F455189

General Info

Members Datasets Scaffolds Average Seq Length
498 271 996 192

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10012652|Ga0157370_100126528
Length 224
Sequence MLRTVCPAVKSILYRLAPPGRRGQTADPTDRYFRMLPPMLASTSRYRLELLQRLGLAPDCARPDVDETPRPGESPHALAVRLAQAKAAEVAARHPGRWVIGSDQVAELNGSPLGKPGTVAAAQAQLAAMSGQVVAFHTAVSLHCDDRELAACDLTRVHFRALDAATIARYVAAEQPLDCAGSFKCEGLGIALFEAIENRDPTALIGLPLIATSQLLRQAGYTLP

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
65 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
75 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
80 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
114 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
115 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
125 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
126 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
132 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
133 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
134 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
135 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
136 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
137 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
138 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
139 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
140 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
141 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
144 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
145 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
146 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
147 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
160 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
161 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
190 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
191 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
218 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
227 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
228 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
229 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
230 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
233 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
234 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
235 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
237 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
238 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
239 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
240 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
241 2734482264 Dyella sp. AD052 Isolate Unclassified
242 2738543009 Luteibacter sp. OK325 Isolate Unclassified
243 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
244 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
245 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
246 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
247 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
248 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
249 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
250 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
251 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
252 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
253 2884411467 Dyella sp. AD56 Isolate Rhizosphere
254 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
255 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
256 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
257 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
258 2919404418 Luteibacter sp. 3190 Isolate Unclassified
259 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
260 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
261 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
262 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
263 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
264 2941471342 Luteibacter sp. 621 Isolate Unclassified
265 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
266 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
267 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
268 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
269 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
270 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
271 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.57
Metatranscriptomes 0.4
Isolates 7.03

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 20.48
Nodule 0.2
Rhizoplane 3.41
Rhizosphere 48.59
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10012652 3300013104 Bacteria 8740
2 JGI24737J22298_10043405 3300001990 Bacteria 1376
3 JGI25156J39149_1002391 3300002705 Bacteria 6781
4 JGI25162J39368_1000937 3300002737 Bacteria 18769
5 JGI25162J39368_1001538 3300002737 Bacteria 11877
6 JGI25157J39369_1000845 3300002741 Bacteria 15120
7 JGI25164J39214_1000142 3300002772 Bacteria 68956
8 JGI25152J39213_1000400 3300002773 Bacteria 26436
9 JGI25150J39212_1000387 3300002774 Bacteria 20980
10 JGI25151J46595_10000107 3300003187 Bacteria 113288
11 JGI25165J46597_1000090 3300003214 Bacteria 168833
