F455211

General Info

Members Datasets Scaffolds Average Seq Length
498 285 996 167

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_101015946|Ga0307409_1010159461
Length 189
Sequence MRYAGLVHRGAHRPGAEGSSASLDSTPMRVHLGCDHAGLDLKAHLVAWLTEHGYEPVDHGPHQYDALDDYPVFCLRAAAAVAAEPGSLGVVIGGSGNGEQMAANKVKGIRSALVWSEETATLAREHNDAQVIAVGGRMHTAEEMTRFVEVFLTTPFSQEERHARRIGMLSDYERTGELPPLPPSAQPHA

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
149 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
150 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
171 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
172 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
269 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
270 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
271 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
272 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
273 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
274 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
276 2643221615 Nocardioides sp. Root224 Isolate Unclassified
277 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
278 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
279 2738541305 Nocardioides sp. CF167 Isolate Unclassified
280 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
281 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
282 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
283 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
284 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
285 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.19
Metatranscriptomes 0.8
Isolates 2.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.02
Nodule 0.4
Rhizoplane 7.63
Rhizosphere 81.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_101015946 3300031995 Bacteria 848
2 JGI24739J22299_10193308 3300001989 Bacteria 598
3 JGI24737J22298_10156955 3300001990 Bacteria 672
4 Ga0070683_100002195 3300005329 Bacteria 15453
5 Ga0070683_100088042 3300005329 Bacteria 2913
6 Ga0070683_100530478 3300005329 Bacteria 1125
7 Ga0070683_100631237 3300005329 Bacteria 1026
8 Ga0070683_100804966 3300005329 Bacteria 901
9 Ga0070670_100141494 3300005331 Bacteria 2081
10 Ga0070670_100998435 3300005331 Bacteria 761
11 Ga0068869_100125788 3300005334 Bacteria 1965
12 Ga0070682_100040513 3300005337 Bacteria 2867
13 Ga0070682_100509769 3300005337 Bacteria 934
14 Ga0068868_100028319 3300005338 Bacteria 4282
15 Ga0068868_100160297 3300005338 Bacteria 1857
16 Ga0068868_100202600 3300005338 Bacteria 1655
17 Ga0070660_100042799 3300005339 Bacteria 3458
18 Ga0070660_100525260 3300005339 Bacteria 986
19 Ga0070689_100534648 3300005340 Bacteria 1008
20 Ga0070691_10036704 3300005341 Bacteria 2311
21 Ga0070687_100455233 3300005343 Bacteria 852
22 Ga0070692_10094002 3300005345 Bacteria 1634
23 Ga0070692_10174124 3300005345 Bacteria 1242
24 Ga0070668_100866032 3300005347 Bacteria 806
25 Ga0070675_100491444 3300005354 Bacteria 1105
26 Ga0070674_100005174 3300005356 Bacteria 7496
27 Ga0070673_100368377 3300005364 Bacteria 1279
28 Ga0070673_100470557 3300005364 Bacteria 1133
29 Ga0070710_10073879 3300005437 Bacteria 1972
30 Ga0070710_10215807 3300005437 Bacteria 1218
31 Ga0070701_10174330 3300005438 Bacteria 1255
32 Ga0070700_100002303 3300005441 Bacteria 9716
33 Ga0070700_101242325 3300005441 Bacteria 624
34 Ga0070678_100816141 3300005456 Bacteria 848
35 Ga0070678_101288507 3300005456 Bacteria 680
36 Ga0070662_100484268 3300005457 Bacteria 1030
37 Ga0070681_10003998 3300005458 Bacteria 13910
38 Ga0070681_10264938 3300005458 Bacteria 1630
39 Ga0068867_100004168 3300005459 Bacteria 10170
40 Ga0070685_10377532 3300005466 Bacteria 976
41 Ga0070679_100058686 3300005530 Bacteria 3834
42 Ga0070684_100001182 3300005535 Bacteria 18768
43 Ga0070684_100223428 3300005535 Bacteria 1718
44 Ga0070684_100279100 3300005535 Bacteria 1530
45 Ga0070684_100341701 3300005535 Bacteria 1376
46 Ga0068853_100239276 3300005539 Bacteria 1663
47 Ga0070672_100012174 3300005543 Bacteria 6027
48 Ga0070686_100028259 3300005544 Bacteria 3400
49 Ga0070686_100297449 3300005544 Bacteria 1196
50 Ga0070695_100047516 3300005545 Bacteria 2742
51 Ga0070695_100607874 3300005545 Bacteria 859
52 Ga0070693_100044245 3300005547 Bacteria 2518
53 Ga0070665_100002481 3300005548 Bacteria 20316
54 Ga0070665_100252850 3300005548 Bacteria 1763
55 Ga0070665_100792193 3300005548 Bacteria 961
56 Ga0070665_100985941 3300005548 Bacteria 855
57 Ga0070664_100750736 3300005564 Bacteria 911
58 Ga0068857_100005347 3300005577 Bacteria 10943
59 Ga0068857_100234266 3300005577 Bacteria 1680
60 Ga0068856_100012929 3300005614 Bacteria 8080
61 Ga0068856_100526753 3300005614 Bacteria 1203
62 Ga0070702_100003489 3300005615 Bacteria 7037
63 Ga0068852_100008365 3300005616 Bacteria 7623
64 Ga0068852_100057229 3300005616 Bacteria 3373
