731 Ga0207657_11003459
732 Ga0207652_10004110
733 Ga0207681_10000021
734 Ga0207681_10153458
735 Ga0207681_10259344
736 Ga0207650_10211564
737 Ga0207650_10450004
738 Ga0207659_10201174
739 Ga0207659_10340668
740 Ga0207659_10376594
741 Ga0207659_10487486
742 Ga0207659_10490276
743 Ga0207687_10000895
744 Ga0207687_10001951
745 Ga0207687_10473754
746 Ga0207687_11672956
747 Ga0207700_10003343
748 Ga0207690_10215084
749 Ga0207706_10014460
750 Ga0207670_10004678
751 Ga0207670_10055802
752 Ga0207670_10245062
753 Ga0207670_10496180
754 Ga0207669_10089389
755 Ga0207669_10537062
756 Ga0207704_10047479
757 Ga0207665_10138445
758 Ga0207691_10001234
759 Ga0207691_10008481
760 Ga0207691_10419302
761 Ga0207691_11222487
762 Ga0207661_11030600
763 Ga0207679_10185419
764 Ga0207679_10518889
765 Ga0207667_10036187
766 Ga0207667_10373963
767 Ga0207651_10021474
768 Ga0207651_10279312
769 Ga0207651_10369435
770 Ga0207651_11000105
771 Ga0207712_10474365
772 Ga0207668_10224972
773 Ga0207668_11475482
774 Ga0207640_10477426
775 Ga0207658_10017762
776 Ga0207703_10000196
777 Ga0207703_10017929
778 Ga0207703_11423831
779 Ga0207639_10010679
780 Ga0207678_10033071
781 Ga0207678_10288864
782 Ga0207708_10044060
783 Ga0207702_10019256
784 Ga0207702_10326918
785 Ga0207641_10039789
786 Ga0207641_10657284
787 Ga0207648_10009036
788 Ga0207648_10013181
789 Ga0207676_10103379
790 Ga0207676_10110525
791 Ga0207676_10144778
792 Ga0207675_100037123
793 Ga0207683_10009080
794 Ga0268266_10001955
795 Ga0268265_10128402
796 Ga0268264_10009001
797 Ga0268264_11024810
798 Ga0265326_10002271
799 Ga0307515_10000092
800 Ga0265338_10082734
801 Ga0265324_10147072
802 Ga0265324_10151565
803 Ga0307511_10024468
804 Ga0265332_10051539
805 Ga0265320_10043254
806 Ga0265325_10018112
807 Ga0265340_10054793
808 Ga0265339_10005340
809 Ga0265339_10036005
810 Ga0265327_10262833
811 Ga0265316_10074188
812 Ga0265316_10083229
813 Ga0307513_10359188
814 Ga0307408_100000017
815 Ga0265313_10154474
816 Ga0265314_10073623
817 Ga0265314_10694231
818 Ga0316576_10684985
819 Ga0307405_10501757
820 Ga0316577_10015057
821 Ga0307413_10053349
822 Ga0307413_10324158
823 Ga0307413_11085754
824 Ga0307410_10000096
825 Ga0307407_10007423
826 Ga0307409_100000090
827 Ga0307416_100000034
828 Ga0307416_102107760
829 Ga0307411_10139895
830 Ga0307415_101225068
831 Ga0316580_10032773
832 Ga0373945_0023469
833 Ga0373945_0059585
834 Ga0373943_0911349
835 Ga0373946_0141684
836 Ga0373935_0047539
837 Ga0373935_0059582
838 Ga0373927_0063423
839 Ga0373947_0039319
840 Ga0373947_0142987
841 Ga0373937_0147572
842 Ga0373937_1532539
843 Ga0316582_0008226
844 Ga0316582_0142366
845 Ga0373925_0055982
846 Ga0373925_0300273
847 Ga0373925_0371583
848 Ga0395899_0497078
849 Ga0395900_0288063
850 Ga0395905_0054307
851 Ga0316581_0080583
852 Ga0436364_0070910
853 Ga0436364_0195633
854 Ga0436364_0610994
855 Ga0400485_17332
856 Ga0400488_53871
857 Ga0400486_17491
858 Ga0436365_1341648
859 Ga0436365_1403723
860 Ga0436365_1470772
861 Ga0436363_0362871
862 Ga0436363_1339355
863 Ga0451802_0649758
864 Ga0451837_0155546
865 Ga0439441_000391
866 Ga0451577_0200668
867 Ga0451577_0744984
868 Ga0466969_0286974
869 Ga0466963_0022084
870 Ga0466963_0141744
871 Ga0466963_0513002
872 Ga0466971_0298803
873 Ga0466957_0261513
874 Ga0466959_0527442
875 Ga0466959_0844132
876 Ga0451576_0118611
877 Ga0466958_0259431
878 Ga0466967_0004648
879 Ga0466967_0336551
880 Ga0466967_0696381
881 Ga0495629_0001612
882 Ga0495650_0092524
883 Ga0495662_0039490
884 Ga0495594_0433068
885 Ga0495628_0001060
886 Ga0495630_0126436
887 Ga0495652_0381717
888 Ga0495645_0158255
889 Ga0495667_0628431
890 Ga0495613_0483631
891 Ga0495674_0461993
892 Ga0495675_0333818
893 Ga0495673_0003542
894 Ga0496100_0014759
895 Ga0496100_0969861
896 Ga0496101_0178735
897 Ga0496102_0003676
898 Ga0496103_0108033
899 Ga0496104_0069476
900 Ga0496106_0339385
901 Ga0496107_0272990
902 Ga0496108_0057825
903 Ga0496109_0100633
904 Ga0496110_0053697
905 Ga0496113_0459355
906 Ga0496115_0011922
907 Ga0501031_0000794
908 Ga0501031_0004464
909 Ga0501032_0023193
910 Ga0501032_0129648
911 Ga0501033_0000047
912 Ga0501034_0036106
913 Ga0501034_0101420
914 Ga0501034_0345145
915 Ga0501036_0035968
916 Ga0501036_0047798
917 Ga0501037_0000062
918 Ga0501037_0059892
919 Ga0501038_0006075
920 Ga0501038_0120056
921 Ga0501038_0129233
922 Ga0501039_0000768
923 Ga0501039_0016067
924 Ga0501040_0086543
925 Ga0501042_0013196
926 Ga0501043_0000273
927 Ga0501043_0000490
928 Ga0501043_0334358
929 Ga0501046_0014333
930 Ga0501047_0007640
931 Ga0501047_0076147
932 Ga0501047_0495232
933 Ga0501047_0959341
934 Ga0501067_0006973
935 Ga0501067_0077171
936 Ga0501068_0202813
937 Ga0501069_0031791
938 Ga0501070_0000879
939 Ga0501070_0268180
940 Ga0501071_0087031
941 Ga0501072_0319391
942 Ga0501073_0009006
943 Ga0501074_0034691
944 Ga0501074_0334105
945 Ga0501075_0174253
946 Ga0501252_041171
947 Ga0501079_0336530
948 Ga0501080_0120352
949 Ga0501080_0308296
950 Ga0501080_0668195
951 Ga0501081_0162119
952 Ga0501083_0255210
953 Ga0501035_0000004
954 Ga0501035_0225724
955 Ga0501044_0001842
956 Ga0501044_0121526
957 Ga0501044_0228293
958 Ga0501044_1472953
959 nmdc:mga05p37_1710110_c1
960 nmdc:mga05p37_789224_c1
961 nmdc:mga06r32_403460_c1
962 nmdc:mga08y16_447676_c1
963 nmdc:mga0n895_3179_c2
964 nmdc:mga0n895_580263_c1
965 nmdc:mga0rr50_15349_c1
966 nmdc:mga0rr50_27284_c1
967 nmdc:mga0rr50_3468_c1
968 nmdc:mga0rr50_45749_c1
969 nmdc:mga0rr50_652195_c1
970 nmdc:mga08x19_1878_c1
971 nmdc:mga08x19_2678_c1
972 nmdc:mga08x19_4082_c1
973 nmdc:mga08x19_746041_c1
974 nmdc:mga0a205_440402_c1
975 nmdc:mga0a205_542_c1
976 nmdc:mga0sz30_421538_c1
977 Ga0495655_0013564
978 Ga0495655_0024060
979 Ga0501084_0025011
980 Ga0501084_0464867
981 Ga0501082_0133192
982 Ga0501082_1012681
983 Ga0466962_0068982
984 Ga0530510_0113014
985 Ga0530510_0236090
986 Ga0530510_0239181
987 2652976680
988 2691331823
989 2739302405
990 2740995329
991 2857508965
992 2900641914
993 2910250061
994 2910250078
995 2919537116
996 2919689495

