F455088
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 497 | 338 | 466 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300046691|Ga0495670_0227088|Ga0495670_0227088_94_939 |
| Length | 281 |
| Sequence | MGTNDEPCHHCEINEVVHRYNDGASHASDVRNSAKMSPVGWEALGQWGEDVARIEPLAGGVANDVWSVRVNGHLAVGRLGARSDADLAWETELLQHLDREGLTVPVPIPTTDGRLFADGLVVMTYVEGGPPETEADWRRVADTLRQLHRLTQGWPQRPGWRSSTDLLIAETGTKIDLGVMPAEGVARCRAAWARLTGRQRCVVHGDPNPANIRMTVDRVALIDWDESHVDVPDLDLVLPHNAASLDDGAHDIAAQAWAAWEAAVCWDDEHAVKRLAEVRAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 2 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 3 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 4 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 5 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 6 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 7 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 8 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 9 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 10 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 11 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 12 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 13 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 14 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 15 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 16 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 17 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 18 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 19 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 20 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 21 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 22 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 23 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 24 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 25 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 26 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 27 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 28 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 29 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 30 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 31 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 32 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 33 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 34 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 35 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 36 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 98 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 113 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 114 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 157 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 158 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 159 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 163 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 165 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 177 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 178 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 179 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 180 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 181 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 182 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 195 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 203 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 204 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 209 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 210 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 211 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 212 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 213 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 214 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 215 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 216 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 218 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 219 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 220 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 221 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 222 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 223 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 224 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 225 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 