65 Ga0068852_100637030 3300005616 Bacteria 1073
66 Ga0068864_100111233 3300005618 Bacteria 2440
67 Ga0068866_10426666 3300005718 Bacteria 861
68 Ga0068870_10003430 3300005840 Bacteria 6722
69 Ga0068860_100721946 3300005843 Bacteria 1007
70 Ga0068860_101635261 3300005843 Bacteria 666
71 Ga0068862_100207050 3300005844 Bacteria 1771
72 Ga0081455_10000298 3300005937 Bacteria 65765
73 Ga0081455_10004995 3300005937 Bacteria 14669
74 Ga0081539_10245407 3300005985 Bacteria 799
75 Ga0070717_10542922 3300006028 Bacteria 1052
76 Ga0070717_10678140 3300006028 Bacteria 936
77 Ga0075365_10123824 3300006038 Bacteria 1785
78 Ga0075365_10239587 3300006038 Bacteria 1274
79 Ga0075365_10339843 3300006038 Bacteria 1058
80 Ga0075365_10426335 3300006038 Bacteria 936
81 Ga0075365_10576871 3300006038 Bacteria 795
82 Ga0075368_10002711 3300006042 Bacteria 5836
83 Ga0075363_100217893 3300006048 Bacteria 1093
84 Ga0075364_10102935 3300006051 Bacteria 1902
85 Ga0075364_10363962 3300006051 Bacteria 986
86 Ga0070715_10017511 3300006163 Bacteria 2713
87 Ga0070712_100673585 3300006175 Bacteria 880
88 Ga0075367_10006790 3300006178 Bacteria 5813
89 Ga0075370_10010910 3300006353 Bacteria 4762
90 Ga0068871_100055706 3300006358 Bacteria 3211
91 Ga0075428_100010093 3300006844 Bacteria 10490
92 Ga0075430_100066567 3300006846 Bacteria 3025
93 Ga0075431_100021939 3300006847 Bacteria 6528
94 Ga0075433_10123234 3300006852 Bacteria 2303
95 Ga0075433_11078360 3300006852 Bacteria 699
96 Ga0075434_100254176 3300006871 Bacteria 1776
97 Ga0075434_100405859 3300006871 Bacteria 1384
98 Ga0075429_100011256 3300006880 Bacteria 7742
99 Ga0068865_100004270 3300006881 Bacteria 8620
100 Ga0068865_100065174 3300006881 Bacteria 2566
101 Ga0075436_100111849 3300006914 Bacteria 1907
102 Ga0075435_100082985 3300007076 Bacteria 2634
103 Ga0111539_10017115 3300009094 Bacteria 8973
104 Ga0105245_10002677 3300009098 Bacteria 16030
105 Ga0105245_10010146 3300009098 Bacteria 8202
106 Ga0105245_10313636 3300009098 Bacteria 1543
107 Ga0105245_10663483 3300009098 Bacteria 1074
108 Ga0105247_10754258 3300009101 Bacteria 738
109 Ga0114129_10214373 3300009147 Bacteria 2601
110 Ga0114129_10291016 3300009147 Bacteria 2180
111 Ga0105243_10006868 3300009148 Bacteria 8775
112 Ga0105243_10106935 3300009148 Bacteria 2333
113 Ga0105243_10625551 3300009148 Bacteria 1040
114 Ga0105242_10076774 3300009176 Bacteria 2786
115 Ga0105242_10436207 3300009176 Bacteria 1231
116 Ga0105248_10508370 3300009177 Bacteria 1358
117 Ga0105237_10388048 3300009545 Bacteria 1401
118 Ga0105238_10104962 3300009551 Bacteria 2807
119 Ga0105238_10237264 3300009551 Bacteria 1801
120 Ga0105238_10497119 3300009551 Bacteria 1220
121 Ga0105249_10028111 3300009553 Bacteria 5076
122 Ga0105249_10622055 3300009553 Bacteria 1136
123 Ga0105249_11201576 3300009553 Bacteria 829
124 Ga0105239_10013026 3300010375 Bacteria 9246
125 Ga0105239_10696589 3300010375 Bacteria 1161
126 Ga0105239_11261686 3300010375 Bacteria 852
127 Ga0105246_10000827 3300011119 Bacteria 17608
128 Ga0105246_10031000 3300011119 Bacteria 3536
129 Ga0105246_10570476 3300011119 Bacteria 973
130 Ga0157338_1019069 3300012515 Bacteria 783
131 Ga0157371_10285834 3300013102 Bacteria 1192
132 Ga0157370_11094981 3300013104 Bacteria 720
133 Ga0157369_10077522 3300013105 Bacteria 3562
134 Ga0157369_11497340 3300013105 Bacteria 686
135 Ga0157378_11128432 3300013297 Bacteria 822
136 Ga0163162_10018971 3300013306 Bacteria 6744
137 Ga0163162_10368348 3300013306 Bacteria 1570
138 Ga0163162_10766153 3300013306 Bacteria 1084
139 Ga0157372_10028354 3300013307 Bacteria 6109
140 Ga0157372_10057174 3300013307 Bacteria 4360
141 Ga0157372_12212630 3300013307 Bacteria 632
142 Ga0157375_10109583 3300013308 Bacteria 2857
143 Ga0163163_10033424 3300014325 Bacteria 4975
144 Ga0163163_10058098 3300014325 Bacteria 3825
145 Ga0163163_10349046 3300014325 Bacteria 1535
146 Ga0157380_10005485 3300014326 Bacteria 8863
147 Ga0157377_10126508 3300014745 Bacteria 1555
148 Ga0157379_10004911 3300014968 Bacteria 11482
149 Ga0157376_10321947 3300014969 Bacteria 1470
150 Ga0157376_10850772 3300014969 Bacteria 927
151 Ga0163161_10180028 3300017792 Bacteria 1620
152 Ga0163161_10668191 3300017792 Bacteria 862
153 Ga0163161_11108176 3300017792 Bacteria 681
154 Ga0206354_10689030 3300020081 Bacteria 1752
155 Ga0206354_11713657 3300020081 Bacteria 1216
156 Ga0206353_10400300 3300020082 Bacteria 2660
157 Ga0206353_11028802 3300020082 Bacteria 528
158 Ga0207682_10294663 3300025893 Bacteria 760
159 Ga0207692_10016213 3300025898 Bacteria 3293
160 Ga0207642_10273893 3300025899 Bacteria 968
161 Ga0207642_10360152 3300025899 Bacteria 861
162 Ga0207688_10038027 3300025901 Bacteria 2670
163 Ga0207688_10129052 3300025901 Bacteria 1481
164 Ga0207688_10316334 3300025901 Bacteria 957
165 Ga0207647_10024239 3300025904 Bacteria 4002
