F455088

General Info

Members Datasets Scaffolds Average Seq Length
497 338 466 247

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0227088|Ga0495670_0227088_94_939
Length 281
Sequence MGTNDEPCHHCEINEVVHRYNDGASHASDVRNSAKMSPVGWEALGQWGEDVARIEPLAGGVANDVWSVRVNGHLAVGRLGARSDADLAWETELLQHLDREGLTVPVPIPTTDGRLFADGLVVMTYVEGGPPETEADWRRVADTLRQLHRLTQGWPQRPGWRSSTDLLIAETGTKIDLGVMPAEGVARCRAAWARLTGRQRCVVHGDPNPANIRMTVDRVALIDWDESHVDVPDLDLVLPHNAASLDDGAHDIAAQAWAAWEAAVCWDDEHAVKRLAEVRAV

Samples

Sample ID Description Type Environment
1 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
2 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
3 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
4 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
5 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
6 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
7 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
8 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
9 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
10 2791355267 Rhizobium sp. L18 Isolate Nodule
11 2802429633 Rhizobium anhuiense J3 Isolate Nodule
12 2802429634 Rhizobium anhuiense S10 Isolate Nodule
13 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
14 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
15 2802429637 Rhizobium anhuiense C15 Isolate Nodule
16 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
17 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
18 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
19 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
20 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
21 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
22 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
23 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
24 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
25 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
26 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
27 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
28 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
29 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
35 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
39 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
98 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
108 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
111 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
112 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
113 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
114 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
164 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
179 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
180 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
183 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
184 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
185 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
186 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
189 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
216 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
217 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
218 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
219 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
220 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
221 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
222 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
223 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
224 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
225 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
226 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
227 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
228 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
229 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
230 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
231 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
232 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
243 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
246 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
249 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
250 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
251 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
285 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
299 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
300 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
305 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
309 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
312 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
313 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
314 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
315 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
323 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
324 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
325 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
326 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
327 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
330 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
331 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
334 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
335 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
336 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
337 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
338 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.55
Metatranscriptomes 0.4
Isolates 6.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.66
Nodule 4.23
Rhizoplane 7.04
Rhizosphere 71.43
Stem 0
Stem Tuber 0
Unclassified 7.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000061 3300002704 Bacteria 71144
2 JGI25156J39149_1000122 3300002705 Bacteria 56600
3 JGI25162J39368_1000481 3300002737 Bacteria 30539
4 JGI25154J39366_1000132 3300002738 Bacteria 58454
5 JGI25157J39369_1000106 3300002741 Bacteria 71144
6 JGI25151J46595_10001406 3300003187 Bacteria 16505
7 JGI25151J46595_10001671 3300003187 Bacteria 14534
8 JGI25165J46597_1002418 3300003214 Bacteria 6074
9 JGI25153J46596_10007996 3300003215 Bacteria 5116
10 rootH2_10015505 3300003320 Bacteria 11045
11 JGI25160J50197_1005187 3300003354 Bacteria 5467
12 JGI25160J50197_1010974 3300003354 Bacteria 3243
13 JGI25407J50210_10012174 3300003373 Bacteria 2203
14 JGI25407J50210_10059661 3300003373 Bacteria 960
15 Ga0055526_1008562 3300003771 Bacteria 5075
16 Ga0055524_1003462 3300003775 Bacteria 7656
17 Ga0055528_1009329 3300003790 Bacteria 4107
18 Ga0055543_1001273 3300004625 Bacteria 10385
19 Ga0065165_1013147 3300005262 Bacteria 3311
20 Ga0065165_1045387 3300005262 Bacteria 1280
21 Ga0070666_10000249 3300005335 Bacteria 35973
22 Ga0070682_100117776 3300005337 Bacteria 1779
23 Ga0070660_100468560 3300005339 Bacteria 1046
24 Ga0070660_100654853 3300005339 Bacteria 880
25 Ga0070689_100631105 3300005340 Bacteria 930
26 Ga0070661_100070111 3300005344 Bacteria 2578
27 Ga0070692_10042551 3300005345 Bacteria 2333
28 Ga0070668_100002810 3300005347 Bacteria 12814
29 Ga0070669_100126084 3300005353 Bacteria 1959
30 Ga0070675_100073492 3300005354 Bacteria 2839
31 Ga0070674_100066303 3300005356 Bacteria 2536
32 Ga0070674_100396142 3300005356 Bacteria 1127
33 Ga0070673_100030242 3300005364 Bacteria 4049
34 Ga0070709_10337775 3300005434 Bacteria 1110
35 Ga0070714_100669580 3300005435 Bacteria 1000