12 JGI25165J46597_1020324 3300003214 Bacteria 870
13 JGI25153J46596_10000078 3300003215 Bacteria 113288
14 rootH2_10058115 3300003320 Bacteria 11775
15 rootL2_10198872 3300003322 Bacteria 2380
16 rootH1_10392548 3300003323 Bacteria 1500
17 Ga0006562J51391_1040298 3300003578 Bacteria 8810
18 Ga0006562J51391_1040299 3300003578 Bacteria 8470
19 Ga0055539_1000930 3300003752 Bacteria 6538
20 Ga0055539_1021890 3300003752 Bacteria 758
21 Ga0055533_1000474 3300003756 Bacteria 15083
22 Ga0055533_1015420 3300003756 Bacteria 751
23 Ga0055525_1000097 3300003759 Bacteria 137371
24 Ga0055527_1000198 3300003760 Bacteria 39703
25 Ga0055527_1000344 3300003760 Bacteria 23312
26 Ga0055527_1000513 3300003760 Bacteria 13411
27 Ga0055527_1001814 3300003760 Bacteria 4065
28 Ga0055535_1000488 3300003761 Bacteria 35722
29 Ga0055535_1000795 3300003761 Bacteria 22979
30 Ga0055535_1001318 3300003761 Bacteria 13235
31 Ga0055535_1001894 3300003761 Bacteria 8825
32 Ga0055542_1000441 3300003762 Bacteria 39703
33 Ga0055542_1000616 3300003762 Bacteria 30337
34 Ga0055542_1001808 3300003762 Bacteria 8825
35 Ga0055529_1000305 3300003763 Bacteria 56629
36 Ga0055529_1000591 3300003763 Bacteria 28451
37 Ga0055529_1001024 3300003763 Bacteria 13373
38 Ga0055526_1000234 3300003771 Bacteria 46624
39 Ga0055526_1003383 3300003771 Bacteria 10165
40 Ga0055537_1000017 3300003773 Bacteria 123856
41 Ga0055536_1004162 3300003781 Bacteria 7490
42 Ga0055534_1000330 3300003784 Bacteria 31193
43 Ga0055528_1000811 3300003790 Bacteria 21508
44 Ga0055530_10003006 3300003791 Bacteria 10101
45 Ga0055530_10003008 3300003791 Bacteria 10096
46 Ga0055531_10005393 3300003794 Bacteria 7493
47 Ga0055531_10005398 3300003794 Bacteria 7490
48 Ga0065165_1000028 3300005262 Bacteria 224430
49 Ga0070670_100000395 3300005331 Bacteria 35994
50 Ga0070670_100907529 3300005331 Bacteria 799
51 Ga0070682_100014878 3300005337 Bacteria 4503
52 Ga0070661_100083274 3300005344 Bacteria 2362
53 Ga0070661_100144461 3300005344 Bacteria 1795
54 Ga0070668_100007687 3300005347 Bacteria 7998
55 Ga0070659_100003696 3300005366 Bacteria 10913
56 Ga0070663_100540985 3300005455 Bacteria 972
57 Ga0070678_100157684 3300005456 Bacteria 1835
58 Ga0070681_10014952 3300005458 Bacteria 7717
59 Ga0070684_100466159 3300005535 Bacteria 1168
60 Ga0068853_100004286 3300005539 Bacteria 11028
61 Ga0070665_100061806 3300005548 Bacteria 3755
62 Ga0068855_100008679 3300005563 Bacteria 12283
63 Ga0070664_100469071 3300005564 Bacteria 1157
64 Ga0068856_100013948 3300005614 Bacteria 7770
65 Ga0068861_100545996 3300005719 Bacteria 1055
66 Ga0068863_100026503 3300005841 Bacteria 5528
67 Ga0081540_1001936 3300005983 Bacteria 17331
68 Ga0081539_10011473 3300005985 Bacteria 6996
69 Ga0075365_10044043 3300006038 Bacteria 2923
70 Ga0075368_10188615 3300006042 Bacteria 870
71 Ga0075364_10000037 3300006051 Bacteria 47111
72 Ga0075364_10123958 3300006051 Bacteria 1731
73 Ga0075364_10124050 3300006051 Bacteria 1730
74 Ga0105251_10000063 3300009011 Bacteria 101276
75 Ga0105251_10008820 3300009011 Bacteria 6039
76 Ga0105244_10022967 3300009036 Bacteria 3428
77 Ga0105240_10011330 3300009093 Bacteria 12422
78 Ga0105247_10010176 3300009101 Bacteria 5697
79 Ga0105239_10000044 3300010375 Bacteria 187680
80 Ga0105239_10009711 3300010375 Bacteria 10819
81 Ga0157373_10079074 3300013100 Bacteria 2319
82 Ga0157373_10115314 3300013100 Bacteria 1889
83 Ga0157373_10233914 3300013100 Bacteria 1298
84 Ga0157373_10235174 3300013100 Bacteria 1294
85 Ga0157371_10001088 3300013102 Bacteria 29433
86 Ga0157370_10056936 3300013104 Bacteria 3719
87 Ga0157369_10000329 3300013105 Bacteria 63484
88 Ga0157375_11668175 3300013308 Bacteria 754
89 Ga0182008_10000096 3300014497 Bacteria 67450
90 Ga0182008_10004395 3300014497 Bacteria 8244
91 Ga0182008_10007424 3300014497 Bacteria 6053
92 Ga0182006_1000072 3300015261 Bacteria 133681
93 Ga0182006_1000540 3300015261 Bacteria 28709
94 Ga0182006_1049800 3300015261 Bacteria 1616
95 Ga0182007_10000048 3300015262 Bacteria 103024
96 Ga0182007_10003221 3300015262 Bacteria 7775
97 Ga0182005_1000264 3300015265 Bacteria 33137
98 Ga0182005_1000621 3300015265 Bacteria 17087
99 Ga0182005_1007491 3300015265 Bacteria 3271
100 Ga0182005_1031856 3300015265 Bacteria 1435
101 Ga0183361_10878 3300016635 Bacteria 1443
102 Ga0163161_10002475 3300017792 Bacteria 13168
103 Ga0163161_10010185 3300017792 Bacteria 6508
104 Ga0163161_10020455 3300017792 Bacteria 4643
105 Ga0163161_10115169 3300017792 Bacteria 2014
106 Ga0163161_10418386 3300017792 Bacteria 1078
107 Ga0209566_101328 3300025225 Bacteria 7932
108 Ga0209674_100506 3300025226 Bacteria 16062
109 Ga0209674_100940 3300025226 Bacteria 9273
110 Ga0209672_100007 3300025228 Bacteria 959482
111 Ga0209672_100078 3300025228 Bacteria 156926
112 Ga0209672_100265 3300025228 Bacteria 38562
113 Ga0209563_100079 3300025230 Bacteria 203017
114 Ga0207427_100033 3300025231 Bacteria 338459
115 Ga0209437_100105 3300025233 Bacteria 220034
116 Ga0209437_101029 3300025233 Bacteria 9434
117 Ga0209258_100012 3300025242 Bacteria 825544
118 Ga0209258_100046 3300025242 Bacteria 369794