166 Ga0207699_10075683 3300025906 Bacteria 2071
167 Ga0207643_10040381 3300025908 Bacteria 2627
168 Ga0207705_10097613 3300025909 Bacteria 2158
169 Ga0207707_10136806 3300025912 Bacteria 2142
170 Ga0207663_10003531 3300025916 Bacteria 7670
171 Ga0207662_10913234 3300025918 Bacteria 622
172 Ga0207657_10053484 3300025919 Bacteria 3498
173 Ga0207687_10002919 3300025927 Bacteria 11603
174 Ga0207687_10075831 3300025927 Bacteria 2414
175 Ga0207700_10013157 3300025928 Bacteria 5371
176 Ga0207664_10090285 3300025929 Bacteria 2510
177 Ga0207706_10266748 3300025933 Bacteria 1494
178 Ga0207686_10526668 3300025934 Bacteria 921
179 Ga0207709_10018513 3300025935 Bacteria 3902
180 Ga0207709_10073893 3300025935 Bacteria 2174
181 Ga0207669_10318498 3300025937 Bacteria 1189
182 Ga0207669_10486224 3300025937 Bacteria 985
183 Ga0207704_10039720 3300025938 Bacteria 2743
184 Ga0207704_10041270 3300025938 Bacteria 2704
185 Ga0207691_10003002 3300025940 Bacteria 16471
186 Ga0207691_10344773 3300025940 Bacteria 1275
187 Ga0207711_10393223 3300025941 Bacteria 1287
188 Ga0207711_10630943 3300025941 Bacteria 1000
189 Ga0207661_10011381 3300025944 Bacteria 6444
190 Ga0207661_10149503 3300025944 Bacteria 2018
191 Ga0207661_10220960 3300025944 Bacteria 1674
192 Ga0207661_10420097 3300025944 Bacteria 1214
193 Ga0207661_10891358 3300025944 Bacteria 819
194 Ga0207679_10262364 3300025945 Bacteria 1474
195 Ga0207651_10036355 3300025960 Bacteria 3214
196 Ga0207651_10234609 3300025960 Bacteria 1492
197 Ga0207712_11007853 3300025961 Bacteria 739
198 Ga0207668_10348397 3300025972 Bacteria 1238
199 Ga0207677_10004641 3300026023 Bacteria 7397
200 Ga0207677_10018227 3300026023 Bacteria 4209
201 Ga0207677_10183330 3300026023 Bacteria 1648
202 Ga0207703_10542178 3300026035 Bacteria 1096
203 Ga0207639_10114633 3300026041 Bacteria 2203
204 Ga0207678_10468948 3300026067 Bacteria 1096
205 Ga0207708_10001371 3300026075 Bacteria 18327
206 Ga0207708_10022724 3300026075 Bacteria 4736
207 Ga0207708_10131416 3300026075 Bacteria 1958
208 Ga0207708_10614918 3300026075 Bacteria 922
209 Ga0207702_10018279 3300026078 Bacteria 5800
210 Ga0207702_10264762 3300026078 Bacteria 1620
211 Ga0207702_10506703 3300026078 Bacteria 1177
212 Ga0207641_11188904 3300026088 Bacteria 762
213 Ga0207648_10003822 3300026089 Bacteria 15734
214 Ga0207648_10241841 3300026089 Bacteria 1607
215 Ga0207676_10046468 3300026095 Bacteria 3360
216 Ga0207674_10043696 3300026116 Bacteria 4619
217 Ga0207674_10259050 3300026116 Bacteria 1687
218 Ga0207675_100264990 3300026118 Bacteria 1666
219 Ga0207675_100506711 3300026118 Bacteria 1202
220 Ga0207683_10293164 3300026121 Bacteria 1488
221 Ga0207683_10606313 3300026121 Bacteria 1013
222 Ga0207698_10015271 3300026142 Bacteria 5139
223 Ga0207698_10206574 3300026142 Bacteria 1763
224 Ga0209983_1071744 3300027665 Bacteria 772
225 Ga0207428_10025216 3300027907 Bacteria 4978
226 Ga0268266_10001392 3300028379 Bacteria 28952
227 Ga0268266_10307654 3300028379 Bacteria 1480
228 Ga0268265_10194537 3300028380 Bacteria 1754
229 Ga0268264_10646279 3300028381 Bacteria 1046
230 Ga0268264_10661499 3300028381 Bacteria 1034
231 Ga0316181_1102777 3300030744 Bacteria 665
232 Ga0307509_10048344 3300031507 Bacteria 4569
233 Ga0307413_10167167 3300031824 Bacteria 1552
234 Ga0307410_10023900 3300031852 Bacteria 3810
235 Ga0307407_10071983 3300031903 Bacteria 2060
236 Ga0307407_10093418 3300031903 Bacteria 1850
237 Ga0307412_10058094 3300031911 Bacteria 2586
238 Ga0307409_100106836 3300031995 Bacteria 2337
239 Ga0307409_100338304 3300031995 Bacteria 1415
240 Ga0307409_100494031 3300031995 Bacteria 1190
241 Ga0307409_100730335 3300031995 Bacteria 992
242 Ga0307416_100422995 3300032002 Bacteria 1377
243 Ga0307414_10174982 3300032004 Bacteria 1720
244 Ga0307411_10295933 3300032005 Bacteria 1296
245 Ga0307411_11115373 3300032005 Bacteria 712
246 Ga0307415_101325318 3300032126 Bacteria 683
247 Ga0373958_0052227 3300034819 Bacteria 866
248 Ga0373938_0010463 3300034957 Bacteria 1706
249 Ga0373929_0089280 3300035085 Bacteria 762
250 Ga0373940_0044565 3300035088 Bacteria 1229
251 Ga0373951_0091927 3300035091 Bacteria 797
252 Ga0373952_0050865 3300035092 Bacteria 988
253 Ga0373932_0046835 3300035112 Bacteria 1269
254 Ga0373939_0009300 3300035114 Bacteria 2434
255 Ga0373941_0035827 3300035115 Bacteria 1505
256 Ga0373946_0029012 3300035171 Bacteria 2199
257 Ga0373942_0055950 3300035207 Bacteria 1118
258 Ga0373961_0013042 3300035241 Bacteria 2090
259 Ga0373962_0223228 3300035242 Bacteria 645
260 Ga0373935_0097469 3300035692 Bacteria 1934
261 Ga0373927_0486084 3300035695 Bacteria 816
262 Ga0373925_0418512 3300037068 Bacteria 1094
263 Ga0373925_0630254 3300037068 Bacteria 883
264 Ga0395900_0030621 3300037418 Bacteria 5526
265 Ga0395898_0128393 3300037466 Bacteria 2429
266 Ga0395905_0012411 3300037471 Bacteria 8201