36 Ga0070663_100077351 3300005455 Bacteria 2435
37 Ga0070678_100120250 3300005456 Bacteria 2070
38 Ga0070662_100007024 3300005457 Bacteria 7282
39 Ga0068867_100275364 3300005459 Bacteria 1378
40 Ga0070685_10019858 3300005466 Bacteria 3630
41 Ga0070685_10071785 3300005466 Bacteria 2053
42 Ga0070679_100736306 3300005530 Bacteria 929
43 Ga0070684_100034062 3300005535 Bacteria 4353
44 Ga0070684_100251151 3300005535 Bacteria 1616
45 Ga0070695_100024276 3300005545 Bacteria 3733
46 Ga0070665_100442041 3300005548 Bacteria 1310
47 Ga0070665_100488874 3300005548 Bacteria 1242
48 Ga0068857_100412094 3300005577 Bacteria 1259
49 Ga0068854_100228748 3300005578 Bacteria 1475
50 Ga0068856_100278900 3300005614 Bacteria 1688
51 Ga0068852_100329572 3300005616 Bacteria 1485
52 Ga0068864_100072416 3300005618 Bacteria 3003
53 Ga0068861_100223597 3300005719 Bacteria 1592
54 Ga0068863_100026556 3300005841 Bacteria 5522
55 Ga0068858_100657356 3300005842 Bacteria 1019
56 Ga0068860_100108377 3300005843 Bacteria 2655
57 Ga0068860_100477319 3300005843 Bacteria 1242
58 Ga0068860_100477790 3300005843 Bacteria 1242
59 Ga0081455_10000122 3300005937 Bacteria 89500
60 Ga0081455_10003424 3300005937 Bacteria 18238
61 Ga0081455_10105726 3300005937 Bacteria 2249
62 Ga0081538_10022987 3300005981 Bacteria 4495
63 Ga0081538_10026994 3300005981 Bacteria 3994
64 Ga0081538_10031505 3300005981 Bacteria 3575
65 Ga0081540_1004395 3300005983 Bacteria 10775
66 Ga0081540_1065098 3300005983 Bacteria 1716
67 Ga0081539_10006939 3300005985 Bacteria 10533
68 Ga0081539_10011776 3300005985 Bacteria 6854
69 Ga0081539_10049227 3300005985 Bacteria 2393
70 Ga0081539_10059376 3300005985 Bacteria 2105
71 Ga0075368_10014604 3300006042 Bacteria 2903
72 Ga0075363_100403132 3300006048 Bacteria 804
73 Ga0075362_10040214 3300006177 Bacteria 2058
74 Ga0075369_10014082 3300006186 Bacteria 3189
75 Ga0075370_10003802 3300006353 Bacteria 7224
76 Ga0075370_10276060 3300006353 Bacteria 998
77 Ga0075428_100005363 3300006844 Bacteria 14252
78 Ga0075428_100041973 3300006844 Bacteria 5030
79 Ga0075428_100094031 3300006844 Bacteria 3268
80 Ga0075428_100173087 3300006844 Bacteria 2339
81 Ga0075430_100005225 3300006846 Bacteria 10945
82 Ga0075430_100014770 3300006846 Bacteria 6650
83 Ga0075430_100039283 3300006846 Bacteria 4007
84 Ga0075431_100000020 3300006847 Bacteria 82958
85 Ga0075431_100008347 3300006847 Bacteria 10363
86 Ga0075431_100009543 3300006847 Bacteria 9745
87 Ga0075431_100016504 3300006847 Bacteria 7495
88 Ga0075431_100545168 3300006847 Bacteria 1148
89 Ga0075433_10011812 3300006852 Bacteria 7034
90 Ga0075433_10079926 3300006852 Bacteria 2881
91 Ga0075434_100059687 3300006871 Bacteria 3792
92 Ga0075434_100076654 3300006871 Bacteria 3338
93 Ga0075429_100006187 3300006880 Bacteria 10350
94 Ga0075429_100126699 3300006880 Bacteria 2233
95 Ga0075429_100529210 3300006880 Bacteria 1033
96 Ga0097620_100401473 3300006931 Bacteria 1467
97 Ga0111539_10014481 3300009094 Bacteria 9845
98 Ga0111539_10054709 3300009094 Bacteria 4747
99 Ga0105245_10590525 3300009098 Bacteria 1136
100 Ga0105247_10346467 3300009101 Bacteria 1044
101 Ga0114129_10000804 3300009147 Bacteria 40281
102 Ga0114129_10079084 3300009147 Bacteria 4572
103 Ga0114129_10268506 3300009147 Bacteria 2283
104 Ga0105248_10136877 3300009177 Bacteria 2763
105 Ga0105248_10284340 3300009177 Bacteria 1862
106 Ga0105238_10000564 3300009551 Bacteria 38884
107 Ga0105249_10017384 3300009553 Bacteria 6385
108 Ga0105249_10888123 3300009553 Bacteria 958
109 Ga0123342_1016896 3300009766 Bacteria 6220
110 Ga0105239_10080599 3300010375 Bacteria 3582
111 Ga0157329_1003126 3300012491 Bacteria 994
112 Ga0157326_1013789 3300012513 Bacteria 935
113 Ga0157370_10069573 3300013104 Bacteria 3324
114 Ga0157378_10025800 3300013297 Bacteria 5177
115 Ga0157372_10847127 3300013307 Bacteria 1061
116 Ga0157375_10742851 3300013308 Bacteria 1133
117 Ga0163163_10013192 3300014325 Bacteria 7552
118 Ga0157377_10364094 3300014745 Bacteria 974
119 Ga0206356_10227172 3300020070 Bacteria 948
120 Ga0206356_10387185 3300020070 Bacteria 1064
121 Ga0213876_10000024 3300021384 Bacteria 237488
122 Ga0213876_10000365 3300021384 Bacteria 38608
123 Ga0213876_10001840 3300021384 Bacteria 12779
124 Ga0213876_10019216 3300021384 Bacteria 3608
125 Ga0209435_100081 3300025206 Bacteria 47006
126 Ga0207427_104375 3300025231 Bacteria 2406
127 Ga0209437_100023 3300025233 Bacteria 614195
128 Ga0207425_1003651 3300025245 Bacteria 4849
129 Ga0209646_1000064 3300025246 Bacteria 246524
130 Ga0209026_1000053 3300025250 Bacteria 246524
131 Ga0209759_1000042 3300025256 Bacteria 246524
132 Ga0209129_1002199 3300025258 Bacteria 9802
133 Ga0209233_1000219 3300025261 Bacteria 104797
134 Ga0209233_1002689 3300025261 Bacteria 6419
135 Ga0209673_1000632 3300025273 Bacteria 53357
136 Ga0209673_1000922 3300025273 Bacteria 37220
137 Ga0209130_1006700 3300025284 Bacteria 3690
138 Ga0209676_1023934 3300025292 Bacteria 1989
139 Ga0209025_1000082 3300025294 Bacteria 265613
140 Ga0209025_1000152 3300025294 Bacteria 171558
141 Ga0209025_1036031 3300025294 Bacteria 2223
142 Ga0209564_1000128 3300025295 Bacteria 196532
143 Ga0209758_1001112 3300025297 Bacteria 34604
144 Ga0209758_1007593 3300025297 Bacteria 7322
145 Ga0209256_1000564 3300025299 Bacteria 53001
146 Ga0207426_1000228 3300025302 Bacteria 129261
147 Ga0207426_1000928 3300025302 Bacteria 29240
148 Ga0209051_1010691 3300025303 Bacteria 4601
149 Ga0207680_10000678 3300025903 Bacteria 16104
150 Ga0207645_10018578 3300025907 Bacteria 4570
151 Ga0207645_10133031 3300025907 Bacteria 1619
152 Ga0207643_10229360 3300025908 Bacteria 1139
153 Ga0207705_10006222 3300025909 Bacteria 8869
154 Ga0207654_10137253 3300025911 Bacteria 1555
155 Ga0207693_10078434 3300025915 Bacteria 2585
156 Ga0207693_10128573 3300025915 Bacteria 1991
157 Ga0207662_10159941 3300025918 Bacteria 1438
158 Ga0207694_10000013 3300025924 Bacteria 384823
159 Ga0207687_10062365 3300025927 Bacteria 2636
160 Ga0207664_10001490 3300025929 Bacteria 15333
161 Ga0207664_10238552 3300025929 Bacteria 1583
162 Ga0207644_10175382 3300025931 Bacteria 1677
163 Ga0207711_10046920 3300025941 Bacteria 3691
164 Ga0207711_10169450 3300025941 Bacteria 1981
165 Ga0207661_10150481 3300025944 Bacteria 2011
166 Ga0207679_10261856 3300025945 Bacteria 1475
167 Ga0207651_10399140 3300025960 Bacteria 1169
168 Ga0207712_10007003 3300025961 Bacteria 7111
169 Ga0207668_10001389 3300025972 Bacteria 14278
170 Ga0207640_10349672 3300025981 Bacteria 1187
171 Ga0207703_10048287 3300026035 Bacteria 3435
172 Ga0207703_10585077 3300026035 Bacteria 1055
173 Ga0207639_10196824 3300026041 Bacteria 1725
174 Ga0207678_10154256 3300026067 Bacteria 1961
175 Ga0207702_10285107 3300026078 Bacteria 1563
176 Ga0207702_10964022 3300026078 Bacteria 846
177 Ga0207676_10046229 3300026095 Bacteria 3367
178 Ga0207676_10452747 3300026095 Bacteria 1210
179 Ga0207674_10035167 3300026116 Bacteria 5230
180 Ga0207674_10139195 3300026116 Bacteria 2388
181 Ga0207675_100011392 3300026118 Bacteria 8322
182 Ga0207675_100017680 3300026118 Bacteria 6652
183 Ga0207698_10265769 3300026142 Bacteria 1578
184 Ga0209974_10107187 3300027876 Bacteria 981
185 Ga0207428_10031980 3300027907 Bacteria 4333
186 Ga0207428_10223677 3300027907 Bacteria 1410
187 Ga0268266_10312453 3300028379 Bacteria 1469
188 Ga0268265_10031095 3300028380 Bacteria 3853
189 Ga0268265_10046914 3300028380 Bacteria 3233
190 Ga0268264_10351445 3300028381 Bacteria 1403
191 Ga0268264_10489095 3300028381 Bacteria 1198
192 Ga0307511_10039338 3300030521 Bacteria 4043