119 Ga0209258_100095 3300025242 Bacteria 223270
120 Ga0207425_1000028 3300025245 Bacteria 286333
121 Ga0209646_1000775 3300025246 Bacteria 10995
122 Ga0209026_1000278 3300025250 Bacteria 59676
123 Ga0209026_1000285 3300025250 Bacteria 58221
124 Ga0209677_101982 3300025253 Bacteria 8133
125 Ga0209677_109425 3300025253 Bacteria 1753
126 Ga0209148_1000014 3300025254 Bacteria 925277
127 Ga0209148_1000039 3300025254 Bacteria 482479
128 Ga0209148_1000098 3300025254 Bacteria 233172
129 Ga0209148_1004404 3300025254 Bacteria 3479
130 Ga0209759_1000460 3300025256 Bacteria 46256
131 Ga0209759_1000536 3300025256 Bacteria 39942
132 Ga0209129_1000011 3300025258 Bacteria 568657
133 Ga0209233_1000080 3300025261 Bacteria 338459
134 Ga0209233_1031103 3300025261 Bacteria 1250
135 Ga0209565_1000031 3300025263 Bacteria 320341
136 Ga0209455_1000010 3300025272 Bacteria 959482
137 Ga0209455_1000034 3300025272 Bacteria 483129
138 Ga0209455_1000126 3300025272 Bacteria 165771
139 Ga0209673_1000204 3300025273 Bacteria 119618
140 Ga0209675_1000015 3300025291 Bacteria 403517
141 Ga0209676_1000110 3300025292 Bacteria 214083
142 Ga0209676_1003063 3300025292 Bacteria 10782
143 Ga0209025_1000002 3300025294 Bacteria 1393142
144 Ga0209564_1000037 3300025295 Bacteria 414794
145 Ga0209758_1000003 3300025297 Bacteria 1398533
146 Ga0209050_1000417 3300025298 Bacteria 78631
147 Ga0209050_1000648 3300025298 Bacteria 53880
148 Ga0209256_1004014 3300025299 Bacteria 9616
149 Ga0209051_1018184 3300025303 Bacteria 3117
150 Ga0209257_1000129 3300025304 Bacteria 214155
151 Ga0209257_1000231 3300025304 Bacteria 131226
152 Ga0209257_1004792 3300025304 Bacteria 10078
153 Ga0209257_1005426 3300025304 Bacteria 8962
154 Ga0207713_1000204 3300025735 Bacteria 81680
155 Ga0207710_10009403 3300025900 Bacteria 4113
156 Ga0207647_10000029 3300025904 Bacteria 109732
157 Ga0207707_10013443 3300025912 Bacteria 7133
158 Ga0207695_10006400 3300025913 Bacteria 15298
159 Ga0207649_10044923 3300025920 Bacteria 2706
160 Ga0207649_10418856 3300025920 Bacteria 1005
161 Ga0207690_10002804 3300025932 Bacteria 10519
162 Ga0207709_10000916 3300025935 Bacteria 22239
163 Ga0207667_10033438 3300025949 Bacteria 5528
164 Ga0207668_10823672 3300025972 Bacteria 823
165 Ga0207639_10000643 3300026041 Bacteria 24069
166 Ga0207678_10248630 3300026067 Bacteria 1523
167 Ga0207702_10031237 3300026078 Bacteria 4438
168 Ga0207641_10044935 3300026088 Bacteria 3716
169 Ga0207675_100863495 3300026118 Bacteria 920
170 Ga0207683_10038699 3300026121 Bacteria 4159
171 Ga0207683_10191641 3300026121 Bacteria 1856
172 Ga0268266_10038499 3300028379 Bacteria 4071
173 Ga0265334_10000097 3300028573 Bacteria 61159
174 Ga0307515_10139988 3300028794 Bacteria 2602
175 Ga0316183_1181528 3300030742 Bacteria 13360
176 Ga0316182_1416967 3300030745 Bacteria 1635
177 Ga0316576_10226129 3300031727 Bacteria 1407
178 Ga0307405_10079001 3300031731 Bacteria 2143
179 Ga0307413_10024539 3300031824 Bacteria 3289
180 Ga0307406_10511945 3300031901 Bacteria 975
181 Ga0307407_10019107 3300031903 Bacteria 3483
182 Ga0307412_10001403 3300031911 Bacteria 13394
183 Ga0307412_10003149 3300031911 Bacteria 9160
184 Ga0307412_10040203 3300031911 Bacteria 3025
185 Ga0307412_10047057 3300031911 Bacteria 2831
186 Ga0307412_10258824 3300031911 Bacteria 1355
187 Ga0307416_100188633 3300032002 Bacteria 1941
188 Ga0307414_10024245 3300032004 Bacteria 3865
189 Ga0307414_10049069 3300032004 Bacteria 2916
190 Ga0307414_10087650 3300032004 Bacteria 2301
191 Ga0307414_10219904 3300032004 Bacteria 1558
192 Ga0307414_10576958 3300032004 Bacteria 1006
193 Ga0307414_10721583 3300032004 Bacteria 904
194 Ga0307415_100097865 3300032126 Bacteria 2143
195 Ga0316583_10141923 3300032133 Bacteria 837
196 Ga0316574_0131269 3300035398 Bacteria 1612
197 Ga0316584_0020284 3300036712 Bacteria 4816
198 Ga0395899_0000319 3300037312 Bacteria 61296
199 Ga0395899_0453249 3300037312 Bacteria 839
200 Ga0395900_0000061 3300037418 Bacteria 202483
201 Ga0395900_0027987 3300037418 Bacteria 5771
202 Ga0395898_0000034 3300037466 Bacteria 356745
203 Ga0395898_0000197 3300037466 Bacteria 155187
204 Ga0395898_0084643 3300037466 Bacteria 3056
205 Ga0395901_0001855 3300038443 Bacteria 21860
206 Ga0395901_0192646 3300038443 Bacteria 2138
207 Ga0395901_0439480 3300038443 Bacteria 1335
208 Ga0237819_00020 3300038705 Bacteria 55328
209 Ga0439436_0000026 3300041404 Bacteria 55607
210 Ga0439465_0001671 3300041413 Bacteria 7242
211 Ga0451789_0455952 3300041443 Bacteria 626
212 Ga0451793_0031560 3300041452 Bacteria 3082
213 Ga0451800_0200933 3300041459 Bacteria 856
214 Ga0451800_1058980 3300041459 Bacteria 3663
215 Ga0451802_0873095 3300041460 Bacteria 1050
216 Ga0451806_123694 3300041462 Bacteria 2714
217 Ga0451807_0342323 3300041486 Bacteria 1271
218 Ga0451841_0363545 3300041498 Bacteria 825
219 Ga0451847_0434317 3300041503 Bacteria 929
220 Ga0451853_1810800 3300041512 Bacteria 1727
221 Ga0439432_013115 3300042006 Bacteria 2821
222 Ga0439432_087689 3300042006 Bacteria 938
223 Ga0450911_000768 3300042115 Bacteria 9146
224 Ga0450908_000466 3300042184 Bacteria 7822
225 Ga0450901_005261 3300042533 Bacteria 1330