267 Ga0395901_0432409 3300038443 Bacteria 1348
268 Ga0395901_1186259 3300038443 Bacteria 730
269 Ga0242420_041341 3300038996 Bacteria 881
270 Ga0436365_0827246 3300039437 Bacteria 2176
271 Ga0451802_0092412 3300041460 Bacteria 800
272 Ga0451833_0212218 3300041491 Bacteria 835
273 Ga0451851_1031080 3300041507 Bacteria 937
274 Ga0451853_1075010 3300041512 Bacteria 1754
275 Ga0451853_1326858 3300041512 Bacteria 751
276 Ga0466972_0144297 3300044658 Bacteria 1120
277 Ga0466965_0036382 3300044683 Bacteria 2415
278 Ga0466965_0078332 3300044683 Bacteria 1669
279 Ga0466965_0306027 3300044683 Bacteria 863
280 Ga0466966_0297190 3300044684 Bacteria 971
281 Ga0466961_0065871 3300044693 Bacteria 2302
282 Ga0466961_0332369 3300044693 Bacteria 926
283 Ga0466963_0009128 3300044694 Bacteria 5963
284 Ga0466963_0070554 3300044694 Bacteria 2350
285 Ga0466963_0084887 3300044694 Bacteria 2149
286 Ga0466963_0210572 3300044694 Bacteria 1360
287 Ga0466963_0746705 3300044694 Bacteria 690
288 Ga0466964_0037819 3300044706 Bacteria 1939
289 Ga0466964_0053337 3300044706 Bacteria 1664
290 Ga0466964_0202728 3300044706 Bacteria 953
291 Ga0466971_0059303 3300044719 Bacteria 1728
292 Ga0466968_0122507 3300044735 Bacteria 1177
293 Ga0466968_0205296 3300044735 Bacteria 924
294 Ga0466968_0430464 3300044735 Bacteria 650
295 Ga0466970_0038893 3300044765 Bacteria 2524
296 Ga0466970_0060768 3300044765 Bacteria 2024
297 Ga0466970_0071020 3300044765 Bacteria 1872
298 Ga0466970_0186149 3300044765 Bacteria 1153
299 Ga0466970_0245010 3300044765 Bacteria 1003
300 Ga0466957_0371561 3300044842 Bacteria 973
301 Ga0466957_0416692 3300044842 Bacteria 921
302 Ga0466960_0014730 3300044901 Bacteria 3357
303 Ga0466960_0021473 3300044901 Bacteria 2874
304 Ga0466960_0071116 3300044901 Bacteria 1732
305 Ga0466960_0136902 3300044901 Bacteria 1297
306 Ga0466960_0175848 3300044901 Bacteria 1158
307 Ga0466958_0170586 3300045836 Bacteria 1377
308 Ga0466967_0062535 3300045976 Bacteria 3304
309 Ga0466967_0096564 3300045976 Bacteria 2696
310 Ga0466967_0112744 3300045976 Bacteria 2500
311 Ga0466967_0178525 3300045976 Bacteria 2001
312 Ga0466967_0178848 3300045976 Bacteria 2000
313 Ga0466967_0192553 3300045976 Bacteria 1928
314 Ga0466967_0317329 3300045976 Bacteria 1502
315 Ga0466967_0482346 3300045976 Bacteria 1215
316 Ga0466967_0605881 3300045976 Bacteria 1081
317 Ga0466967_0998369 3300045976 Bacteria 833
318 Ga0466967_1045947 3300045976 Bacteria 813
319 Ga0495592_0029689 3300046454 Bacteria 4139
320 Ga0495651_0003074 3300046462 Bacteria 12889
321 Ga0495662_0311346 3300046476 Bacteria 774
322 Ga0495618_0037299 3300046514 Bacteria 3052
323 Ga0495628_0011707 3300046516 Bacteria 7408
324 Ga0495630_0432595 3300046517 Bacteria 1008
325 Ga0495652_0005750 3300046529 Bacteria 11611
326 Ga0495645_0056969 3300046543 Bacteria 2837
327 Ga0495635_0001181 3300046663 Bacteria 17399
328 Ga0495623_0015548 3300046679 Bacteria 4921
329 Ga0495658_0672651 3300046683 Bacteria 663
330 Ga0495624_0229548 3300046690 Bacteria 1124
331 Ga0495600_0027818 3300046809 Bacteria 3656
332 Ga0495593_0360352 3300047673 Bacteria 727
333 Ga0495602_0143597 3300048088 Bacteria 1886
334 Ga0496101_0080888 3300048904 Bacteria 2401
335 Ga0496101_0269058 3300048904 Bacteria 1330
336 Ga0496102_0011605 3300048905 Bacteria 7603
337 Ga0496102_0079095 3300048905 Bacteria 3027
338 Ga0496102_0592369 3300048905 Bacteria 1032
339 Ga0496102_0901305 3300048905 Bacteria 806
340 Ga0496103_0044483 3300048906 Bacteria 2736
341 Ga0496103_0133901 3300048906 Bacteria 1583
342 Ga0496103_0245686 3300048906 Bacteria 1151
343 Ga0496103_0248455 3300048906 Bacteria 1145
344 Ga0496104_0148232 3300048907 Bacteria 2253
345 Ga0496104_0270871 3300048907 Bacteria 1610
346 Ga0496105_0191972 3300048908 Bacteria 1670
347 Ga0496106_0061961 3300048909 Bacteria 2839
348 Ga0496107_0042562 3300048910 Bacteria 3262
349 Ga0496107_0065009 3300048910 Bacteria 2644
350 Ga0496107_0379239 3300048910 Bacteria 1052
351 Ga0496108_0061222 3300048911 Bacteria 3167
352 Ga0496108_0085234 3300048911 Bacteria 2681
353 Ga0496109_0027130 3300048912 Bacteria 5112
354 Ga0496109_0040838 3300048912 Bacteria 4202
355 Ga0496109_0154734 3300048912 Bacteria 2147
356 Ga0496109_0203279 3300048912 Bacteria 1862
357 Ga0496110_0047621 3300048913 Bacteria 3755
358 Ga0496110_0572083 3300048913 Bacteria 1026
359 Ga0496110_0823669 3300048913 Bacteria 833
360 Ga0496111_0000753 3300048914 Bacteria 17277
361 Ga0496111_0043438 3300048914 Bacteria 3230
362 Ga0496111_0358154 3300048914 Bacteria 1080
363 Ga0496112_0084937 3300048915 Bacteria 3131
364 Ga0496112_0178001 3300048915 Bacteria 2091
365 Ga0496113_0941596 3300048916 Bacteria 682
366 Ga0496114_0017843 3300048917 Bacteria 5736
367 Ga0496114_0031481 3300048917 Bacteria 4365
368 Ga0496114_0042933 3300048917 Bacteria 3749
369 Ga0496114_0524431 3300048917 Bacteria 1047