193 Ga0307512_10086845 3300030522 Bacteria 2207
194 Ga0265325_10003829 3300031241 Bacteria 9683
195 Ga0265325_10004490 3300031241 Bacteria 8804
196 Ga0265339_10014452 3300031249 Bacteria 4756
197 Ga0265339_10019330 3300031249 Bacteria 4002
198 Ga0265331_10025302 3300031250 Bacteria 2998
199 Ga0265316_10013588 3300031344 Bacteria 7224
200 Ga0265316_10094631 3300031344 Bacteria 2276
201 Ga0307513_10092470 3300031456 Bacteria 3079
202 Ga0265313_10002553 3300031595 Bacteria 15556
203 Ga0307508_10000370 3300031616 Bacteria 54530
204 Ga0307508_10000419 3300031616 Bacteria 50420
205 Ga0265314_10247210 3300031711 Bacteria 1026
206 Ga0307405_10004043 3300031731 Bacteria 6886
207 Ga0307405_10043399 3300031731 Bacteria 2743
208 Ga0307413_10005895 3300031824 Bacteria 5532
209 Ga0307413_10027571 3300031824 Bacteria 3149
210 Ga0307410_10008166 3300031852 Bacteria 5788
211 Ga0307410_10017834 3300031852 Bacteria 4273
212 Ga0307410_10206287 3300031852 Bacteria 1504
213 Ga0307406_10001235 3300031901 Bacteria 14320
214 Ga0307406_10053531 3300031901 Bacteria 2571
215 Ga0307407_10009187 3300031903 Bacteria 4589
216 Ga0307409_100001305 3300031995 Bacteria 12090
217 Ga0307409_100008093 3300031995 Bacteria 6349
218 Ga0307409_100054455 3300031995 Bacteria 3081
219 Ga0307409_100072959 3300031995 Bacteria 2735
220 Ga0307409_101203074 3300031995 Bacteria 781
221 Ga0307416_100001906 3300032002 Bacteria 11638
222 Ga0307416_100033950 3300032002 Bacteria 3875
223 Ga0307416_100039719 3300032002 Bacteria 3647
224 Ga0307416_100359826 3300032002 Bacteria 1477
225 Ga0307414_10033869 3300032004 Bacteria 3381
226 Ga0307411_10153205 3300032005 Bacteria 1716
227 Ga0307415_100001344 3300032126 Bacteria 11688
228 Ga0307415_100135054 3300032126 Bacteria 1875
229 Ga0307415_100498498 3300032126 Bacteria 1064
230 Ga0307415_100568730 3300032126 Bacteria 1003
231 Ga0307507_10189055 3300033179 Bacteria 1452
232 Ga0307510_10334937 3300033180 Bacteria 967
233 Ga0315911_1000003 3300033442 Bacteria 502217
234 Ga0315911_1000072 3300033442 Bacteria 15680
235 Ga0373959_0000270 3300034820 Bacteria 11184
236 Ga0373959_0005071 3300034820 Bacteria 2151
237 Ga0373938_0007226 3300034957 Bacteria 1949
238 Ga0373926_0104618 3300035083 Bacteria 1060
239 Ga0373934_0014714 3300035086 Bacteria 2964
240 Ga0373940_0044750 3300035088 Bacteria 1227
241 Ga0373944_0003442 3300035089 Bacteria 4087
242 Ga0373949_0057925 3300035090 Bacteria 991
243 Ga0373949_0060406 3300035090 Bacteria 974
244 Ga0373951_0019768 3300035091 Bacteria 1538
245 Ga0373923_0017283 3300035111 Bacteria 2757
246 Ga0373932_0006030 3300035112 Bacteria 2860
247 Ga0373936_0109563 3300035113 Bacteria 1171
248 Ga0373945_0002792 3300035116 Bacteria 5478
249 Ga0373953_0053507 3300035117 Bacteria 1636
250 Ga0373954_0124612 3300035118 Bacteria 1252
251 Ga0373956_0013140 3300035119 Bacteria 3442
252 Ga0373957_0055159 3300035120 Bacteria 1527
253 Ga0373960_0045801 3300035121 Bacteria 1281
254 Ga0373946_0062104 3300035171 Bacteria 1593
255 Ga0373955_0061626 3300035172 Bacteria 2072
256 Ga0373942_0000355 3300035207 Bacteria 12570
257 Ga0373961_0100620 3300035241 Bacteria 935
258 Ga0373924_0080286 3300035410 Bacteria 1386
259 Ga0373935_0229353 3300035692 Bacteria 1292
260 Ga0373933_0205014 3300035724 Bacteria 1262
261 Ga0373947_0028232 3300035725 Bacteria 3287
262 Ga0373947_0067873 3300035725 Bacteria 2179
263 Ga0373937_0103327 3300036401 Bacteria 2646
264 Ga0373925_0141443 3300037068 Bacteria 1883
265 Ga0373925_0239233 3300037068 Bacteria 1453
266 Ga0373925_0266491 3300037068 Bacteria 1377
267 Ga0395899_0083861 3300037312 Bacteria 2317
268 Ga0395900_0031585 3300037418 Bacteria 5443
269 Ga0395900_0064015 3300037418 Bacteria 3780
270 Ga0395898_0015769 3300037466 Bacteria 7744
271 Ga0395898_0040177 3300037466 Bacteria 4627
272 Ga0395905_0013760 3300037471 Bacteria 7746
273 Ga0395905_0144024 3300037471 Bacteria 2242
274 Ga0395905_0507007 3300037471 Bacteria 1107
275 Ga0436364_0069694 3300037853 Bacteria 2100
276 Ga0436364_1308164 3300037853 Bacteria 895
277 Ga0395901_0017821 3300038443 Bacteria 7247
278 Ga0395901_0039590 3300038443 Bacteria 4878
279 Ga0395901_0087402 3300038443 Bacteria 3259
280 Ga0436365_0410704 3300039437 Bacteria 3557
281 Ga0436365_0672215 3300039437 Bacteria 6822
282 Ga0436365_0693142 3300039437 Bacteria 69863
283 Ga0436365_0861406 3300039437 Bacteria 61112
284 Ga0436365_0871751 3300039437 Bacteria 4193
285 Ga0436365_0962686 3300039437 Bacteria 2024
286 Ga0436365_1017987 3300039437 Bacteria 20964
287 Ga0436365_1919465 3300039437 Bacteria 19290
288 Ga0436360_1016574 3300039438 Bacteria 1612
289 Ga0436362_1015986 3300039453 Bacteria 1530
290 Ga0439461_0044394 3300041410 Bacteria 969
291 Ga0451793_0430880 3300041452 Bacteria 5314
292 Ga0439433_0021504 3300041999 Bacteria 1444
293 Ga0439443_009386 3300042003 Bacteria 1402
294 Ga0439450_040650 3300042008 Bacteria 1078
295 Ga0450915_000839 3300042119 Bacteria 1282
296 Ga0450920_035302 3300042122 Bacteria 990
297 Ga0450922_004491 3300042124 Bacteria 1283
298 Ga0450888_004567 3300042126 Bacteria 1450
299 Ga0450898_017735 3300042134 Bacteria 1227
300 Ga0450900_013297 3300042136 Bacteria 1086
301 Ga0450908_030455 3300042184 Bacteria 938
302 Ga0439459_0038569 3300042438 Bacteria 1005
303 Ga0439460_0021724 3300042461 Bacteria 1756
304 Ga0450918_031430 3300042531 Bacteria 938
305 Ga0450893_0029247 3300042532 Bacteria 977
306 Ga0466963_0055640 3300044694 Bacteria 2631
307 Ga0466968_0297175 3300044735 Bacteria 776
308 Ga0466970_0003775 3300044765 Bacteria 7411
309 Ga0466959_0019857 3300045049 Bacteria 4944
310 Ga0466958_0029062 3300045836 Bacteria 3279
311 Ga0466958_0300499 3300045836 Bacteria 1030
312 Ga0466967_0070423 3300045976 Bacteria 3129
313 Ga0466967_0165286 3300045976 Bacteria 2079
314 Ga0495603_0065381 3300046455 Bacteria 2143
315 Ga0495629_0008087 3300046459 Bacteria 7741
316 Ga0495638_0004573 3300046460 Bacteria 10470
317 Ga0495641_0083342 3300046461 Bacteria 1432
318 Ga0495651_0064229 3300046462 Bacteria 2805
319 Ga0495582_0044556 3300046473 Bacteria 2443
320 Ga0495662_0025636 3300046476 Bacteria 2847
321 Ga0495594_0060671 3300046499 Bacteria 2092
322 Ga0495607_0094383 3300046501 Bacteria 1614
323 Ga0495606_0172801 3300046507 Bacteria 1252
324 Ga0495608_0019585 3300046511 Bacteria 4656
325 Ga0495630_0387410 3300046517 Bacteria 1070
326 Ga0495643_0188110 3300046522 Bacteria 999
327 Ga0495652_0297191 3300046529 Bacteria 1175
328 Ga0495665_0123716 3300046531 Bacteria 1354
329 Ga0495586_0217397 3300046535 Bacteria 1085
330 Ga0495587_0053195 3300046536 Bacteria 2387
331 Ga0495645_0085240 3300046543 Bacteria 2261
332 Ga0495667_0054748 3300046559 Bacteria 2624
333 Ga0495668_0135901 3300046616 Bacteria 1346
334 Ga0495668_0283385 3300046616 Bacteria 908
335 Ga0495661_0078752 3300046665 Bacteria 1906
336 Ga0495588_0087720 3300046674 Bacteria 1628
337 Ga0495599_0044072 3300046678 Bacteria 2798
338 Ga0495646_0151090 3300046680 Bacteria 1291
339 Ga0495613_0363037 3300046689 Bacteria 993
340 Ga0495670_0227088 3300046691 Bacteria 992
341 Ga0495600_0035767 3300046809 Bacteria 3227
342 Ga0495581_0394476 3300047315 Bacteria 807
343 Ga0495674_0205527 3300047319 Bacteria 1632
344 Ga0495676_0120076 3300047321 Bacteria 1913
345 Ga0495680_0057346 3300047322 Bacteria 3012
346 Ga0495684_0256648 3300047471 Bacteria 1270
347 Ga0495593_0152501 3300047673 Bacteria 1168
348 Ga0495593_0166797 3300047673 Bacteria 1111
349 Ga0496101_0066766 3300048904 Bacteria 2625
350 Ga0496101_0119057 3300048904 Bacteria 1995
351 Ga0496102_0082922 3300048905 Bacteria 2957