226 Ga0466988_0470348 3300044536 Bacteria 625
227 Ga0466969_0031024 3300044656 Bacteria 2722
228 Ga0466965_0007785 3300044683 Bacteria 4934
229 Ga0466966_0010065 3300044684 Bacteria 6270
230 Ga0466961_0001469 3300044693 Bacteria 14633
231 Ga0466961_0002759 3300044693 Bacteria 10930
232 Ga0466961_0004766 3300044693 Bacteria 8537
233 Ga0466961_0016543 3300044693 Bacteria 4739
234 Ga0466963_0185512 3300044694 Unclassified 1453
235 Ga0466963_0276820 3300044694 Bacteria 1179
236 Ga0466964_0003032 3300044706 Bacteria 6092
237 Ga0466971_0009551 3300044719 Bacteria 4235
238 Ga0466971_0098795 3300044719 Bacteria 1340
239 Ga0466971_0104365 3300044719 Bacteria 1304
240 Ga0466970_0011634 3300044765 Bacteria 4488
241 Ga0466957_0012640 3300044842 Bacteria 4889
242 Ga0466957_0035382 3300044842 Bacteria 2997
243 Ga0466957_0248301 3300044842 Unclassified 1182
244 Ga0466959_0000258 3300045049 Bacteria 32514
245 Ga0466959_0008071 3300045049 Bacteria 7421
246 Ga0466959_0336302 3300045049 Bacteria 1030
247 Ga0466958_0001913 3300045836 Bacteria 10191
248 Ga0466958_0021407 3300045836 Bacteria 3779
249 Ga0466958_0186226 3300045836 Bacteria 1318
250 Ga0495617_001270 3300046452 Bacteria 11262
251 Ga0495617_001849 3300046452 Bacteria 8975
252 Ga0495627_007242 3300046453 Bacteria 4274
253 Ga0495591_057354 3300046458 Bacteria 1044
254 Ga0495638_0000007 3300046460 Bacteria 602783
255 Ga0495638_0000146 3300046460 Bacteria 111558
256 Ga0495638_0003153 3300046460 Bacteria 13049
257 Ga0495638_0024484 3300046460 Bacteria 3936
258 Ga0495638_0105719 3300046460 Bacteria 1677
259 Ga0495650_0003910 3300046471 Bacteria 10516
260 Ga0495605_0087088 3300046474 Bacteria 1453
261 Ga0495584_0000301 3300046491 Bacteria 34886
262 Ga0495585_0001234 3300046492 Bacteria 20628
263 Ga0495585_0007631 3300046492 Bacteria 6611
264 Ga0495607_0002165 3300046501 Bacteria 16356
265 Ga0495607_0207197 3300046501 Bacteria 967
266 Ga0495583_0014922 3300046506 Bacteria 4252
267 Ga0495606_0001894 3300046507 Bacteria 26138
268 Ga0495606_0002172 3300046507 Bacteria 23594
269 Ga0495606_0020197 3300046507 Bacteria 4922
270 Ga0495606_0041128 3300046507 Bacteria 3101
271 Ga0495610_0001026 3300046512 Bacteria 25659
272 Ga0495610_0003914 3300046512 Bacteria 11290
273 Ga0495616_0000129 3300046513 Bacteria 66170
274 Ga0495616_0088527 3300046513 Bacteria 1469
275 Ga0495620_0004942 3300046515 Bacteria 7481
276 Ga0495620_0006810 3300046515 Bacteria 6249
277 Ga0495631_0000774 3300046518 Bacteria 20562
278 Ga0495631_0002246 3300046518 Bacteria 11091
279 Ga0495631_0005138 3300046518 Bacteria 6897
280 Ga0495632_0000004 3300046519 Bacteria 381372
281 Ga0495632_0027259 3300046519 Bacteria 2994
282 Ga0495632_0032438 3300046519 Bacteria 2691
283 Ga0495632_0079088 3300046519 Bacteria 1570
284 Ga0495637_0062730 3300046520 Bacteria 1520
285 Ga0495643_0000254 3300046522 Bacteria 78711
286 Ga0495644_0030392 3300046523 Bacteria 2040
287 Ga0495648_0003984 3300046524 Bacteria 12780
288 Ga0495648_0014697 3300046524 Bacteria 5714
289 Ga0495663_0000888 3300046525 Bacteria 10078
290 Ga0495663_0001069 3300046525 Bacteria 8931
291 Ga0495663_0048795 3300046525 Bacteria 1306
292 Ga0495609_0024231 3300046538 Bacteria 2785
293 Ga0495621_0003174 3300046539 Bacteria 4503
294 Ga0495633_0002837 3300046558 Bacteria 11935
295 Ga0495633_0003252 3300046558 Bacteria 10948
296 Ga0495633_0056526 3300046558 Bacteria 1844
297 Ga0495656_0067927 3300046615 Bacteria 1574
298 Ga0495656_0099027 3300046615 Bacteria 1345
299 Ga0495656_0525737 3300046615 Bacteria 629
300 Ga0495656_0642330 3300046615 Unclassified 569
301 Ga0495611_0000001 3300046648 Bacteria 2628469
302 Ga0495611_0000674 3300046648 Bacteria 19453
303 Ga0495625_0000022 3300046660 Bacteria 278823
304 Ga0495625_0075427 3300046660 Bacteria 2359
305 Ga0495625_0190836 3300046660 Bacteria 1357
306 Ga0495661_0000632 3300046665 Bacteria 35731
307 Ga0495661_0007347 3300046665 Bacteria 7677
308 Ga0495658_0076930 3300046683 Bacteria 1951
309 Ga0495658_0224742 3300046683 Bacteria 1176
310 Ga0495670_0002918 3300046691 Bacteria 8423
311 Ga0495670_0003784 3300046691 Bacteria 7435
312 Ga0495671_0000512 3300046692 Bacteria 29774
313 Ga0495589_0000236 3300046794 Bacteria 46053
314 Ga0495660_0000331 3300046810 Bacteria 41960
315 Ga0495660_0000366 3300046810 Bacteria 39762
316 Ga0495660_0045297 3300046810 Bacteria 2416
317 Ga0495636_0005386 3300047318 Bacteria 5027
318 Ga0495636_0010916 3300047318 Bacteria 3594
319 Ga0495672_0000090 3300047320 Bacteria 148367
320 Ga0495672_0021864 3300047320 Bacteria 4166
321 Ga0495683_0021668 3300047323 Bacteria 3309
322 Ga0495679_000004 3300047446 Bacteria 748056
323 Ga0495673_0000202 3300047469 Bacteria 90523
324 Ga0495673_0000670 3300047469 Bacteria 33730
325 Ga0495673_0006460 3300047469 Bacteria 6882
326 Ga0495673_0075898 3300047469 Bacteria 1403
327 Ga0495681_0054390 3300047470 Bacteria 1870
328 Ga0495686_0002215 3300047472 Bacteria 18870
329 Ga0495686_0015647 3300047472 Bacteria 5172
330 Ga0495686_0020950 3300047472 Bacteria 4353
331 Ga0495686_0027814 3300047472 Bacteria 3687
332 Ga0495686_0040048 3300047472 Bacteria 2990
333 Ga0496100_0003810 3300048903 Bacteria 7900