370 Ga0496115_0012673 3300048918 Bacteria 6353
371 Ga0496116_0009290 3300048919 Bacteria 8401
372 Ga0496117_0035305 3300048920 Bacteria 3753
373 Ga0496117_0041520 3300048920 Bacteria 3369
374 Ga0496118_0012747 3300048921 Bacteria 8031
375 Ga0496118_0445926 3300048921 Bacteria 658
376 Ga0496122_0000637 3300048925 Bacteria 71256
377 Ga0496125_0000079 3300048928 Bacteria 230066
378 Ga0501031_0020593 3300049568 Bacteria 4301
379 Ga0501031_0180418 3300049568 Bacteria 1379
380 Ga0501032_0024896 3300049569 Bacteria 4129
381 Ga0501033_0003386 3300049570 Bacteria 13153
382 Ga0501033_0059398 3300049570 Bacteria 2824
383 Ga0501034_0056422 3300049571 Bacteria 3952
384 Ga0501034_0123919 3300049571 Bacteria 2570
385 Ga0501034_0161638 3300049571 Bacteria 2210
386 Ga0501034_1136938 3300049571 Bacteria 661
387 Ga0501036_0006122 3300049572 Bacteria 9765
388 Ga0501036_0451579 3300049572 Bacteria 1071
389 Ga0501037_0021566 3300049573 Bacteria 4762
390 Ga0501037_0024878 3300049573 Bacteria 4426
391 Ga0501038_0045211 3300049574 Bacteria 3823
392 Ga0501039_0079624 3300049575 Bacteria 2549
393 Ga0501039_0225279 3300049575 Bacteria 1474
394 Ga0501040_0056106 3300049576 Bacteria 2703
395 Ga0501040_0597240 3300049576 Bacteria 797
396 Ga0501042_0110175 3300049578 Bacteria 1982
397 Ga0501042_0462908 3300049578 Bacteria 920
398 Ga0501043_0040347 3300049579 Bacteria 3669
399 Ga0501043_0479507 3300049579 Bacteria 931
400 Ga0501046_0016769 3300049580 Bacteria 6124
401 Ga0501046_0036500 3300049580 Bacteria 3954
402 Ga0501047_0013895 3300049581 Bacteria 7645
403 Ga0501047_0182189 3300049581 Bacteria 1967
404 Ga0501047_0433746 3300049581 Bacteria 1144
405 Ga0501047_1123570 3300049581 Bacteria 599
406 Ga0501048_0011025 3300049582 Bacteria 6743
407 Ga0501067_0001526 3300049583 Bacteria 12612
408 Ga0501067_0001657 3300049583 Bacteria 12232
409 Ga0501067_0011641 3300049583 Bacteria 4872
410 Ga0501067_0033500 3300049583 Bacteria 2850
411 Ga0501067_0085611 3300049583 Bacteria 1749
412 Ga0501067_0090220 3300049583 Bacteria 1701
413 Ga0501067_0566574 3300049583 Bacteria 636
414 Ga0501068_0001932 3300049584 Bacteria 11016
415 Ga0501068_0004854 3300049584 Bacteria 7322
416 Ga0501068_0170142 3300049584 Bacteria 1375
417 Ga0501068_0199899 3300049584 Bacteria 1267
418 Ga0501068_0700152 3300049584 Bacteria 662
419 Ga0501069_0012809 3300049585 Bacteria 4465
420 Ga0501069_0014843 3300049585 Bacteria 4171
421 Ga0501069_0021342 3300049585 Bacteria 3513
422 Ga0501069_0061510 3300049585 Bacteria 2097
423 Ga0501069_0121332 3300049585 Bacteria 1493
424 Ga0501070_0004840 3300049586 Bacteria 11504
425 Ga0501070_0086093 3300049586 Bacteria 2601
426 Ga0501070_0166551 3300049586 Bacteria 1816
427 Ga0501072_0002545 3300049588 Bacteria 13663
428 Ga0501073_0003406 3300049589 Bacteria 11960
429 Ga0501073_0040068 3300049589 Bacteria 3317
430 Ga0501073_0070449 3300049589 Bacteria 2436
431 Ga0501074_0002866 3300049590 Bacteria 12079
432 Ga0501074_0005254 3300049590 Bacteria 9316
433 Ga0501074_0069624 3300049590 Bacteria 2530
434 Ga0501076_0320064 3300049592 Bacteria 1272
435 Ga0501076_0460899 3300049592 Bacteria 1047
436 Ga0501076_0578239 3300049592 Bacteria 926
437 Ga0501076_0716139 3300049592 Bacteria 826
438 Ga0501077_0001085 3300049593 Bacteria 16408
439 Ga0501077_0024544 3300049593 Bacteria 3829
440 Ga0501209_035969 3300049656 Bacteria 1285
441 Ga0501079_0097387 3300049741 Bacteria 2281
442 Ga0501080_0017448 3300049742 Bacteria 6638
443 Ga0501080_0039065 3300049742 Bacteria 4429
444 Ga0501080_0130418 3300049742 Bacteria 2327
445 Ga0501083_0004399 3300049744 Bacteria 9933
446 Ga0501035_0008456 3300049822 Bacteria 9587
447 Ga0501035_0107427 3300049822 Bacteria 2447
448 Ga0501035_0112398 3300049822 Bacteria 2386
449 Ga0501044_0005123 3300049823 Bacteria 14617
450 Ga0501044_0485412 3300049823 Bacteria 1138
451 Ga0501045_0044061 3300049824 Bacteria 3249
452 Ga0501045_0057794 3300049824 Bacteria 2839
453 Ga0501045_0369347 3300049824 Bacteria 1068
454 nmdc:mga03n38_54784_c1 3300050490 Bacteria 1794
455 nmdc:mga03n38_8285_c1 3300050490 Bacteria 3723
456 nmdc:mga00v17_352708_c1 3300050491 Bacteria 956
457 nmdc:mga00v17_367946_c1 3300050491 Bacteria 935
458 nmdc:mga00v17_50343_c1 3300050491 Bacteria 2530
459 nmdc:mga0yw44_506154_c1 3300050492 Bacteria 820
460 nmdc:mga0yw44_74228_c1 3300050492 Bacteria 2118
461 nmdc:mga0yw44_853474_c1 3300050492 Bacteria 618
462 nmdc:mga0yw44_86372_c1 3300050492 Bacteria 1976
463 nmdc:mga06z11_172208_c1 3300050494 Bacteria 1244
464 nmdc:mga07m45_205280_c1 3300050496 Bacteria 1146
465 nmdc:mga07m45_397979_c1 3300050496 Bacteria 799
466 nmdc:mga05p37_152_c1 3300050507 Bacteria 65549
467 nmdc:mga09592_63_c1 3300050508 Bacteria 60777
468 nmdc:mga0qj67_39354_c1 3300050509 Bacteria 3712
469 nmdc:mga06r32_9202_c1 3300050510 Bacteria 8905
470 nmdc:mga08y16_1163694_c1 3300050511 Bacteria 743