352 Ga0496102_0432496 3300048905 Bacteria 1236
353 Ga0496103_0050700 3300048906 Bacteria 2568
354 Ga0496103_0244947 3300048906 Bacteria 1153
355 Ga0496104_0173975 3300048907 Bacteria 2063
356 Ga0496104_0500559 3300048907 Bacteria 1126
357 Ga0496105_0061875 3300048908 Bacteria 3089
358 Ga0496105_0377993 3300048908 Bacteria 1127
359 Ga0496106_0161341 3300048909 Bacteria 1773
360 Ga0496106_0400874 3300048909 Bacteria 1102
361 Ga0496106_0508891 3300048909 Bacteria 967
362 Ga0496106_0531744 3300048909 Bacteria 944
363 Ga0496107_0090006 3300048910 Bacteria 2241
364 Ga0496108_0000113 3300048911 Bacteria 81461
365 Ga0496108_0043171 3300048911 Bacteria 3766
366 Ga0496108_0114110 3300048911 Bacteria 2313
367 Ga0496108_0273776 3300048911 Bacteria 1470
368 Ga0496109_0012395 3300048912 Bacteria 7361
369 Ga0496109_0055258 3300048912 Bacteria 3622
370 Ga0496109_0088212 3300048912 Bacteria 2866
371 Ga0496111_0045334 3300048914 Bacteria 3163
372 Ga0496111_0136972 3300048914 Bacteria 1814
373 Ga0496112_0012981 3300048915 Bacteria 7677
374 Ga0496112_0062242 3300048915 Bacteria 3680
375 Ga0496112_0238521 3300048915 Bacteria 1771
376 Ga0496112_0632748 3300048915 Bacteria 1000
377 Ga0496113_0000366 3300048916 Bacteria 21747
378 Ga0496114_0212400 3300048917 Bacteria 1697
379 Ga0496114_0287737 3300048917 Bacteria 1450
380 Ga0496114_0683662 3300048917 Bacteria 901
381 Ga0496115_0013701 3300048918 Bacteria 6140
382 Ga0496115_0034251 3300048918 Bacteria 4013
383 Ga0496116_0258653 3300048919 Bacteria 860
384 Ga0501031_0107979 3300049568 Bacteria 1817
385 Ga0501032_0102188 3300049569 Bacteria 1899
386 Ga0501034_0163866 3300049571 Bacteria 2193
387 Ga0501034_0343573 3300049571 Bacteria 1422
388 Ga0501036_0084876 3300049572 Bacteria 2677
389 Ga0501036_0503546 3300049572 Bacteria 1007
390 Ga0501037_0004319 3300049573 Bacteria 10307
391 Ga0501037_0182978 3300049573 Bacteria 1486
392 Ga0501038_0117966 3300049574 Bacteria 2191
393 Ga0501038_0167703 3300049574 Bacteria 1780
394 Ga0501039_0103056 3300049575 Bacteria 2227
395 Ga0501040_0057689 3300049576 Bacteria 2666
396 Ga0501040_0089588 3300049576 Bacteria 2137
397 Ga0501041_0035401 3300049577 Bacteria 3024
398 Ga0501042_0231609 3300049578 Bacteria 1332
399 Ga0501043_0204300 3300049579 Bacteria 1532
400 Ga0501047_0002351 3300049581 Bacteria 18082
401 Ga0501047_0010811 3300049581 Bacteria 8626
402 Ga0501047_0029373 3300049581 Bacteria 5302
403 Ga0501048_0071586 3300049582 Bacteria 2448
404 Ga0501048_0261848 3300049582 Bacteria 1228
405 Ga0501067_0026769 3300049583 Bacteria 3193
406 Ga0501068_0003400 3300049584 Bacteria 8559
407 Ga0501069_0198749 3300049585 Bacteria 1161
408 Ga0501069_0254584 3300049585 Bacteria 1024
409 Ga0501070_0001898 3300049586 Bacteria 18497
410 Ga0501071_0008105 3300049587 Bacteria 6928
411 Ga0501071_0058103 3300049587 Bacteria 2796
412 Ga0501072_0035419 3300049588 Bacteria 3909
413 Ga0501074_0021872 3300049590 Bacteria 4643
414 Ga0501076_0145081 3300049592 Bacteria 1930
415 Ga0501076_0399857 3300049592 Bacteria 1130
416 Ga0501079_0037889 3300049741 Bacteria 3717
417 Ga0501080_0143711 3300049742 Bacteria 2205
418 Ga0501083_0007143 3300049744 Bacteria 7929
419 Ga0501035_0009930 3300049822 Bacteria 8839
420 Ga0501044_0002645 3300049823 Bacteria 20386
421 Ga0501044_0141906 3300049823 Bacteria 2390
422 Ga0501045_0332063 3300049824 Bacteria 1131
423 Ga0501045_0540169 3300049824 Bacteria 865
424 nmdc:mga03683_23931_c1 3300050489 Bacteria 2385
425 nmdc:mga03n38_326290_c1 3300050490 Bacteria 830
426 nmdc:mga04h51_6132_c1 3300050495 Bacteria 3100
427 nmdc:mga07m45_26648_c1 3300050496 Bacteria 3178
428 nmdc:mga05p37_15521_c1 3300050507 Bacteria 9156
429 nmdc:mga05p37_481_c1 3300050507 Bacteria 43634
430 nmdc:mga05p37_52911_c1 3300050507 Bacteria 4994
431 nmdc:mga05p37_659814_c1 3300050507 Bacteria 1170
432 nmdc:mga05p37_7764_c1 3300050507 Bacteria 12665
433 nmdc:mga05p37_89430_c1 3300050507 Bacteria 3795
434 nmdc:mga09592_1486_c1 3300050508 Bacteria 18853
435 nmdc:mga09592_18531_c1 3300050508 Bacteria 5710
436 nmdc:mga09592_25442_c1 3300050508 Bacteria 4899
437 nmdc:mga09592_307244_c1 3300050508 Bacteria 1375
438 nmdc:mga09592_76809_c1 3300050508 Bacteria 2841
439 nmdc:mga09592_790_c1 3300050508 Bacteria 24488
440 nmdc:mga0qj67_13824_c1 3300050509 Bacteria 6094
441 nmdc:mga0qj67_18090_c1 3300050509 Bacteria 5370
442 nmdc:mga0qj67_24283_c1 3300050509 Bacteria 4672
443 nmdc:mga0qj67_4547_c1 3300050509 Bacteria 10050
444 nmdc:mga0qj67_60791_c1 3300050509 Bacteria 2999
445 nmdc:mga06r32_10652_c1 3300050510 Bacteria 8294
446 nmdc:mga06r32_32_c1 3300050510 Bacteria 83882
447 nmdc:mga06r32_92816_c1 3300050510 Bacteria 2952
448 nmdc:mga08y16_109333_c1 3300050511 Bacteria 2878
449 nmdc:mga08y16_169606_c1 3300050511 Bacteria 2267
450 nmdc:mga08y16_7002_c1 3300050511 Bacteria 11826
451 nmdc:mga0n895_16745_c1 3300050512 Bacteria 6736
452 nmdc:mga0a205_9218_c1 3300050515 Bacteria 9010
453 Ga0495612_0080349 3300053078 Bacteria 1369
454 Ga0495595_0067755 3300053084 Bacteria 1683
455 Ga0495595_0208110 3300053084 Bacteria 975
456 Ga0495619_0215597 3300053085 Bacteria 1329
457 Ga0500646_0000287 3300053090 Bacteria 15428
458 Ga0500651_0111141 3300053093 Bacteria 1672
459 Ga0500568_0002126 3300053139 Bacteria 11964
460 Ga0500600_0120797 3300053149 Bacteria 1350
461 Ga0500616_0002369 3300053153 Bacteria 15819
462 Ga0590075_047133 3300059424 Bacteria 1105
463 Ga0501082_0204328 3300060353 Bacteria 1719
464 Ga0501082_0637256 3300060353 Bacteria 933
465 Ga0530510_0082648 3300061734 Bacteria 2339
466 Ga0530510_0341537 3300061734 Bacteria 1124

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031456 Ga0307513_10092470 Ga0307513_100924701 228
2 3300003320 rootH2_10015505 rootH2_1001550512 229
3 3300012491 Ga0157329_1003126 Ga0157329_10031261 229
4 3300031995 Ga0307409_100054455 Ga0307409_1000544552 234
5 3300045976 Ga0466967_0070423 Ga0466967_0070423_130_849 237
6 3300013308 Ga0157375_10742851 Ga0157375_107428512 238
7 iso_pu_bacteria 2751185782 2753263941 239
8 iso_pu_bacteria 2816332119 2816422555 239
9 iso_pu_bacteria 2915650412 2915654443 239
10 3300037312 Ga0395899_0083861 Ga0395899_0083861_359_1105 240
11 3300037418 Ga0395900_0031585 Ga0395900_0031585_858_1622 240
12 3300037471 Ga0395905_0013760 Ga0395905_0013760_1082_1846 240
13 3300038443 Ga0395901_0039590 Ga0395901_0039590_1986_2750 240
14 iso_pu_bacteria 2515075009 2515110867 240
15 iso_pu_bacteria 2517093000 2517093689 240
16 iso_pu_bacteria 2585427528 2585538628 240
17 iso_pu_bacteria 2585427593 2585836581 240
18 iso_pu_bacteria 2615840698 2616556813 240
19 iso_pu_bacteria 2738541333 2739034059 240
20 iso_pu_bacteria 2791355267 2793368114 240
21 iso_pu_bacteria 2802429633 2806042855 240
22 iso_pu_bacteria 2802429634 2806050807 240
23 iso_pu_bacteria 2802429635 2806058025 240
24 iso_pu_bacteria 2802429636 2806065262 240
25 iso_pu_bacteria 2802429637 2806076748 240
26 iso_pu_bacteria 2842110456 2842117170 240
27 iso_pu_bacteria 2856858025 2856863960 240
28 iso_pu_bacteria 2884693830 2884699561 240
29 iso_pu_bacteria 2895442618 2895443230 240
30 iso_pu_bacteria 2933586486 2933593311 240
31 iso_pu_bacteria 8001781756 8001785499 240
32 iso_pu_bacteria 8005460587 8005461505 240
33 iso_pu_bacteria 8005570704 8005575708 240
34 iso_pu_bacteria 8055412473 8055418842 240
35 iso_pu_bacteria 8056375014 8056379235 240
36 3300009147 Ga0114129_10268506 Ga0114129_102685063 242
37 3300042136 Ga0450900_013297 Ga0450900_013297_268_1017 242
38 3300050511 nmdc:mga08y16_109333_c1 nmdc:mga08y16_109333_c1_1751_2521 242