334 Ga0496101_0002544 3300048904 Bacteria 11184
335 Ga0496104_0134225 3300048907 Bacteria 2378
336 Ga0496104_0185180 3300048907 Bacteria 1993
337 Ga0496105_0034058 3300048908 Bacteria 4188
338 Ga0496106_0004906 3300048909 Bacteria 9901
339 Ga0496106_0065651 3300048909 Bacteria 2763
340 Ga0496111_0159595 3300048914 Bacteria 1674
341 Ga0496111_0898810 3300048914 Bacteria 638
342 Ga0496113_0080501 3300048916 Bacteria 2495
343 Ga0496116_0003519 3300048919 Bacteria 15417
344 Ga0496116_0006458 3300048919 Bacteria 10622
345 Ga0496116_0093353 3300048919 Bacteria 1822
346 Ga0496116_0118579 3300048919 Bacteria 1537
347 Ga0496116_0118652 3300048919 Bacteria 1536
348 Ga0496116_0141051 3300048919 Bacteria 1356
349 Ga0496117_0000948 3300048920 Bacteria 44319
350 Ga0496117_0001413 3300048920 Bacteria 34807
351 Ga0496117_0006490 3300048920 Bacteria 11807
352 Ga0496117_0011441 3300048920 Bacteria 7949
353 Ga0496117_0021708 3300048920 Bacteria 5182
354 Ga0496117_0021822 3300048920 Bacteria 5163
355 Ga0496117_0052087 3300048920 Bacteria 2886
356 Ga0496117_0063429 3300048920 Bacteria 2526
357 Ga0496117_0095081 3300048920 Bacteria 1905
358 Ga0496117_0127091 3300048920 Bacteria 1553
359 Ga0496118_0001453 3300048921 Bacteria 35692
360 Ga0496118_0001469 3300048921 Bacteria 35326
361 Ga0496118_0001601 3300048921 Bacteria 33506
362 Ga0496118_0006601 3300048921 Bacteria 12669
363 Ga0496118_0014861 3300048921 Bacteria 7251
364 Ga0496118_0018799 3300048921 Bacteria 6205
365 Ga0496118_0033214 3300048921 Bacteria 4236
366 Ga0496118_0033982 3300048921 Bacteria 4171
367 Ga0496118_0096716 3300048921 Bacteria 2011
368 Ga0496119_0000981 3300048922 Bacteria 36677
369 Ga0496119_0001308 3300048922 Bacteria 30779
370 Ga0496119_0004858 3300048922 Bacteria 13164
371 Ga0496119_0016107 3300048922 Bacteria 5710
372 Ga0496119_0061723 3300048922 Bacteria 2236
373 Ga0496120_0000147 3300048923 Bacteria 117881
374 Ga0496120_0001354 3300048923 Bacteria 30075
375 Ga0496120_0001723 3300048923 Bacteria 24891
376 Ga0496120_0032775 3300048923 Bacteria 3128
377 Ga0496120_0101808 3300048923 Bacteria 1516
378 Ga0496121_0000045 3300048924 Bacteria 336130
379 Ga0496121_0003471 3300048924 Bacteria 22466
380 Ga0496121_0009501 3300048924 Bacteria 11157
381 Ga0496121_0010020 3300048924 Bacteria 10767
382 Ga0496121_0027892 3300048924 Bacteria 5273
383 Ga0496121_0031968 3300048924 Bacteria 4796
384 Ga0496121_0052917 3300048924 Bacteria 3404
385 Ga0496121_0359068 3300048924 Bacteria 968
386 Ga0496121_0673351 3300048924 Bacteria 627
387 Ga0496122_0000928 3300048925 Bacteria 53465
388 Ga0496122_0007651 3300048925 Bacteria 11928
389 Ga0496122_0025754 3300048925 Bacteria 5095
390 Ga0496122_0035604 3300048925 Bacteria 4044
391 Ga0496122_0042918 3300048925 Bacteria 3550
392 Ga0496122_0087899 3300048925 Bacteria 2133
393 Ga0496122_0092115 3300048925 Bacteria 2061
394 Ga0496122_0103569 3300048925 Bacteria 1893
395 Ga0496122_0108902 3300048925 Bacteria 1825
396 Ga0496123_0000695 3300048926 Bacteria 55320
397 Ga0496123_0003599 3300048926 Bacteria 17164
398 Ga0496123_0015198 3300048926 Bacteria 6331
399 Ga0496123_0017033 3300048926 Bacteria 5867
400 Ga0496123_0027259 3300048926 Bacteria 4258
401 Ga0496123_0047765 3300048926 Bacteria 2887
402 Ga0496123_0048144 3300048926 Bacteria 2870
403 Ga0496123_0048628 3300048926 Bacteria 2851
404 Ga0496123_0051262 3300048926 Bacteria 2749
405 Ga0496124_0000343 3300048927 Bacteria 85220
406 Ga0496124_0000901 3300048927 Bacteria 48046
407 Ga0496124_0005124 3300048927 Bacteria 14921
408 Ga0496124_0008550 3300048927 Bacteria 10686
409 Ga0496124_0013141 3300048927 Bacteria 8105
410 Ga0496124_0016264 3300048927 Bacteria 7084
411 Ga0496124_0047772 3300048927 Bacteria 3659
412 Ga0496124_0054658 3300048927 Bacteria 3378
413 Ga0496124_0104381 3300048927 Bacteria 2291
414 Ga0496124_0123196 3300048927 Bacteria 2068
415 Ga0496124_0155135 3300048927 Bacteria 1791
416 Ga0496124_0170461 3300048927 Bacteria 1686
417 Ga0496124_0174175 3300048927 Bacteria 1663
418 Ga0496124_0197365 3300048927 Bacteria 1534
419 Ga0496124_0206280 3300048927 Bacteria 1490
420 Ga0496124_0304007 3300048927 Bacteria 1150
421 Ga0496125_0006210 3300048928 Bacteria 13008
422 Ga0496125_0007547 3300048928 Bacteria 11554
423 Ga0496125_0008795 3300048928 Bacteria 10500
424 Ga0496125_0010824 3300048928 Bacteria 9184
425 Ga0496125_0011575 3300048928 Bacteria 8813
426 Ga0496125_0027976 3300048928 Bacteria 5100
427 Ga0496125_0031118 3300048928 Bacteria 4762
428 Ga0496125_0323071 3300048928 Bacteria 935
429 Ga0496125_0538109 3300048928 Bacteria 650
430 Ga0496126_0001844 3300048929 Bacteria 30914
431 Ga0496126_0016152 3300048929 Bacteria 7479
432 Ga0496126_0018396 3300048929 Bacteria 6924
433 Ga0496126_0169778 3300048929 Bacteria 1859
434 Ga0496126_0185532 3300048929 Bacteria 1764
435 Ga0496126_0197329 3300048929 Bacteria 1701
436 Ga0496126_0204500 3300048929 Bacteria 1665
437 Ga0496126_0438499 3300048929 Bacteria 1053
438 Ga0495678_000099 3300049459 Bacteria 106223
439 Ga0495682_0015009 3300049460 Bacteria 2935
440 Ga0501034_0012662 3300049571 Bacteria 8702
441 Ga0501037_0772381 3300049573 Bacteria 636