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08808

RES

RES domain

21

167

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gug-assembly1.cif.gz_A-2 structure of vpa0770 toxin bound to vpa0769 antitoxin in vibrio parahaemolyticus 0.8864 3 150
6d0h-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars 0.8668 2 149
6d0i-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars. l48m part, semet-substituted complex. 0.8599 1 151
8gug-assembly1.cif.gz_A-2 structure of vpa0770 toxin bound to vpa0769 antitoxin in vibrio parahaemolyticus 0.8385 3 150
6gw6-assembly1.cif.gz_D structure of the pseudomonas putida res-xre toxin-antitoxin complex 0.8278 3 151
ID Description Score Start End Superfamily
af_Q9LJB4_234_449_3.30.559.10 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain 0.5777 102 135 3.30.559.10
af_Q57805_1_214_3.90.228.10 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.5424 1 142 3.90.228.10
5lx6B00 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.5364 2 139 3.90.228.10
af_Q9FJN0_217_437_3.30.559.10 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain 0.5306 110 135 3.30.559.10
af_Q109A0_1_182_3.90.228.10 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.5223 2 139 3.90.228.10
ID Description Score Start End GO Terms
AF-A0A838PG02-F1-model_v4 RES domain-containing protein 0.9732 3 150
AF-A0A1G5TR80-F1-model_v4 RES domain-containing protein 0.9697 1 134
AF-B1G6M4-F1-model_v4 RES domain protein 0.9694 38 152
AF-A0A1F4D671-F1-model_v4 RES domain-containing protein 0.9654 3 152
AF-A0A158L0N6-F1-model_v4 RES domain-containing protein 0.9645 1 157

Map