39 iso_pu_bacteria 2513237137 2513858710 242
40 iso_pu_bacteria 2513237137 2513862470 242
41 iso_pu_bacteria 2844533157 2844534854 242
42 iso_pu_bacteria 2904699407 2904701358 242
43 3300003187 JGI25151J46595_10001406 JGI25151J46595_1000140614 243
44 3300003214 JGI25165J46597_1002418 JGI25165J46597_10024187 243
45 3300003354 JGI25160J50197_1010974 JGI25160J50197_10109742 243
46 3300003373 JGI25407J50210_10012174 JGI25407J50210_100121743 243
47 3300003373 JGI25407J50210_10059661 JGI25407J50210_100596612 243
48 3300005262 Ga0065165_1045387 Ga0065165_10453872 243
49 3300005335 Ga0070666_10000249 Ga0070666_100002497 243
50 3300005337 Ga0070682_100117776 Ga0070682_1001177763 243
51 3300005339 Ga0070660_100468560 Ga0070660_1004685601 243
52 3300005340 Ga0070689_100631105 Ga0070689_1006311051 243
53 3300005344 Ga0070661_100070111 Ga0070661_1000701112 243
54 3300005345 Ga0070692_10042551 Ga0070692_100425512 243
55 3300005347 Ga0070668_100002810 Ga0070668_10000281013 243
56 3300005353 Ga0070669_100126084 Ga0070669_1001260842 243
57 3300005354 Ga0070675_100073492 Ga0070675_1000734924 243
58 3300005356 Ga0070674_100066303 Ga0070674_1000663032 243
59 3300005356 Ga0070674_100396142 Ga0070674_1003961422 243
60 3300005364 Ga0070673_100030242 Ga0070673_1000302425 243
61 3300005434 Ga0070709_10337775 Ga0070709_103377751 243
62 3300005455 Ga0070663_100077351 Ga0070663_1000773512 243
63 3300005456 Ga0070678_100120250 Ga0070678_1001202503 243
64 3300005457 Ga0070662_100007024 Ga0070662_1000070243 243
65 3300005459 Ga0068867_100275364 Ga0068867_1002753642 243
66 3300005466 Ga0070685_10019858 Ga0070685_100198585 243
67 3300005535 Ga0070684_100034062 Ga0070684_1000340623 243
68 3300005535 Ga0070684_100251151 Ga0070684_1002511511 243
69 3300005548 Ga0070665_100442041 Ga0070665_1004420412 243
70 3300005548 Ga0070665_100488874 Ga0070665_1004888741 243
71 3300005578 Ga0068854_100228748 Ga0068854_1002287483 243
72 3300005616 Ga0068852_100329572 Ga0068852_1003295722 243
73 3300005719 Ga0068861_100223597 Ga0068861_1002235971 243
74 3300005841 Ga0068863_100026556 Ga0068863_1000265566 243
75 3300005842 Ga0068858_100657356 Ga0068858_1006573561 243
76 3300005843 Ga0068860_100108377 Ga0068860_1001083773 243
77 3300005843 Ga0068860_100477319 Ga0068860_1004773191 243
78 3300005843 Ga0068860_100477790 Ga0068860_1004777902 243
79 3300005937 Ga0081455_10105726 Ga0081455_101057263 243
80 3300005981 Ga0081538_10026994 Ga0081538_100269942 243
81 3300005981 Ga0081538_10031505 Ga0081538_100315054 243
82 3300005983 Ga0081540_1004395 Ga0081540_10043954 243
83 3300005985 Ga0081539_10006939 Ga0081539_100069399 243
84 3300005985 Ga0081539_10011776 Ga0081539_100117762 243
85 3300005985 Ga0081539_10049227 Ga0081539_100492272 243
86 3300005985 Ga0081539_10059376 Ga0081539_100593762 243
87 3300006353 Ga0075370_10276060 Ga0075370_102760602 243
88 3300006844 Ga0075428_100094031 Ga0075428_1000940316 243
89 3300006847 Ga0075431_100545168 Ga0075431_1005451682 243
90 3300006852 Ga0075433_10011812 Ga0075433_100118122 243
91 3300006880 Ga0075429_100126699 Ga0075429_1001266994 243
92 3300006880 Ga0075429_100529210 Ga0075429_1005292102 243
93 3300006931 Ga0097620_100401473 Ga0097620_1004014732 243
94 3300009094 Ga0111539_10014481 Ga0111539_1001448110 243
95 3300009094 Ga0111539_10054709 Ga0111539_100547092 243
96 3300009098 Ga0105245_10590525 Ga0105245_105905251 243
97 3300009101 Ga0105247_10346467 Ga0105247_103464671 243
98 3300009177 Ga0105248_10284340 Ga0105248_102843402 243
99 3300009551 Ga0105238_10000564 Ga0105238_1000056434 243
100 3300009553 Ga0105249_10017384 Ga0105249_100173847 243
101 3300009553 Ga0105249_10888123 Ga0105249_108881231 243
102 3300010375 Ga0105239_10080599 Ga0105239_100805991 243
103 3300013104 Ga0157370_10069573 Ga0157370_100695731 243
104 3300013297 Ga0157378_10025800 Ga0157378_100258004 243
105 3300013307 Ga0157372_10847127 Ga0157372_108471272 243
106 3300020070 Ga0206356_10227172 Ga0206356_102271721 243
107 3300020070 Ga0206356_10387185 Ga0206356_103871851 243
108 3300021384 Ga0213876_10000024 Ga0213876_10000024105 243
109 3300021384 Ga0213876_10000365 Ga0213876_1000036527 243
110 3300021384 Ga0213876_10001840 Ga0213876_1000184013 243
111 3300021384 Ga0213876_10019216 Ga0213876_100192164 243
112 3300025231 Ga0207427_104375 Ga0207427_1043753 243
113 3300025261 Ga0209233_1002689 Ga0209233_10026892 243
114 3300025284 Ga0209130_1006700 Ga0209130_10067001 243
115 3300025294 Ga0209025_1000152 Ga0209025_100015211 243
116 3300025294 Ga0209025_1036031 Ga0209025_10360312 243
117 3300025297 Ga0209758_1007593 Ga0209758_10075934 243
118 3300025302 Ga0207426_1000928 Ga0207426_100092811 243
119 3300025903 Ga0207680_10000678 Ga0207680_100006784 243
120 3300025907 Ga0207645_10018578 Ga0207645_100185786 243
121 3300025907 Ga0207645_10133031 Ga0207645_101330312 243
122 3300025908 Ga0207643_10229360 Ga0207643_102293602 243
123 3300025909 Ga0207705_10006222 Ga0207705_100062223 243
124 3300025911 Ga0207654_10137253 Ga0207654_101372531 243
125 3300025915 Ga0207693_10128573 Ga0207693_101285732 243
126 3300025918 Ga0207662_10159941 Ga0207662_101599412 243
127 3300025924 Ga0207694_10000013 Ga0207694_10000013218 243
128 3300025927 Ga0207687_10062365 Ga0207687_100623654 243
129 3300025929 Ga0207664_10001490 Ga0207664_1000149013 243
130 3300025931 Ga0207644_10175382 Ga0207644_101753821 243
131 3300025941 Ga0207711_10169450 Ga0207711_101694501 243
132 3300025944 Ga0207661_10150481 Ga0207661_101504812 243
133 3300025945 Ga0207679_10261856 Ga0207679_102618562 243
134 3300025960 Ga0207651_10399140 Ga0207651_103991402 243
135 3300025961 Ga0207712_10007003 Ga0207712_100070039 243
136 3300025972 Ga0207668_10001389 Ga0207668_1000138914 243
137 3300025981 Ga0207640_10349672 Ga0207640_103496722 243
138 3300026035 Ga0207703_10048287 Ga0207703_100482872 243
139 3300026035 Ga0207703_10585077 Ga0207703_105850771 243
140 3300026041 Ga0207639_10196824 Ga0207639_101968243 243
141 3300026067 Ga0207678_10154256 Ga0207678_101542562 243
142 3300026078 Ga0207702_10964022 Ga0207702_109640221 243
143 3300026095 Ga0207676_10452747 Ga0207676_104527471 243
144 3300026116 Ga0207674_10035167 Ga0207674_100351672 243
145 3300026118 Ga0207675_100011392 Ga0207675_1000113921 243
146 3300026142 Ga0207698_10265769 Ga0207698_102657692 243
147 3300027876 Ga0209974_10107187 Ga0209974_101071871 243
148 3300027907 Ga0207428_10031980 Ga0207428_100319804 243
149 3300027907 Ga0207428_10223677 Ga0207428_102236772 243
150 3300028379 Ga0268266_10312453 Ga0268266_103124531 243
151 3300028380 Ga0268265_10031095 Ga0268265_100310952 243
152 3300028380 Ga0268265_10046914 Ga0268265_100469144 243
153 3300028381 Ga0268264_10351445 Ga0268264_103514451 243
154 3300028381 Ga0268264_10489095 Ga0268264_104890952 243
155 3300030521 Ga0307511_10039338 Ga0307511_100393384 243
156 3300030522 Ga0307512_10086845 Ga0307512_100868451 243
157 3300031241 Ga0265325_10003829 Ga0265325_100038294 243
158 3300031241 Ga0265325_10004490 Ga0265325_100044902 243
159 3300031249 Ga0265339_10014452 Ga0265339_100144522 243
160 3300031249 Ga0265339_10019330 Ga0265339_100193302 243
161 3300031250 Ga0265331_10025302 Ga0265331_100253023 243
162 3300031344 Ga0265316_10013588 Ga0265316_100135884 243
163 3300031344 Ga0265316_10094631 Ga0265316_100946312 243
164 3300031595 Ga0265313_10002553 Ga0265313_100025534 243
165 3300031616 Ga0307508_10000370 Ga0307508_1000037050 243
166 3300031616 Ga0307508_10000419 Ga0307508_1000041935 243
167 3300031711 Ga0265314_10247210 Ga0265314_102472102 243