442 Ga0501070_0156156 3300049586 Bacteria 1881
443 Ga0501080_0058762 3300049742 Bacteria 3579
444 Ga0501044_0016599 3300049823 Bacteria 7903
445 nmdc:mga00v17_101636_c1 3300050491 Bacteria 1815
446 nmdc:mga00v17_153168_c1 3300050491 Bacteria 1482
447 nmdc:mga00v17_183675_c1 3300050491 Bacteria 1350
448 nmdc:mga00v17_190424_c1 3300050491 Bacteria 1325
449 nmdc:mga00v17_561_c1 3300050491 Bacteria 20819
450 nmdc:mga0yw44_84150_c1 3300050492 Bacteria 1999
451 nmdc:mga04h51_147619_c1 3300050495 Bacteria 896
452 nmdc:mga0sz30_50107_c1 3300050516 Bacteria 1770
453 Ga0500643_000075 3300053087 Bacteria 111465
454 Ga0500555_001048 3300053103 Bacteria 9326
455 Ga0500626_045409 3300053128 Bacteria 1982
456 Ga0500568_0020605 3300053139 Bacteria 2849
457 Ga0500616_0024282 3300053153 Bacteria 3371
458 Ga0500633_0012200 3300053160 Bacteria 2366
459 Ga0500634_0000088 3300053161 Bacteria 35382
460 Ga0500645_001428 3300053730 Bacteria 12141
461 Ga0466962_0007799 3300061719 Bacteria 5131
462 Ga0466962_0016961 3300061719 Bacteria 3507
463 Ga0466962_0122498 3300061719 Bacteria 1255
464 2538832509 2537561836 Bacteria 3910579
465 2595446647 2593339238 Bacteria 4182970
466 2643830551 2643221562 Bacteria 4048635
467 2721026727 2718218334 Bacteria 4765486
468 2735837719 2734482264 Unclassified 5014763
469 2739228324 2738543009 Bacteria 4944499
470 2747947841 2747842428 Bacteria 4689383
471 2816515983 2816332141 Bacteria 4436036
472 2819563718 2818991440 Bacteria 4774720
473 2842394293 2842391507 Bacteria 4486072
474 2842759878 2842757796 Bacteria 3981385
475 2842781420 2842780639 Bacteria 4337790
476 2842919534 2842918807 Bacteria 4289178
477 2852653215 2852649853 Bacteria 4036942
478 2857446469 2857442823 Bacteria 4562550
479 2874220535 2874220319 Bacteria 4594709
480 2884414030 2884411467 Bacteria 5246714
481 2904463971 2904463128 Bacteria 4775606
482 2916702489 2916699645 Bacteria 3568996
483 2919093257 2919089067 Bacteria 4560942
484 2919130215 2919130084 Bacteria 5301837
485 2919404935 2919404418 Bacteria 4232372
486 2928498601 2928496128 Bacteria 4631123
487 2929198785 2929195423 Bacteria 5325372
488 2939591973 2939589442 Bacteria 4214238
489 2939626006 2939622612 Bacteria 4698046
490 2939629842 2939626828 Bacteria 4695272
491 2941472750 2941471342 Bacteria 5018624
492 2941477161 2941475908 Bacteria 4145589
493 2953998001 2953994433 Bacteria 4303959
494 2961047300 2961047084 Bacteria 4594415
495 2974309855 2974307012 Bacteria 4172388
496 2977250596 2977247770 Bacteria 4160543
497 2984514928 2984514374 Bacteria 4172479
498 8002749441 8002745576 Bacteria 4840272
499 Ga0157370_10012652
500 JGI24737J22298_10043405
501 JGI25156J39149_1002391
502 JGI25162J39368_1000937
503 JGI25162J39368_1001538
504 JGI25157J39369_1000845
505 JGI25164J39214_1000142
506 JGI25152J39213_1000400
507 JGI25150J39212_1000387
508 JGI25151J46595_10000107
509 JGI25165J46597_1000090
510 JGI25165J46597_1020324
511 JGI25153J46596_10000078
512 rootH2_10058115
513 rootL2_10198872
514 rootH1_10392548
515 Ga0006562J51391_1040298
516 Ga0006562J51391_1040299
517 Ga0055539_1000930
518 Ga0055539_1021890
519 Ga0055533_1000474
520 Ga0055533_1015420
521 Ga0055525_1000097
522 Ga0055527_1000198
523 Ga0055527_1000344
524 Ga0055527_1000513
525 Ga0055527_1001814
526 Ga0055535_1000488
527 Ga0055535_1000795
528 Ga0055535_1001318
529 Ga0055535_1001894
530 Ga0055542_1000441
531 Ga0055542_1000616
532 Ga0055542_1001808
533 Ga0055529_1000305
534 Ga0055529_1000591
535 Ga0055529_1001024
536 Ga0055526_1000234
537 Ga0055526_1003383
538 Ga0055537_1000017
539 Ga0055536_1004162
540 Ga0055534_1000330
541 Ga0055528_1000811
542 Ga0055530_10003006
543 Ga0055530_10003008
544 Ga0055531_10005393
545 Ga0055531_10005398
546 Ga0065165_1000028
547 Ga0070670_100000395
548 Ga0070670_100907529
549 Ga0070682_100014878
550 Ga0070661_100083274
551 Ga0070661_100144461
552 Ga0070668_100007687
553 Ga0070659_100003696
554 Ga0070663_100540985
555 Ga0070678_100157684
556 Ga0070681_10014952
557 Ga0070684_100466159
558 Ga0068853_100004286
559 Ga0070665_100061806
560 Ga0068855_100008679
561 Ga0070664_100469071
562 Ga0068856_100013948
563 Ga0068861_100545996
564 Ga0068863_100026503
565 Ga0081540_1001936
566 Ga0081539_10011473
567 Ga0075365_10044043
568 Ga0075368_10188615
569 Ga0075364_10000037
570 Ga0075364_10123958
571 Ga0075364_10124050
572 Ga0105251_10000063
573 Ga0105251_10008820
574 Ga0105244_10022967
575 Ga0105240_10011330
576 Ga0105247_10010176
577 Ga0105239_10000044
578 Ga0105239_10009711
579 Ga0157373_10079074
580 Ga0157373_10115314
581 Ga0157373_10233914
582 Ga0157373_10235174
583 Ga0157371_10001088
584 Ga0157370_10056936
585 Ga0157369_10000329
586 Ga0157375_11668175
587 Ga0182008_10000096
588 Ga0182008_10004395
589 Ga0182008_10007424
590 Ga0182006_1000072
591 Ga0182006_1000540
592 Ga0182006_1049800
593 Ga0182007_10000048
594 Ga0182007_10003221
595 Ga0182005_1000264
596 Ga0182005_1000621
597 Ga0182005_1007491
598 Ga0182005_1031856
599 Ga0183361_10878
600 Ga0163161_10002475
601 Ga0163161_10010185
602 Ga0163161_10020455
603 Ga0163161_10115169
604 Ga0163161_10418386
605 Ga0209566_101328
606 Ga0209674_100506
607 Ga0209674_100940