471 nmdc:mga08y16_6384_c1 3300050511 Bacteria 12364
472 nmdc:mga0n895_381163_c1 3300050512 Bacteria 1427
473 nmdc:mga0n895_74463_c1 3300050512 Bacteria 3373
474 nmdc:mga0rr50_36530_c1 3300050513 Bacteria 2150
475 nmdc:mga0a205_61775_c1 3300050515 Bacteria 3619
476 nmdc:mga0a205_77898_c2 3300050515 Bacteria 1272
477 Ga0495601_0025845 3300053077 Bacteria 3622
478 Ga0495612_0004957 3300053078 Bacteria 5510
479 Ga0495619_0213504 3300053085 Bacteria 1336
480 Ga0500643_000497 3300053087 Bacteria 28195
481 Ga0500641_0049604 3300053096 Bacteria 1722
482 Ga0500554_059694 3300053102 Bacteria 1221
483 Ga0500556_0001592 3300053104 Bacteria 9040
484 Ga0500593_021009 3300053117 Bacteria 2871
485 Ga0500573_0003868 3300053140 Bacteria 7812
486 Ga0500573_0124999 3300053140 Bacteria 1429
487 Ga0466962_0010291 3300061719 Bacteria 4493
488 Ga0530510_0157106 3300061734 Bacteria 1681
489 2644090753 2643221615 Bacteria 5487866
490 2644320557 2643221657 Bacteria 5490246
491 2676198641 2675902999 Bacteria 9438463
492 2738870582 2738541305 Bacteria 4910150
493 2774393811 2773857762 Bacteria 5971770
494 2774843219 2773857921 Bacteria 9435764
495 2809195314 2808606439 Bacteria 5952208
496 2812350188 2811994878 Bacteria 5992952
497 2857482798 2857481737 Bacteria 4761446
498 2891972187 2891968417 Bacteria 5821697
499 Ga0307409_101015946
500 JGI24739J22299_10193308
501 JGI24737J22298_10156955
502 Ga0070683_100002195
503 Ga0070683_100088042
504 Ga0070683_100530478
505 Ga0070683_100631237
506 Ga0070683_100804966
507 Ga0070670_100141494
508 Ga0070670_100998435
509 Ga0068869_100125788
510 Ga0070682_100040513
511 Ga0070682_100509769
512 Ga0068868_100028319
513 Ga0068868_100160297
514 Ga0068868_100202600
515 Ga0070660_100042799
516 Ga0070660_100525260
517 Ga0070689_100534648
518 Ga0070691_10036704
519 Ga0070687_100455233
520 Ga0070692_10094002
521 Ga0070692_10174124
522 Ga0070668_100866032
523 Ga0070675_100491444
524 Ga0070674_100005174
525 Ga0070673_100368377
526 Ga0070673_100470557
527 Ga0070710_10073879
528 Ga0070710_10215807
529 Ga0070701_10174330
530 Ga0070700_100002303
531 Ga0070700_101242325
532 Ga0070678_100816141
533 Ga0070678_101288507
534 Ga0070662_100484268
535 Ga0070681_10003998
536 Ga0070681_10264938
537 Ga0068867_100004168
538 Ga0070685_10377532
539 Ga0070679_100058686
540 Ga0070684_100001182
541 Ga0070684_100223428
542 Ga0070684_100279100
543 Ga0070684_100341701
544 Ga0068853_100239276
545 Ga0070672_100012174
546 Ga0070686_100028259
547 Ga0070686_100297449
548 Ga0070695_100047516
549 Ga0070695_100607874
550 Ga0070693_100044245
551 Ga0070665_100002481
552 Ga0070665_100252850
553 Ga0070665_100792193
554 Ga0070665_100985941
555 Ga0070664_100750736
556 Ga0068857_100005347
557 Ga0068857_100234266
558 Ga0068856_100012929
559 Ga0068856_100526753
560 Ga0070702_100003489
561 Ga0068852_100008365
562 Ga0068852_100057229
563 Ga0068852_100637030
564 Ga0068864_100111233
565 Ga0068866_10426666
566 Ga0068870_10003430
567 Ga0068860_100721946
568 Ga0068860_101635261
569 Ga0068862_100207050
570 Ga0081455_10000298
571 Ga0081455_10004995
572 Ga0081539_10245407
573 Ga0070717_10542922
574 Ga0070717_10678140
575 Ga0075365_10123824
576 Ga0075365_10239587
577 Ga0075365_10339843
578 Ga0075365_10426335
579 Ga0075365_10576871
580 Ga0075368_10002711
581 Ga0075363_100217893
582 Ga0075364_10102935
583 Ga0075364_10363962
584 Ga0070715_10017511
585 Ga0070712_100673585
586 Ga0075367_10006790
587 Ga0075370_10010910
588 Ga0068871_100055706
589 Ga0075428_100010093
590 Ga0075430_100066567
591 Ga0075431_100021939
592 Ga0075433_10123234
593 Ga0075433_11078360
594 Ga0075434_100254176
595 Ga0075434_100405859
596 Ga0075429_100011256
597 Ga0068865_100004270
598 Ga0068865_100065174
599 Ga0075436_100111849
600 Ga0075435_100082985
601 Ga0111539_10017115
602 Ga0105245_10002677
603 Ga0105245_10010146
604 Ga0105245_10313636
605 Ga0105245_10663483
606 Ga0105247_10754258
607 Ga0114129_10214373
608 Ga0114129_10291016
609 Ga0105243_10006868
610 Ga0105243_10106935
611 Ga0105243_10625551
612 Ga0105242_10076774
613 Ga0105242_10436207
614 Ga0105248_10508370
615 Ga0105237_10388048
616 Ga0105238_10104962
617 Ga0105238_10237264
618 Ga0105238_10497119
619 Ga0105249_10028111
620 Ga0105249_10622055
621 Ga0105249_11201576
622 Ga0105239_10013026
623 Ga0105239_10696589
624 Ga0105239_11261686
625 Ga0105246_10000827
626 Ga0105246_10031000
627 Ga0105246_10570476
628 Ga0157338_1019069
629 Ga0157371_10285834
630 Ga0157370_11094981
631 Ga0157369_10077522
632 Ga0157369_11497340
633 Ga0157378_11128432
634 Ga0163162_10018971
635 Ga0163162_10368348
636 Ga0163162_10766153
637 Ga0157372_10028354
638 Ga0157372_10057174
639 Ga0157372_12212630
640 Ga0157375_10109583
641 Ga0163163_10033424
642 Ga0163163_10058098
643 Ga0163163_10349046
644 Ga0157380_10005485
645 Ga0157377_10126508
646 Ga0157379_10004911
647 Ga0157376_10321947
648 Ga0157376_10850772