168 3300031852 Ga0307410_10008166 Ga0307410_100081663 243
169 3300031903 Ga0307407_10009187 Ga0307407_100091875 243
170 3300031995 Ga0307409_100008093 Ga0307409_1000080933 243
171 3300031995 Ga0307409_101203074 Ga0307409_1012030741 243
172 3300032002 Ga0307416_100039719 Ga0307416_1000397193 243
173 3300032004 Ga0307414_10033869 Ga0307414_100338692 243
174 3300032126 Ga0307415_100135054 Ga0307415_1001350542 243
175 3300033179 Ga0307507_10189055 Ga0307507_101890552 243
176 3300033442 Ga0315911_1000003 Ga0315911_1000003103 243
177 3300033442 Ga0315911_1000072 Ga0315911_100007211 243
178 3300034820 Ga0373959_0000270 Ga0373959_0000270_2150_2881 243
179 3300035083 Ga0373926_0104618 Ga0373926_0104618_11_748 243
180 3300035086 Ga0373934_0014714 Ga0373934_0014714_533_1270 243
181 3300035089 Ga0373944_0003442 Ga0373944_0003442_419_1156 243
182 3300035090 Ga0373949_0057925 Ga0373949_0057925_226_981 243
183 3300035111 Ga0373923_0017283 Ga0373923_0017283_727_1464 243
184 3300035113 Ga0373936_0109563 Ga0373936_0109563_394_1131 243
185 3300035116 Ga0373945_0002792 Ga0373945_0002792_3421_4158 243
186 3300035117 Ga0373953_0053507 Ga0373953_0053507_143_880 243
187 3300035118 Ga0373954_0124612 Ga0373954_0124612_199_936 243
188 3300035119 Ga0373956_0013140 Ga0373956_0013140_632_1369 243
189 3300035120 Ga0373957_0055159 Ga0373957_0055159_628_1365 243
190 3300035172 Ga0373955_0061626 Ga0373955_0061626_258_995 243
191 3300035410 Ga0373924_0080286 Ga0373924_0080286_319_1056 243
192 3300035692 Ga0373935_0229353 Ga0373935_0229353_531_1268 243
193 3300035724 Ga0373933_0205014 Ga0373933_0205014_157_894 243
194 3300035725 Ga0373947_0028232 Ga0373947_0028232_1536_2273 243
195 3300036401 Ga0373937_0103327 Ga0373937_0103327_1714_2451 243
196 3300037068 Ga0373925_0141443 Ga0373925_0141443_530_1267 243
197 3300037418 Ga0395900_0064015 Ga0395900_0064015_823_1575 243
198 3300037466 Ga0395898_0040177 Ga0395898_0040177_817_1569 243
199 3300037471 Ga0395905_0144024 Ga0395905_0144024_754_1506 243
200 3300037471 Ga0395905_0507007 Ga0395905_0507007_329_1060 243
201 3300037853 Ga0436364_0069694 Ga0436364_0069694_796_1539 243
202 3300038443 Ga0395901_0087402 Ga0395901_0087402_1946_2698 243
203 3300039437 Ga0436365_0693142 Ga0436365_0693142_23799_24542 243
204 3300039437 Ga0436365_0861406 Ga0436365_0861406_9345_10088 243
205 3300039437 Ga0436365_1017987 Ga0436365_1017987_710_1447 243
206 3300039437 Ga0436365_1919465 Ga0436365_1919465_9633_10376 243
207 3300039438 Ga0436360_1016574 Ga0436360_1016574_676_1416 243
208 3300039453 Ga0436362_1015986 Ga0436362_1015986_12_743 243
209 3300041410 Ga0439461_0044394 Ga0439461_0044394_75_806 243
210 3300041452 Ga0451793_0430880 Ga0451793_0430880_1422_2153 243
211 3300042003 Ga0439443_009386 Ga0439443_009386_273_1013 243
212 3300042008 Ga0439450_040650 Ga0439450_040650_258_989 243
213 3300042119 Ga0450915_000839 Ga0450915_000839_308_1147 243
214 3300042122 Ga0450920_035302 Ga0450920_035302_77_817 243
215 3300042124 Ga0450922_004491 Ga0450922_004491_52_792 243
216 3300042126 Ga0450888_004567 Ga0450888_004567_301_1041 243
217 3300042134 Ga0450898_017735 Ga0450898_017735_200_940 243
218 3300042184 Ga0450908_030455 Ga0450908_030455_145_885 243
219 3300042438 Ga0439459_0038569 Ga0439459_0038569_209_949 243
220 3300042461 Ga0439460_0021724 Ga0439460_0021724_45_785 243
221 3300042531 Ga0450918_031430 Ga0450918_031430_40_780 243
222 3300042532 Ga0450893_0029247 Ga0450893_0029247_31_762 243
223 3300044735 Ga0466968_0297175 Ga0466968_0297175_10_741 243
224 3300045836 Ga0466958_0029062 Ga0466958_0029062_2358_3122 243
225 3300045836 Ga0466958_0300499 Ga0466958_0300499_187_933 243
226 3300045976 Ga0466967_0165286 Ga0466967_0165286_224_970 243
227 3300046455 Ga0495603_0065381 Ga0495603_0065381_294_1031 243
228 3300046459 Ga0495629_0008087 Ga0495629_0008087_1497_2234 243
229 3300046461 Ga0495641_0083342 Ga0495641_0083342_648_1379 243
230 3300046462 Ga0495651_0064229 Ga0495651_0064229_932_1669 243
231 3300046473 Ga0495582_0044556 Ga0495582_0044556_1270_2007 243
232 3300046476 Ga0495662_0025636 Ga0495662_0025636_742_1479 243
233 3300046499 Ga0495594_0060671 Ga0495594_0060671_1015_1752 243
234 3300046507 Ga0495606_0172801 Ga0495606_0172801_70_801 243
235 3300046511 Ga0495608_0019585 Ga0495608_0019585_2143_2880 243
236 3300046517 Ga0495630_0387410 Ga0495630_0387410_286_1023 243
237 3300046529 Ga0495652_0297191 Ga0495652_0297191_386_1123 243
238 3300046531 Ga0495665_0123716 Ga0495665_0123716_589_1326 243
239 3300046535 Ga0495586_0217397 Ga0495586_0217397_313_1050 243
240 3300046536 Ga0495587_0053195 Ga0495587_0053195_1201_1938 243
241 3300046543 Ga0495645_0085240 Ga0495645_0085240_191_928 243
242 3300046559 Ga0495667_0054748 Ga0495667_0054748_375_1112 243
243 3300046616 Ga0495668_0135901 Ga0495668_0135901_15_773 243
244 3300046616 Ga0495668_0283385 Ga0495668_0283385_73_843 243
245 3300046665 Ga0495661_0078752 Ga0495661_0078752_1025_1783 243
246 3300046674 Ga0495588_0087720 Ga0495588_0087720_861_1598 243
247 3300046678 Ga0495599_0044072 Ga0495599_0044072_943_1680 243
248 3300046680 Ga0495646_0151090 Ga0495646_0151090_530_1267 243
249 3300046689 Ga0495613_0363037 Ga0495613_0363037_97_837 243
250 3300046691 Ga0495670_0227088 Ga0495670_0227088_94_939 243
251 3300046809 Ga0495600_0035767 Ga0495600_0035767_928_1665 243
252 3300047315 Ga0495581_0394476 Ga0495581_0394476_53_793 243
253 3300047319 Ga0495674_0205527 Ga0495674_0205527_611_1348 243
254 3300047321 Ga0495676_0120076 Ga0495676_0120076_212_949 243
255 3300047322 Ga0495680_0057346 Ga0495680_0057346_2213_2944 243
256 3300047673 Ga0495593_0152501 Ga0495593_0152501_244_981 243
257 3300048904 Ga0496101_0119057 Ga0496101_0119057_74_805 243
258 3300048905 Ga0496102_0082922 Ga0496102_0082922_811_1566 243
259 3300048906 Ga0496103_0050700 Ga0496103_0050700_1049_1780 243
260 3300048906 Ga0496103_0244947 Ga0496103_0244947_371_1126 243
261 3300048907 Ga0496104_0500559 Ga0496104_0500559_122_862 243
262 3300048908 Ga0496105_0377993 Ga0496105_0377993_216_956 243
263 3300048909 Ga0496106_0400874 Ga0496106_0400874_18_773 243
264 3300048909 Ga0496106_0508891 Ga0496106_0508891_109_852 243
265 3300048909 Ga0496106_0531744 Ga0496106_0531744_125_856 243
266 3300048910 Ga0496107_0090006 Ga0496107_0090006_173_913 243
267 3300048911 Ga0496108_0000113 Ga0496108_0000113_32472_33203 243
268 3300048911 Ga0496108_0114110 Ga0496108_0114110_1224_1964 243
269 3300048912 Ga0496109_0088212 Ga0496109_0088212_34_774 243
270 3300048914 Ga0496111_0136972 Ga0496111_0136972_804_1544 243
271 3300048915 Ga0496112_0012981 Ga0496112_0012981_5931_6671 243
272 3300048915 Ga0496112_0238521 Ga0496112_0238521_828_1568 243
273 3300048917 Ga0496114_0212400 Ga0496114_0212400_115_846 243
274 3300048917 Ga0496114_0287737 Ga0496114_0287737_302_1057 243
275 3300048917 Ga0496114_0683662 Ga0496114_0683662_76_816 243
276 3300048918 Ga0496115_0034251 Ga0496115_0034251_3256_3996 243
277 3300049568 Ga0501031_0107979 Ga0501031_0107979_898_1629 243
278 3300049569 Ga0501032_0102188 Ga0501032_0102188_731_1462 243
279 3300049571 Ga0501034_0163866 Ga0501034_0163866_982_1722 243
280 3300049571 Ga0501034_0343573 Ga0501034_0343573_235_966 243
281 3300049572 Ga0501036_0084876 Ga0501036_0084876_1089_1820 243
282 3300049572 Ga0501036_0503546 Ga0501036_0503546_130_861 243
283 3300049573 Ga0501037_0004319 Ga0501037_0004319_9407_10138 243
284 3300049573 Ga0501037_0182978 Ga0501037_0182978_389_1120 243
285 3300049574 Ga0501038_0117966 Ga0501038_0117966_351_1082 243
286 3300049574 Ga0501038_0167703 Ga0501038_0167703_865_1596 243