608 Ga0209672_100007
609 Ga0209672_100078
610 Ga0209672_100265
611 Ga0209563_100079
612 Ga0207427_100033
613 Ga0209437_100105
614 Ga0209437_101029
615 Ga0209258_100012
616 Ga0209258_100046
617 Ga0209258_100095
618 Ga0207425_1000028
619 Ga0209646_1000775
620 Ga0209026_1000278
621 Ga0209026_1000285
622 Ga0209677_101982
623 Ga0209677_109425
624 Ga0209148_1000014
625 Ga0209148_1000039
626 Ga0209148_1000098
627 Ga0209148_1004404
628 Ga0209759_1000460
629 Ga0209759_1000536
630 Ga0209129_1000011
631 Ga0209233_1000080
632 Ga0209233_1031103
633 Ga0209565_1000031
634 Ga0209455_1000010
635 Ga0209455_1000034
636 Ga0209455_1000126
637 Ga0209673_1000204
638 Ga0209675_1000015
639 Ga0209676_1000110
640 Ga0209676_1003063
641 Ga0209025_1000002
642 Ga0209564_1000037
643 Ga0209758_1000003
644 Ga0209050_1000417
645 Ga0209050_1000648
646 Ga0209256_1004014
647 Ga0209051_1018184
648 Ga0209257_1000129
649 Ga0209257_1000231
650 Ga0209257_1004792
651 Ga0209257_1005426
652 Ga0207713_1000204
653 Ga0207710_10009403
654 Ga0207647_10000029
655 Ga0207707_10013443
656 Ga0207695_10006400
657 Ga0207649_10044923
658 Ga0207649_10418856
659 Ga0207690_10002804
660 Ga0207709_10000916
661 Ga0207667_10033438
662 Ga0207668_10823672
663 Ga0207639_10000643
664 Ga0207678_10248630
665 Ga0207702_10031237
666 Ga0207641_10044935
667 Ga0207675_100863495
668 Ga0207683_10038699
669 Ga0207683_10191641
670 Ga0268266_10038499
671 Ga0265334_10000097
672 Ga0307515_10139988
673 Ga0316183_1181528
674 Ga0316182_1416967
675 Ga0316576_10226129
676 Ga0307405_10079001
677 Ga0307413_10024539
678 Ga0307406_10511945
679 Ga0307407_10019107
680 Ga0307412_10001403
681 Ga0307412_10003149
682 Ga0307412_10040203
683 Ga0307412_10047057
684 Ga0307412_10258824
685 Ga0307416_100188633
686 Ga0307414_10024245
687 Ga0307414_10049069
688 Ga0307414_10087650
689 Ga0307414_10219904
690 Ga0307414_10576958
691 Ga0307414_10721583
692 Ga0307415_100097865
693 Ga0316583_10141923
694 Ga0316574_0131269
695 Ga0316584_0020284
696 Ga0395899_0000319
697 Ga0395899_0453249
698 Ga0395900_0000061
699 Ga0395900_0027987
700 Ga0395898_0000034
701 Ga0395898_0000197
702 Ga0395898_0084643
703 Ga0395901_0001855
704 Ga0395901_0192646
705 Ga0395901_0439480
706 Ga0237819_00020
707 Ga0439436_0000026
708 Ga0439465_0001671
709 Ga0451789_0455952
710 Ga0451793_0031560
711 Ga0451800_0200933
712 Ga0451800_1058980
713 Ga0451802_0873095
714 Ga0451806_123694
715 Ga0451807_0342323
716 Ga0451841_0363545
717 Ga0451847_0434317
718 Ga0451853_1810800
719 Ga0439432_013115
720 Ga0439432_087689
721 Ga0450911_000768
722 Ga0450908_000466
723 Ga0450901_005261
724 Ga0466988_0470348
725 Ga0466969_0031024
726 Ga0466965_0007785
727 Ga0466966_0010065
728 Ga0466961_0001469
729 Ga0466961_0002759
730 Ga0466961_0004766
731 Ga0466961_0016543
732 Ga0466963_0185512
733 Ga0466963_0276820
734 Ga0466964_0003032
735 Ga0466971_0009551
736 Ga0466971_0098795
737 Ga0466971_0104365
738 Ga0466970_0011634
739 Ga0466957_0012640
740 Ga0466957_0035382
741 Ga0466957_0248301
742 Ga0466959_0000258
743 Ga0466959_0008071
744 Ga0466959_0336302
745 Ga0466958_0001913
746 Ga0466958_0021407
747 Ga0466958_0186226
748 Ga0495617_001270
749 Ga0495617_001849
750 Ga0495627_007242
751 Ga0495591_057354
752 Ga0495638_0000007
753 Ga0495638_0000146
754 Ga0495638_0003153
755 Ga0495638_0024484
756 Ga0495638_0105719
757 Ga0495650_0003910
758 Ga0495605_0087088
759 Ga0495584_0000301
760 Ga0495585_0001234
761 Ga0495585_0007631
762 Ga0495607_0002165
763 Ga0495607_0207197
764 Ga0495583_0014922
765 Ga0495606_0001894
766 Ga0495606_0002172
767 Ga0495606_0020197
768 Ga0495606_0041128
769 Ga0495610_0001026
770 Ga0495610_0003914
771 Ga0495616_0000129
772 Ga0495616_0088527
773 Ga0495620_0004942
774 Ga0495620_0006810
775 Ga0495631_0000774
776 Ga0495631_0002246
777 Ga0495631_0005138
778 Ga0495632_0000004
779 Ga0495632_0027259
780 Ga0495632_0032438
781 Ga0495632_0079088
782 Ga0495637_0062730
783 Ga0495643_0000254
784 Ga0495644_0030392
785 Ga0495648_0003984
786 Ga0495648_0014697
787 Ga0495663_0000888
788 Ga0495663_0001069
789 Ga0495663_0048795
790 Ga0495609_0024231
791 Ga0495621_0003174
792 Ga0495633_0002837
793 Ga0495633_0003252
794 Ga0495633_0056526
795 Ga0495656_0067927
796 Ga0495656_0099027
797 Ga0495656_0525737
798 Ga0495656_0642330
799 Ga0495611_0000001
800 Ga0495611_0000674
801 Ga0495625_0000022
802 Ga0495625_0075427
803 Ga0495625_0190836
804 Ga0495661_0000632
805 Ga0495661_0007347
806 Ga0495658_0076930
807 Ga0495658_0224742
808 Ga0495670_0002918
809 Ga0495670_0003784
810 Ga0495671_0000512
811 Ga0495589_0000236
812 Ga0495660_0000331
813 Ga0495660_0000366
814 Ga0495660_0045297
815 Ga0495636_0005386
816 Ga0495636_0010916
817 Ga0495672_0000090
818 Ga0495672_0021864
819 Ga0495683_0021668
820 Ga0495679_000004
821 Ga0495673_0000202
822 Ga0495673_0000670
823 Ga0495673_0006460
824 Ga0495673_0075898
825 Ga0495681_0054390
826 Ga0495686_0002215
827 Ga0495686_0015647
828 Ga0495686_0020950
829 Ga0495686_0027814
830 Ga0495686_0040048
831 Ga0496100_0003810
832 Ga0496101_0002544
833 Ga0496104_0134225
834 Ga0496104_0185180
835 Ga0496105_0034058
836 Ga0496106_0004906
837 Ga0496106_0065651
838 Ga0496111_0159595
839 Ga0496111_0898810