226 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 227 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 228 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 229 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 230 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 231 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 232 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 233 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 234 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 282 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 283 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 284 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 285 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 313 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 314 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 315 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 316 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 327 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 328 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 329 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 330 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 331 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 332 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 334 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 335 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 336 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 337 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 338 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.55 |
| Metatranscriptomes | 0.4 |
| Isolates | 6.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.66 |
| Nodule | 4.23 |
| Rhizoplane | 7.04 |
| Rhizosphere | 71.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000061 | 3300002704 | Bacteria | 71144 |
| 2 | JGI25156J39149_1000122 | 3300002705 | Bacteria | 56600 |
| 3 | JGI25162J39368_1000481 | 3300002737 | Bacteria | 30539 |
| 4 | JGI25154J39366_1000132 | 3300002738 | Bacteria | 58454 |
| 5 | JGI25157J39369_1000106 | 3300002741 | Bacteria | 71144 |
| 6 | JGI25151J46595_10001406 | 3300003187 | Bacteria | 16505 |
| 7 | JGI25151J46595_10001671 | 3300003187 | Bacteria | 14534 |
| 8 | JGI25165J46597_1002418 | 3300003214 | Bacteria | 6074 |
| 9 | JGI25153J46596_10007996 | 3300003215 | Bacteria | 5116 |
| 10 | rootH2_10015505 | 3300003320 | Bacteria | 11045 |
| 11 | JGI25160J50197_1005187 | 3300003354 | Bacteria | 5467 |
| 12 | JGI25160J50197_1010974 | 3300003354 | Bacteria | 3243 |
| 13 | JGI25407J50210_10012174 | 3300003373 | Bacteria | 2203 |
| 14 | JGI25407J50210_10059661 | 3300003373 | Bacteria | 960 |
| 15 | Ga0055526_1008562 | 3300003771 | Bacteria | 5075 |
| 16 | Ga0055524_1003462 | 3300003775 | Bacteria | 7656 |
| 17 | Ga0055528_1009329 | 3300003790 | Bacteria | 4107 |
| 18 | Ga0055543_1001273 | 3300004625 | Bacteria | 10385 |
| 19 | Ga0065165_1013147 | 3300005262 | Bacteria | 3311 |
| 20 | Ga0065165_1045387 | 3300005262 | Bacteria | 1280 |
| 21 | Ga0070666_10000249 | 3300005335 | Bacteria | 35973 |
| 22 | Ga0070682_100117776 | 3300005337 | Bacteria | 1779 |
| 23 | Ga0070660_100468560 | 3300005339 | Bacteria | 1046 |
| 24 | Ga0070660_100654853 | 3300005339 | Bacteria | 880 |
| 25 | Ga0070689_100631105 | 3300005340 | Bacteria | 930 |
| 26 | Ga0070661_100070111 | 3300005344 | Bacteria | 2578 |
| 27 | Ga0070692_10042551 | 3300005345 | Bacteria | 2333 |
| 28 | Ga0070668_100002810 | 3300005347 | Bacteria | 12814 |
| 29 | Ga0070669_100126084 | 3300005353 | Bacteria | 1959 |
| 30 | Ga0070675_100073492 | 3300005354 | Bacteria | 2839 |
| 31 | Ga0070674_100066303 | 3300005356 | Bacteria | 2536 |
| 32 | Ga0070674_100396142 | 3300005356 | Bacteria | 1127 |
| 33 | Ga0070673_100030242 | 3300005364 | Bacteria | 4049 |
| 34 | Ga0070709_10337775 | 3300005434 | Bacteria | 1110 |
| 35 | Ga0070714_100669580 | 3300005435 | Bacteria | 1000 |
| 36 | Ga0070663_100077351 | 3300005455 | Bacteria | 2435 |
| 37 | Ga0070678_100120250 | 3300005456 | Bacteria | 2070 |
| 38 | Ga0070662_100007024 | 3300005457 | Bacteria | 7282 |
| 39 | Ga0068867_100275364 | 3300005459 | Bacteria | 1378 |
| 40 | Ga0070685_10019858 | 3300005466 | Bacteria | 3630 |
| 41 | Ga0070685_10071785 | 3300005466 | Bacteria | 2053 |
| 42 | Ga0070679_100736306 | 3300005530 | Bacteria | 929 |
| 43 | Ga0070684_100034062 | 3300005535 | Bacteria | 4353 |