287 3300049575 Ga0501039_0103056 Ga0501039_0103056_170_901 243
288 3300049576 Ga0501040_0057689 Ga0501040_0057689_153_884 243
289 3300049576 Ga0501040_0089588 Ga0501040_0089588_415_1146 243
290 3300049577 Ga0501041_0035401 Ga0501041_0035401_1305_2036 243
291 3300049578 Ga0501042_0231609 Ga0501042_0231609_187_918 243
292 3300049579 Ga0501043_0204300 Ga0501043_0204300_393_1124 243
293 3300049581 Ga0501047_0002351 Ga0501047_0002351_5998_6729 243
294 3300049581 Ga0501047_0010811 Ga0501047_0010811_1776_2507 243
295 3300049581 Ga0501047_0029373 Ga0501047_0029373_4098_4838 243
296 3300049582 Ga0501048_0071586 Ga0501048_0071586_528_1259 243
297 3300049582 Ga0501048_0261848 Ga0501048_0261848_147_878 243
298 3300049583 Ga0501067_0026769 Ga0501067_0026769_1611_2342 243
299 3300049584 Ga0501068_0003400 Ga0501068_0003400_1322_2053 243
300 3300049585 Ga0501069_0198749 Ga0501069_0198749_128_859 243
301 3300049585 Ga0501069_0254584 Ga0501069_0254584_20_751 243
302 3300049586 Ga0501070_0001898 Ga0501070_0001898_9300_10031 243
303 3300049587 Ga0501071_0008105 Ga0501071_0008105_782_1513 243
304 3300049587 Ga0501071_0058103 Ga0501071_0058103_1680_2411 243
305 3300049588 Ga0501072_0035419 Ga0501072_0035419_3044_3775 243
306 3300049590 Ga0501074_0021872 Ga0501074_0021872_869_1600 243
307 3300049592 Ga0501076_0399857 Ga0501076_0399857_322_1053 243
308 3300049741 Ga0501079_0037889 Ga0501079_0037889_1674_2405 243
309 3300049742 Ga0501080_0143711 Ga0501080_0143711_20_751 243
310 3300049744 Ga0501083_0007143 Ga0501083_0007143_6253_6984 243
311 3300049822 Ga0501035_0009930 Ga0501035_0009930_1989_2720 243
312 3300049823 Ga0501044_0002645 Ga0501044_0002645_322_1053 243
313 3300049823 Ga0501044_0141906 Ga0501044_0141906_781_1512 243
314 3300049824 Ga0501045_0332063 Ga0501045_0332063_225_956 243
315 3300050507 nmdc:mga05p37_659814_c1 nmdc:mga05p37_659814_c1_113_880 243
316 3300050507 nmdc:mga05p37_89430_c1 nmdc:mga05p37_89430_c1_869_1600 243
317 3300050508 nmdc:mga09592_25442_c1 nmdc:mga09592_25442_c1_3939_4670 243
318 3300050508 nmdc:mga09592_307244_c1 nmdc:mga09592_307244_c1_113_880 243
319 3300050509 nmdc:mga0qj67_60791_c1 nmdc:mga0qj67_60791_c1_1682_2449 243
320 3300050511 nmdc:mga08y16_169606_c1 nmdc:mga08y16_169606_c1_12_758 243
321 3300050511 nmdc:mga08y16_7002_c1 nmdc:mga08y16_7002_c1_9819_10610 243
322 3300053078 Ga0495612_0080349 Ga0495612_0080349_531_1268 243
323 3300053084 Ga0495595_0067755 Ga0495595_0067755_538_1278 243
324 3300053085 Ga0495619_0215597 Ga0495619_0215597_453_1190 243
325 3300053093 Ga0500651_0111141 Ga0500651_0111141_510_1250 243
326 3300053139 Ga0500568_0002126 Ga0500568_0002126_6063_6815 243
327 3300060353 Ga0501082_0204328 Ga0501082_0204328_931_1662 243
328 3300060353 Ga0501082_0637256 Ga0501082_0637256_104_916 243
329 3300061734 Ga0530510_0082648 Ga0530510_0082648_520_1251 243
330 iso_pu_bacteria 2517093001 2517108341 243
331 iso_pu_bacteria 2996221748 2996225960 243
332 3300002704 JGI25155J39150_1000061 JGI25155J39150_100006154 244
333 3300002705 JGI25156J39149_1000122 JGI25156J39149_100012226 244
334 3300002737 JGI25162J39368_1000481 JGI25162J39368_10004816 244
335 3300002738 JGI25154J39366_1000132 JGI25154J39366_100013237 244
336 3300002741 JGI25157J39369_1000106 JGI25157J39369_100010654 244
337 3300003187 JGI25151J46595_10001671 JGI25151J46595_100016719 244
338 3300003215 JGI25153J46596_10007996 JGI25153J46596_100079966 244
339 3300003354 JGI25160J50197_1005187 JGI25160J50197_10051877 244
340 3300003771 Ga0055526_1008562 Ga0055526_10085622 244
341 3300003775 Ga0055524_1003462 Ga0055524_10034626 244
342 3300003790 Ga0055528_1009329 Ga0055528_10093296 244
343 3300004625 Ga0055543_1001273 Ga0055543_10012737 244
344 3300005262 Ga0065165_1013147 Ga0065165_10131472 244
345 3300005339 Ga0070660_100654853 Ga0070660_1006548531 244
346 3300005435 Ga0070714_100669580 Ga0070714_1006695802 244
347 3300005466 Ga0070685_10071785 Ga0070685_100717853 244
348 3300005530 Ga0070679_100736306 Ga0070679_1007363061 244
349 3300005545 Ga0070695_100024276 Ga0070695_1000242765 244
350 3300005577 Ga0068857_100412094 Ga0068857_1004120942 244
351 3300005614 Ga0068856_100278900 Ga0068856_1002789002 244
352 3300005618 Ga0068864_100072416 Ga0068864_1000724162 244
353 3300005937 Ga0081455_10000122 Ga0081455_1000012227 244
354 3300005937 Ga0081455_10003424 Ga0081455_1000342410 244
355 3300005981 Ga0081538_10022987 Ga0081538_100229872 244
356 3300005983 Ga0081540_1065098 Ga0081540_10650982 244
357 3300006042 Ga0075368_10014604 Ga0075368_100146045 244
358 3300006048 Ga0075363_100403132 Ga0075363_1004031321 244
359 3300006177 Ga0075362_10040214 Ga0075362_100402142 244
360 3300006186 Ga0075369_10014082 Ga0075369_100140821 244
361 3300006353 Ga0075370_10003802 Ga0075370_100038028 244
362 3300006844 Ga0075428_100005363 Ga0075428_1000053636 244
363 3300006844 Ga0075428_100041973 Ga0075428_1000419734 244
364 3300006844 Ga0075428_100173087 Ga0075428_1001730872 244
365 3300006846 Ga0075430_100005225 Ga0075430_1000052258 244
366 3300006846 Ga0075430_100014770 Ga0075430_1000147701 244
367 3300006846 Ga0075430_100039283 Ga0075430_1000392833 244
368 3300006847 Ga0075431_100000020 Ga0075431_10000002061 244
369 3300006847 Ga0075431_100008347 Ga0075431_1000083476 244
370 3300006847 Ga0075431_100009543 Ga0075431_1000095436 244
371 3300006847 Ga0075431_100016504 Ga0075431_1000165045 244
372 3300006852 Ga0075433_10079926 Ga0075433_100799264 244
373 3300006871 Ga0075434_100059687 Ga0075434_1000596875 244
374 3300006871 Ga0075434_100076654 Ga0075434_1000766542 244
375 3300006880 Ga0075429_100006187 Ga0075429_1000061876 244
376 3300009147 Ga0114129_10000804 Ga0114129_1000080437 244
377 3300009147 Ga0114129_10079084 Ga0114129_100790844 244
378 3300009177 Ga0105248_10136877 Ga0105248_101368771 244
379 3300009766 Ga0123342_1016896 Ga0123342_10168969 244
380 3300012513 Ga0157326_1013789 Ga0157326_10137891 244
381 3300014325 Ga0163163_10013192 Ga0163163_100131922 244
382 3300014745 Ga0157377_10364094 Ga0157377_103640942 244
383 3300025206 Ga0209435_100081 Ga0209435_10008133 244
384 3300025233 Ga0209437_100023 Ga0209437_10002327 244
385 3300025245 Ga0207425_1003651 Ga0207425_10036515 244
386 3300025246 Ga0209646_1000064 Ga0209646_1000064234 244
387 3300025250 Ga0209026_1000053 Ga0209026_1000053234 244
388 3300025256 Ga0209759_1000042 Ga0209759_1000042234 244
389 3300025258 Ga0209129_1002199 Ga0209129_10021994 244
390 3300025261 Ga0209233_1000219 Ga0209233_100021927 244
391 3300025273 Ga0209673_1000632 Ga0209673_10006328 244
392 3300025273 Ga0209673_1000922 Ga0209673_100092215 244
393 3300025292 Ga0209676_1023934 Ga0209676_10239343 244
394 3300025294 Ga0209025_1000082 Ga0209025_100008245 244
395 3300025295 Ga0209564_1000128 Ga0209564_100012846 244
396 3300025297 Ga0209758_1001112 Ga0209758_100111232 244
397 3300025299 Ga0209256_1000564 Ga0209256_100056456 244
398 3300025302 Ga0207426_1000228 Ga0207426_10002288 244
399 3300025303 Ga0209051_1010691 Ga0209051_10106913 244
400 3300025915 Ga0207693_10078434 Ga0207693_100784343 244
401 3300025929 Ga0207664_10238552 Ga0207664_102385522 244
402 3300025941 Ga0207711_10046920 Ga0207711_100469202 244
403 3300026078 Ga0207702_10285107 Ga0207702_102851072 244
404 3300026095 Ga0207676_10046229 Ga0207676_100462292 244
405 3300026116 Ga0207674_10139195 Ga0207674_101391952 244
406 3300026118 Ga0207675_100017680 Ga0207675_1000176805 244
407 3300031731 Ga0307405_10004043 Ga0307405_100040434 244
408 3300031731 Ga0307405_10043399 Ga0307405_100433993 244