649 Ga0163161_10180028
650 Ga0163161_10668191
651 Ga0163161_11108176
652 Ga0206354_10689030
653 Ga0206354_11713657
654 Ga0206353_10400300
655 Ga0206353_11028802
656 Ga0207682_10294663
657 Ga0207692_10016213
658 Ga0207642_10273893
659 Ga0207642_10360152
660 Ga0207688_10038027
661 Ga0207688_10129052
662 Ga0207688_10316334
663 Ga0207647_10024239
664 Ga0207699_10075683
665 Ga0207643_10040381
666 Ga0207705_10097613
667 Ga0207707_10136806
668 Ga0207663_10003531
669 Ga0207662_10913234
670 Ga0207657_10053484
671 Ga0207687_10002919
672 Ga0207687_10075831
673 Ga0207700_10013157
674 Ga0207664_10090285
675 Ga0207706_10266748
676 Ga0207686_10526668
677 Ga0207709_10018513
678 Ga0207709_10073893
679 Ga0207669_10318498
680 Ga0207669_10486224
681 Ga0207704_10039720
682 Ga0207704_10041270
683 Ga0207691_10003002
684 Ga0207691_10344773
685 Ga0207711_10393223
686 Ga0207711_10630943
687 Ga0207661_10011381
688 Ga0207661_10149503
689 Ga0207661_10220960
690 Ga0207661_10420097
691 Ga0207661_10891358
692 Ga0207679_10262364
693 Ga0207651_10036355
694 Ga0207651_10234609
695 Ga0207712_11007853
696 Ga0207668_10348397
697 Ga0207677_10004641
698 Ga0207677_10018227
699 Ga0207677_10183330
700 Ga0207703_10542178
701 Ga0207639_10114633
702 Ga0207678_10468948
703 Ga0207708_10001371
704 Ga0207708_10022724
705 Ga0207708_10131416
706 Ga0207708_10614918
707 Ga0207702_10018279
708 Ga0207702_10264762
709 Ga0207702_10506703
710 Ga0207641_11188904
711 Ga0207648_10003822
712 Ga0207648_10241841
713 Ga0207676_10046468
714 Ga0207674_10043696
715 Ga0207674_10259050
716 Ga0207675_100264990
717 Ga0207675_100506711
718 Ga0207683_10293164
719 Ga0207683_10606313
720 Ga0207698_10015271
721 Ga0207698_10206574
722 Ga0209983_1071744
723 Ga0207428_10025216
724 Ga0268266_10001392
725 Ga0268266_10307654
726 Ga0268265_10194537
727 Ga0268264_10646279
728 Ga0268264_10661499
729 Ga0316181_1102777
730 Ga0307509_10048344
731 Ga0307413_10167167
732 Ga0307410_10023900
733 Ga0307407_10071983
734 Ga0307407_10093418
735 Ga0307412_10058094
736 Ga0307409_100106836
737 Ga0307409_100338304
738 Ga0307409_100494031
739 Ga0307409_100730335
740 Ga0307416_100422995
741 Ga0307414_10174982
742 Ga0307411_10295933
743 Ga0307411_11115373
744 Ga0307415_101325318
745 Ga0373958_0052227
746 Ga0373938_0010463
747 Ga0373929_0089280
748 Ga0373940_0044565
749 Ga0373951_0091927
750 Ga0373952_0050865
751 Ga0373932_0046835
752 Ga0373939_0009300
753 Ga0373941_0035827
754 Ga0373946_0029012
755 Ga0373942_0055950
756 Ga0373961_0013042
757 Ga0373962_0223228
758 Ga0373935_0097469
759 Ga0373927_0486084
760 Ga0373925_0418512
761 Ga0373925_0630254
762 Ga0395900_0030621
763 Ga0395898_0128393
764 Ga0395905_0012411
765 Ga0395901_0432409
766 Ga0395901_1186259
767 Ga0242420_041341
768 Ga0436365_0827246
769 Ga0451802_0092412
770 Ga0451833_0212218
771 Ga0451851_1031080
772 Ga0451853_1075010
773 Ga0451853_1326858
774 Ga0466972_0144297
775 Ga0466965_0036382
776 Ga0466965_0078332
777 Ga0466965_0306027
778 Ga0466966_0297190
779 Ga0466961_0065871
780 Ga0466961_0332369
781 Ga0466963_0009128
782 Ga0466963_0070554
783 Ga0466963_0084887
784 Ga0466963_0210572
785 Ga0466963_0746705
786 Ga0466964_0037819
787 Ga0466964_0053337
788 Ga0466964_0202728
789 Ga0466971_0059303
790 Ga0466968_0122507
791 Ga0466968_0205296
792 Ga0466968_0430464
793 Ga0466970_0038893
794 Ga0466970_0060768
795 Ga0466970_0071020
796 Ga0466970_0186149
797 Ga0466970_0245010
798 Ga0466957_0371561
799 Ga0466957_0416692
800 Ga0466960_0014730
801 Ga0466960_0021473
802 Ga0466960_0071116
803 Ga0466960_0136902
804 Ga0466960_0175848
805 Ga0466958_0170586
806 Ga0466967_0062535
807 Ga0466967_0096564
808 Ga0466967_0112744
809 Ga0466967_0178525
810 Ga0466967_0178848
811 Ga0466967_0192553
812 Ga0466967_0317329
813 Ga0466967_0482346
814 Ga0466967_0605881
815 Ga0466967_0998369
816 Ga0466967_1045947
817 Ga0495592_0029689
818 Ga0495651_0003074
819 Ga0495662_0311346
820 Ga0495618_0037299
821 Ga0495628_0011707
822 Ga0495630_0432595
823 Ga0495652_0005750
824 Ga0495645_0056969
825 Ga0495635_0001181
826 Ga0495623_0015548
827 Ga0495658_0672651
828 Ga0495624_0229548
829 Ga0495600_0027818
830 Ga0495593_0360352
831 Ga0495602_0143597
832 Ga0496101_0080888
833 Ga0496101_0269058
834 Ga0496102_0011605
835 Ga0496102_0079095
836 Ga0496102_0592369
837 Ga0496102_0901305
838 Ga0496103_0044483
839 Ga0496103_0133901
840 Ga0496103_0245686
841 Ga0496103_0248455
842 Ga0496104_0148232
843 Ga0496104_0270871
844 Ga0496105_0191972
845 Ga0496106_0061961
846 Ga0496107_0042562
847 Ga0496107_0065009
848 Ga0496107_0379239
849 Ga0496108_0061222
850 Ga0496108_0085234
851 Ga0496109_0027130
852 Ga0496109_0040838
853 Ga0496109_0154734
854 Ga0496109_0203279
855 Ga0496110_0047621
856 Ga0496110_0572083
857 Ga0496110_0823669
858 Ga0496111_0000753
859 Ga0496111_0043438
860 Ga0496111_0358154
861 Ga0496112_0084937
862 Ga0496112_0178001
863 Ga0496113_0941596