840 Ga0496113_0080501
841 Ga0496116_0003519
842 Ga0496116_0006458
843 Ga0496116_0093353
844 Ga0496116_0118579
845 Ga0496116_0118652
846 Ga0496116_0141051
847 Ga0496117_0000948
848 Ga0496117_0001413
849 Ga0496117_0006490
850 Ga0496117_0011441
851 Ga0496117_0021708
852 Ga0496117_0021822
853 Ga0496117_0052087
854 Ga0496117_0063429
855 Ga0496117_0095081
856 Ga0496117_0127091
857 Ga0496118_0001453
858 Ga0496118_0001469
859 Ga0496118_0001601
860 Ga0496118_0006601
861 Ga0496118_0014861
862 Ga0496118_0018799
863 Ga0496118_0033214
864 Ga0496118_0033982
865 Ga0496118_0096716
866 Ga0496119_0000981
867 Ga0496119_0001308
868 Ga0496119_0004858
869 Ga0496119_0016107
870 Ga0496119_0061723
871 Ga0496120_0000147
872 Ga0496120_0001354
873 Ga0496120_0001723
874 Ga0496120_0032775
875 Ga0496120_0101808
876 Ga0496121_0000045
877 Ga0496121_0003471
878 Ga0496121_0009501
879 Ga0496121_0010020
880 Ga0496121_0027892
881 Ga0496121_0031968
882 Ga0496121_0052917
883 Ga0496121_0359068
884 Ga0496121_0673351
885 Ga0496122_0000928
886 Ga0496122_0007651
887 Ga0496122_0025754
888 Ga0496122_0035604
889 Ga0496122_0042918
890 Ga0496122_0087899
891 Ga0496122_0092115
892 Ga0496122_0103569
893 Ga0496122_0108902
894 Ga0496123_0000695
895 Ga0496123_0003599
896 Ga0496123_0015198
897 Ga0496123_0017033
898 Ga0496123_0027259
899 Ga0496123_0047765
900 Ga0496123_0048144
901 Ga0496123_0048628
902 Ga0496123_0051262
903 Ga0496124_0000343
904 Ga0496124_0000901
905 Ga0496124_0005124
906 Ga0496124_0008550
907 Ga0496124_0013141
908 Ga0496124_0016264
909 Ga0496124_0047772
910 Ga0496124_0054658
911 Ga0496124_0104381
912 Ga0496124_0123196
913 Ga0496124_0155135
914 Ga0496124_0170461
915 Ga0496124_0174175
916 Ga0496124_0197365
917 Ga0496124_0206280
918 Ga0496124_0304007
919 Ga0496125_0006210
920 Ga0496125_0007547
921 Ga0496125_0008795
922 Ga0496125_0010824
923 Ga0496125_0011575
924 Ga0496125_0027976
925 Ga0496125_0031118
926 Ga0496125_0323071
927 Ga0496125_0538109
928 Ga0496126_0001844
929 Ga0496126_0016152
930 Ga0496126_0018396
931 Ga0496126_0169778
932 Ga0496126_0185532
933 Ga0496126_0197329
934 Ga0496126_0204500
935 Ga0496126_0438499
936 Ga0495678_000099
937 Ga0495682_0015009
938 Ga0501034_0012662
939 Ga0501037_0772381
940 Ga0501070_0156156
941 Ga0501080_0058762
942 Ga0501044_0016599
943 nmdc:mga00v17_101636_c1
944 nmdc:mga00v17_153168_c1
945 nmdc:mga00v17_183675_c1
946 nmdc:mga00v17_190424_c1
947 nmdc:mga00v17_561_c1
948 nmdc:mga0yw44_84150_c1
949 nmdc:mga04h51_147619_c1
950 nmdc:mga0sz30_50107_c1
951 Ga0500643_000075
952 Ga0500555_001048
953 Ga0500626_045409
954 Ga0500568_0020605
955 Ga0500616_0024282
956 Ga0500633_0012200
957 Ga0500634_0000088
958 Ga0500645_001428
959 Ga0466962_0007799
960 Ga0466962_0016961
961 Ga0466962_0122498
962 2538832509
963 2595446647
964 2643830551
965 2721026727
966 2735837719
967 2739228324
968 2747947841
969 2816515983
970 2819563718
971 2842394293
972 2842759878
973 2842781420
974 2842919534
975 2852653215
976 2857446469
977 2874220535
978 2884414030
979 2904463971
980 2916702489
981 2919093257
982 2919130215
983 2919404935
984 2928498601
985 2929198785
986 2939591973
987 2939626006
988 2939629842
989 2941472750
990 2941477161
991 2953998001
992 2961047300
993 2974309855
994 2977250596
995 2984514928
996 8002749441

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02545

Maf

Maf-like protein

37

219

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lu1-assembly1.cif.gz_B crystal structure of the uncharacterized maf protein ycef from e. coli, mutant d69a 0.9677 5 190
4heb-assembly1.cif.gz_A the crystal structure of maf protein of bacillus subtilis 0.9575 5 188
1exc-assembly1.cif.gz_A crystal structure of b. subtilis maf protein complexed with d-(utp) 0.9567 1 188
4p0e-assembly1.cif.gz_A yhde e33a (p212121 space group) 0.9504 5 190
4jhc-assembly1.cif.gz_B crystal structure of the uncharacterized maf protein ycef from e. coli 0.9488 4 190
ID Description Score Start End Superfamily
4lu1B00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9677 5 190 3.90.950.10
4hebA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9575 5 188 3.90.950.10
4p0uA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9426 5 190 3.90.950.10
4hebA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9423 5 188 3.90.950.10
4lu1B00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9361 5 190 3.90.950.10
ID Description Score Start End GO Terms
AF-C7RTM1-F1-model_v4 7-methyl-GTP pyrophosphatase (m(7)GTP pyrophosphatase) (EC 3.6.1.-) 0.9822 1 192 GO:0005737
GO:0009117
GO:0047429
AF-A0A4Y5Z5F5-F1-model_v4 7-methyl-GTP pyrophosphatase (m(7)GTP pyrophosphatase) (EC 3.6.1.-) 0.9806 8 194 GO:0005737
GO:0009117
GO:0047429
AF-A0A7S6N4A2-F1-model_v4 7-methyl-GTP pyrophosphatase (m(7)GTP pyrophosphatase) (EC 3.6.1.-) 0.9802 2 194 GO:0005737
GO:0009117
GO:0047429
AF-A0A389MGN2-F1-model_v4 Nucleoside triphosphate pyrophosphatase (EC 3.6.1.9) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.9799 29 192 GO:0005737
GO:0009117
GO:0106379
AF-A0A7Y5K943-F1-model_v4 7-methyl-GTP pyrophosphatase (m(7)GTP pyrophosphatase) (EC 3.6.1.-) 0.9765 1 193 GO:0005737
GO:0009117
GO:0047429

Map