409 3300031824 Ga0307413_10005895 Ga0307413_100058954 244
410 3300031824 Ga0307413_10027571 Ga0307413_100275711 244
411 3300031852 Ga0307410_10017834 Ga0307410_100178343 244
412 3300031852 Ga0307410_10206287 Ga0307410_102062872 244
413 3300031901 Ga0307406_10001235 Ga0307406_100012359 244
414 3300031901 Ga0307406_10053531 Ga0307406_100535311 244
415 3300031995 Ga0307409_100001305 Ga0307409_10000130510 244
416 3300031995 Ga0307409_100072959 Ga0307409_1000729595 244
417 3300032002 Ga0307416_100001906 Ga0307416_1000019069 244
418 3300032002 Ga0307416_100033950 Ga0307416_1000339504 244
419 3300032002 Ga0307416_100359826 Ga0307416_1003598262 244
420 3300032005 Ga0307411_10153205 Ga0307411_101532052 244
421 3300032126 Ga0307415_100001344 Ga0307415_10000134416 244
422 3300032126 Ga0307415_100498498 Ga0307415_1004984981 244
423 3300032126 Ga0307415_100568730 Ga0307415_1005687301 244
424 3300033180 Ga0307510_10334937 Ga0307510_103349371 244
425 3300034820 Ga0373959_0005071 Ga0373959_0005071_1124_1867 244
426 3300034957 Ga0373938_0007226 Ga0373938_0007226_563_1306 244
427 3300035088 Ga0373940_0044750 Ga0373940_0044750_159_902 244
428 3300035090 Ga0373949_0060406 Ga0373949_0060406_27_770 244
429 3300035091 Ga0373951_0019768 Ga0373951_0019768_463_1206 244
430 3300035112 Ga0373932_0006030 Ga0373932_0006030_1233_1976 244
431 3300035121 Ga0373960_0045801 Ga0373960_0045801_33_776 244
432 3300035171 Ga0373946_0062104 Ga0373946_0062104_711_1472 244
433 3300035207 Ga0373942_0000355 Ga0373942_0000355_9486_10229 244
434 3300035241 Ga0373961_0100620 Ga0373961_0100620_43_786 244
435 3300035725 Ga0373947_0067873 Ga0373947_0067873_451_1212 244
436 3300037068 Ga0373925_0239233 Ga0373925_0239233_295_1056 244
437 3300037068 Ga0373925_0266491 Ga0373925_0266491_227_970 244
438 3300037466 Ga0395898_0015769 Ga0395898_0015769_6165_6908 244
439 3300037853 Ga0436364_1308164 Ga0436364_1308164_142_876 244
440 3300038443 Ga0395901_0017821 Ga0395901_0017821_2832_3575 244
441 3300039437 Ga0436365_0410704 Ga0436365_0410704_1024_1767 244
442 3300039437 Ga0436365_0672215 Ga0436365_0672215_1205_1948 244
443 3300039437 Ga0436365_0871751 Ga0436365_0871751_603_1346 244
444 3300039437 Ga0436365_0962686 Ga0436365_0962686_137_964 244
445 3300041999 Ga0439433_0021504 Ga0439433_0021504_143_886 244
446 3300044694 Ga0466963_0055640 Ga0466963_0055640_1508_2242 244
447 3300044765 Ga0466970_0003775 Ga0466970_0003775_1161_1895 244
448 3300045049 Ga0466959_0019857 Ga0466959_0019857_3865_4605 244
449 3300046460 Ga0495638_0004573 Ga0495638_0004573_1270_2013 244
450 3300046501 Ga0495607_0094383 Ga0495607_0094383_671_1405 244
451 3300046522 Ga0495643_0188110 Ga0495643_0188110_208_942 244
452 3300047471 Ga0495684_0256648 Ga0495684_0256648_172_933 244
453 3300047673 Ga0495593_0166797 Ga0495593_0166797_20_781 244
454 3300048904 Ga0496101_0066766 Ga0496101_0066766_1845_2579 244
455 3300048905 Ga0496102_0432496 Ga0496102_0432496_210_944 244
456 3300048907 Ga0496104_0173975 Ga0496104_0173975_704_1438 244
457 3300048908 Ga0496105_0061875 Ga0496105_0061875_761_1546 244
458 3300048909 Ga0496106_0161341 Ga0496106_0161341_715_1449 244
459 3300048911 Ga0496108_0043171 Ga0496108_0043171_2200_2985 244
460 3300048911 Ga0496108_0273776 Ga0496108_0273776_648_1382 244
461 3300048912 Ga0496109_0012395 Ga0496109_0012395_731_1516 244
462 3300048912 Ga0496109_0055258 Ga0496109_0055258_364_1098 244
463 3300048914 Ga0496111_0045334 Ga0496111_0045334_649_1434 244
464 3300048915 Ga0496112_0062242 Ga0496112_0062242_1225_2010 244
465 3300048915 Ga0496112_0632748 Ga0496112_0632748_100_834 244
466 3300048916 Ga0496113_0000366 Ga0496113_0000366_18391_19176 244
467 3300048918 Ga0496115_0013701 Ga0496115_0013701_1670_2404 244
468 3300048919 Ga0496116_0258653 Ga0496116_0258653_27_761 244
469 3300049592 Ga0501076_0145081 Ga0501076_0145081_395_1129 244
470 3300049824 Ga0501045_0540169 Ga0501045_0540169_63_797 244
471 3300050489 nmdc:mga03683_23931_c1 nmdc:mga03683_23931_c1_721_1455 244
472 3300050490 nmdc:mga03n38_326290_c1 nmdc:mga03n38_326290_c1_32_766 244
473 3300050495 nmdc:mga04h51_6132_c1 nmdc:mga04h51_6132_c1_1730_2464 244
474 3300050496 nmdc:mga07m45_26648_c1 nmdc:mga07m45_26648_c1_911_1645 244
475 3300050507 nmdc:mga05p37_15521_c1 nmdc:mga05p37_15521_c1_512_1291 244
476 3300050507 nmdc:mga05p37_481_c1 nmdc:mga05p37_481_c1_26422_27165 244
477 3300050507 nmdc:mga05p37_52911_c1 nmdc:mga05p37_52911_c1_1058_1801 244
478 3300050507 nmdc:mga05p37_7764_c1 nmdc:mga05p37_7764_c1_7646_8380 244
479 3300050508 nmdc:mga09592_1486_c1 nmdc:mga09592_1486_c1_17319_18062 244
480 3300050508 nmdc:mga09592_18531_c1 nmdc:mga09592_18531_c1_583_1362 244
481 3300050508 nmdc:mga09592_76809_c1 nmdc:mga09592_76809_c1_1897_2640 244
482 3300050508 nmdc:mga09592_790_c1 nmdc:mga09592_790_c1_21875_22609 244
483 3300050509 nmdc:mga0qj67_13824_c1 nmdc:mga0qj67_13824_c1_2948_3682 244
484 3300050509 nmdc:mga0qj67_18090_c1 nmdc:mga0qj67_18090_c1_4136_4936 244
485 3300050509 nmdc:mga0qj67_24283_c1 nmdc:mga0qj67_24283_c1_1638_2381 244
486 3300050509 nmdc:mga0qj67_4547_c1 nmdc:mga0qj67_4547_c1_5043_5777 244
487 3300050510 nmdc:mga06r32_10652_c1 nmdc:mga06r32_10652_c1_5649_6383 244
488 3300050510 nmdc:mga06r32_32_c1 nmdc:mga06r32_32_c1_34247_34990 244
489 3300050510 nmdc:mga06r32_92816_c1 nmdc:mga06r32_92816_c1_1029_1772 244
490 3300050512 nmdc:mga0n895_16745_c1 nmdc:mga0n895_16745_c1_4752_5495 244
491 3300050515 nmdc:mga0a205_9218_c1 nmdc:mga0a205_9218_c1_3915_4658 244
492 3300053084 Ga0495595_0208110 Ga0495595_0208110_171_932 244
493 3300053090 Ga0500646_0000287 Ga0500646_0000287_12418_13161 244
494 3300053149 Ga0500600_0120797 Ga0500600_0120797_195_929 244
495 3300053153 Ga0500616_0002369 Ga0500616_0002369_14029_14787 244
496 3300059424 Ga0590075_047133 Ga0590075_047133_217_960 244
497 3300061734 Ga0530510_0341537 Ga0530510_0341537_31_765 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

53

274

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bv3-assembly2.cif.gz_C yeast scavenger decapping enzyme in complex with m7gdp 0.7716 11 45
6trq-assembly2.cif.gz_D s.c. scavenger decapping enzyme dcps in complex with the capped rna dinucleotide m7g-gu 0.7714 11 45
5bv3-assembly1.cif.gz_B yeast scavenger decapping enzyme in complex with m7gdp 0.7698 11 45
5bv3-assembly1.cif.gz_A yeast scavenger decapping enzyme in complex with m7gdp 0.7664 11 45
5h3x-assembly1.cif.gz_A the structure of the n-terminal of the fibronectin/fibrinogen-binding protein from streptococcus suis (fbps) 0.7344 12 42
ID Description Score Start End Superfamily
5bv3C01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Scavenger mRNA decapping enzyme, N-terminal domain 0.7716 11 45 3.30.200.40
af_E7FEY1_207_349_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7609 10 40 3.30.200.20
2ppqA01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7443 13 87 3.30.200.20
af_A0A1D6L995_64_160_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7406 11 65 3.30.200.20
2q83B01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.74 3 88 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A3S3LRW4-F1-model_v4 Aminoglycoside phosphotransferase 0.9982 90 244 GO:0016740
AF-A0A7W6YPP2-F1-model_v4 deleted 0.996 56 244
AF-A0A829XYT2-F1-model_v4 deleted 0.9949 1 244
AF-A0A1C5J9L4-F1-model_v4 Ser/Thr protein kinase RdoA involved in Cpx stress response, MazF antagonist 0.9947 2 244 GO:0016301
AF-A0A7W1E3K7-F1-model_v4 Phosphotransferase 0.9943 1 244 GO:0016740

Feature Viewer

pLDDT pTM Quality
94.76 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map