864 Ga0496114_0017843
865 Ga0496114_0031481
866 Ga0496114_0042933
867 Ga0496114_0524431
868 Ga0496115_0012673
869 Ga0496116_0009290
870 Ga0496117_0035305
871 Ga0496117_0041520
872 Ga0496118_0012747
873 Ga0496118_0445926
874 Ga0496122_0000637
875 Ga0496125_0000079
876 Ga0501031_0020593
877 Ga0501031_0180418
878 Ga0501032_0024896
879 Ga0501033_0003386
880 Ga0501033_0059398
881 Ga0501034_0056422
882 Ga0501034_0123919
883 Ga0501034_0161638
884 Ga0501034_1136938
885 Ga0501036_0006122
886 Ga0501036_0451579
887 Ga0501037_0021566
888 Ga0501037_0024878
889 Ga0501038_0045211
890 Ga0501039_0079624
891 Ga0501039_0225279
892 Ga0501040_0056106
893 Ga0501040_0597240
894 Ga0501042_0110175
895 Ga0501042_0462908
896 Ga0501043_0040347
897 Ga0501043_0479507
898 Ga0501046_0016769
899 Ga0501046_0036500
900 Ga0501047_0013895
901 Ga0501047_0182189
902 Ga0501047_0433746
903 Ga0501047_1123570
904 Ga0501048_0011025
905 Ga0501067_0001526
906 Ga0501067_0001657
907 Ga0501067_0011641
908 Ga0501067_0033500
909 Ga0501067_0085611
910 Ga0501067_0090220
911 Ga0501067_0566574
912 Ga0501068_0001932
913 Ga0501068_0004854
914 Ga0501068_0170142
915 Ga0501068_0199899
916 Ga0501068_0700152
917 Ga0501069_0012809
918 Ga0501069_0014843
919 Ga0501069_0021342
920 Ga0501069_0061510
921 Ga0501069_0121332
922 Ga0501070_0004840
923 Ga0501070_0086093
924 Ga0501070_0166551
925 Ga0501072_0002545
926 Ga0501073_0003406
927 Ga0501073_0040068
928 Ga0501073_0070449
929 Ga0501074_0002866
930 Ga0501074_0005254
931 Ga0501074_0069624
932 Ga0501076_0320064
933 Ga0501076_0460899
934 Ga0501076_0578239
935 Ga0501076_0716139
936 Ga0501077_0001085
937 Ga0501077_0024544
938 Ga0501209_035969
939 Ga0501079_0097387
940 Ga0501080_0017448
941 Ga0501080_0039065
942 Ga0501080_0130418
943 Ga0501083_0004399
944 Ga0501035_0008456
945 Ga0501035_0107427
946 Ga0501035_0112398
947 Ga0501044_0005123
948 Ga0501044_0485412
949 Ga0501045_0044061
950 Ga0501045_0057794
951 Ga0501045_0369347
952 nmdc:mga03n38_54784_c1
953 nmdc:mga03n38_8285_c1
954 nmdc:mga00v17_352708_c1
955 nmdc:mga00v17_367946_c1
956 nmdc:mga00v17_50343_c1
957 nmdc:mga0yw44_506154_c1
958 nmdc:mga0yw44_74228_c1
959 nmdc:mga0yw44_853474_c1
960 nmdc:mga0yw44_86372_c1
961 nmdc:mga06z11_172208_c1
962 nmdc:mga07m45_205280_c1
963 nmdc:mga07m45_397979_c1
964 nmdc:mga05p37_152_c1
965 nmdc:mga09592_63_c1
966 nmdc:mga0qj67_39354_c1
967 nmdc:mga06r32_9202_c1
968 nmdc:mga08y16_1163694_c1
969 nmdc:mga08y16_6384_c1
970 nmdc:mga0n895_381163_c1
971 nmdc:mga0n895_74463_c1
972 nmdc:mga0rr50_36530_c1
973 nmdc:mga0a205_61775_c1
974 nmdc:mga0a205_77898_c2
975 Ga0495601_0025845
976 Ga0495612_0004957
977 Ga0495619_0213504
978 Ga0500643_000497
979 Ga0500641_0049604
980 Ga0500554_059694
981 Ga0500556_0001592
982 Ga0500593_021009
983 Ga0500573_0003868
984 Ga0500573_0124999
985 Ga0466962_0010291
986 Ga0530510_0157106
987 2644090753
988 2644320557
989 2676198641
990 2738870582
991 2774393811
992 2774843219
993 2809195314
994 2812350188
995 2857482798
996 2891972187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

30

169

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bes-assembly2.cif.gz_C structure of mycobacterium tuberculosis ribose-5-phosphate isomerase, rpib, rv2465c, in complex with 4-phospho-d-erythronohydroxamic acid. 0.9732 1 156
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9563 2 146
2bes-assembly2.cif.gz_C structure of mycobacterium tuberculosis ribose-5-phosphate isomerase, rpib, rv2465c, in complex with 4-phospho-d-erythronohydroxamic acid. 0.9552 1 156
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.9539 1 150
6mu0-assembly1.cif.gz_A crystal structure of ribose-5-phosphate isomerase b from mycoplasma genitalium with bound ribulose-5-phosphate 0.9524 2 148
ID Description Score Start End Superfamily
af_P9WKD7_1_162_3.40.1400.10 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9772 1 156 3.40.1400.10
6mu0A00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9519 2 148 3.40.1400.10
4em8B00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9492 2 142 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9485 2 144 3.40.1400.10
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9472 2 147 3.40.1400.10
ID Description Score Start End GO Terms
AF-F5XP55-F1-model_v4 Ribose-5-phosphate isomerase B (EC 5.3.1.6) (Phosphoriboisomerase B) 0.9927 1 147 GO:0004751
GO:0009052
GO:0019316
AF-A0A2G7E7J1-F1-model_v4 deleted 0.9923 1 156
AF-A0A1H6DPR8-F1-model_v4 Ribose-5-phosphate isomerase B (EC 5.3.1.6) (Phosphoriboisomerase B) 0.9923 1 156 GO:0004751
GO:0009052
GO:0019316
AF-C9Z7D9-F1-model_v4 Ribose-5-phosphate isomerase B (EC 5.3.1.6) (Phosphoriboisomerase B) 0.9922 1 156 GO:0004751
GO:0009052
GO:0019316
AF-A0A0N0AP15-F1-model_v4 Ribose-5-phosphate isomerase B (EC 5.3.1.6) (Phosphoriboisomerase B) 0.9921 1 155 GO:0004751
GO:0009052
GO:0019316

Map