| 44 | Ga0070684_100251151 | 3300005535 | Bacteria | 1616 |
| 45 | Ga0070695_100024276 | 3300005545 | Bacteria | 3733 |
| 46 | Ga0070665_100442041 | 3300005548 | Bacteria | 1310 |
| 47 | Ga0070665_100488874 | 3300005548 | Bacteria | 1242 |
| 48 | Ga0068857_100412094 | 3300005577 | Bacteria | 1259 |
| 49 | Ga0068854_100228748 | 3300005578 | Bacteria | 1475 |
| 50 | Ga0068856_100278900 | 3300005614 | Bacteria | 1688 |
| 51 | Ga0068852_100329572 | 3300005616 | Bacteria | 1485 |
| 52 | Ga0068864_100072416 | 3300005618 | Bacteria | 3003 |
| 53 | Ga0068861_100223597 | 3300005719 | Bacteria | 1592 |
| 54 | Ga0068863_100026556 | 3300005841 | Bacteria | 5522 |
| 55 | Ga0068858_100657356 | 3300005842 | Bacteria | 1019 |
| 56 | Ga0068860_100108377 | 3300005843 | Bacteria | 2655 |
| 57 | Ga0068860_100477319 | 3300005843 | Bacteria | 1242 |
| 58 | Ga0068860_100477790 | 3300005843 | Bacteria | 1242 |
| 59 | Ga0081455_10000122 | 3300005937 | Bacteria | 89500 |
| 60 | Ga0081455_10003424 | 3300005937 | Bacteria | 18238 |
| 61 | Ga0081455_10105726 | 3300005937 | Bacteria | 2249 |
| 62 | Ga0081538_10022987 | 3300005981 | Bacteria | 4495 |
| 63 | Ga0081538_10026994 | 3300005981 | Bacteria | 3994 |
| 64 | Ga0081538_10031505 | 3300005981 | Bacteria | 3575 |
| 65 | Ga0081540_1004395 | 3300005983 | Bacteria | 10775 |
| 66 | Ga0081540_1065098 | 3300005983 | Bacteria | 1716 |
| 67 | Ga0081539_10006939 | 3300005985 | Bacteria | 10533 |
| 68 | Ga0081539_10011776 | 3300005985 | Bacteria | 6854 |
| 69 | Ga0081539_10049227 | 3300005985 | Bacteria | 2393 |
| 70 | Ga0081539_10059376 | 3300005985 | Bacteria | 2105 |
| 71 | Ga0075368_10014604 | 3300006042 | Bacteria | 2903 |
| 72 | Ga0075363_100403132 | 3300006048 | Bacteria | 804 |
| 73 | Ga0075362_10040214 | 3300006177 | Bacteria | 2058 |
| 74 | Ga0075369_10014082 | 3300006186 | Bacteria | 3189 |
| 75 | Ga0075370_10003802 | 3300006353 | Bacteria | 7224 |
| 76 | Ga0075370_10276060 | 3300006353 | Bacteria | 998 |
| 77 | Ga0075428_100005363 | 3300006844 | Bacteria | 14252 |
| 78 | Ga0075428_100041973 | 3300006844 | Bacteria | 5030 |
| 79 | Ga0075428_100094031 | 3300006844 | Bacteria | 3268 |
| 80 | Ga0075428_100173087 | 3300006844 | Bacteria | 2339 |
| 81 | Ga0075430_100005225 | 3300006846 | Bacteria | 10945 |
| 82 | Ga0075430_100014770 | 3300006846 | Bacteria | 6650 |
| 83 | Ga0075430_100039283 | 3300006846 | Bacteria | 4007 |
| 84 | Ga0075431_100000020 | 3300006847 | Bacteria | 82958 |
| 85 | Ga0075431_100008347 | 3300006847 | Bacteria | 10363 |
| 86 | Ga0075431_100009543 | 3300006847 | Bacteria | 9745 |
| 87 | Ga0075431_100016504 | 3300006847 | Bacteria | 7495 |
| 88 | Ga0075431_100545168 | 3300006847 | Bacteria | 1148 |
| 89 | Ga0075433_10011812 | 3300006852 | Bacteria | 7034 |
| 90 | Ga0075433_10079926 | 3300006852 | Bacteria | 2881 |
| 91 | Ga0075434_100059687 | 3300006871 | Bacteria | 3792 |
| 92 | Ga0075434_100076654 | 3300006871 | Bacteria | 3338 |
| 93 | Ga0075429_100006187 | 3300006880 | Bacteria | 10350 |
| 94 | Ga0075429_100126699 | 3300006880 | Bacteria | 2233 |
| 95 | Ga0075429_100529210 | 3300006880 | Bacteria | 1033 |
| 96 | Ga0097620_100401473 | 3300006931 | Bacteria | 1467 |
| 97 | Ga0111539_10014481 | 3300009094 | Bacteria | 9845 |
| 98 | Ga0111539_10054709 | 3300009094 | Bacteria | 4747 |
| 99 | Ga0105245_10590525 | 3300009098 | Bacteria | 1136 |
| 100 | Ga0105247_10346467 | 3300009101 | Bacteria | 1044 |
| 101 | Ga0114129_10000804 | 3300009147 | Bacteria | 40281 |
| 102 | Ga0114129_10079084 | 3300009147 | Bacteria | 4572 |
| 103 | Ga0114129_10268506 | 3300009147 | Bacteria | 2283 |
| 104 | Ga0105248_10136877 | 3300009177 | Bacteria | 2763 |
| 105 | Ga0105248_10284340 | 3300009177 | Bacteria | 1862 |
| 106 | Ga0105238_10000564 | 3300009551 | Bacteria | 38884 |
| 107 | Ga0105249_10017384 | 3300009553 | Bacteria | 6385 |
| 108 | Ga0105249_10888123 | 3300009553 | Bacteria | 958 |
| 109 | Ga0123342_1016896 | 3300009766 | Bacteria | 6220 |
| 110 | Ga0105239_10080599 | 3300010375 | Bacteria | 3582 |
| 111 | Ga0157329_1003126 | 3300012491 | Bacteria | 994 |
| 112 | Ga0157326_1013789 | 3300012513 | Bacteria | 935 |
| 113 | Ga0157370_10069573 | 3300013104 | Bacteria | 3324 |
| 114 | Ga0157378_10025800 | 3300013297 | Bacteria | 5177 |
| 115 | Ga0157372_10847127 | 3300013307 | Bacteria | 1061 |
| 116 | Ga0157375_10742851 | 3300013308 | Bacteria | 1133 |
| 117 | Ga0163163_10013192 | 3300014325 | Bacteria | 7552 |
| 118 | Ga0157377_10364094 | 3300014745 | Bacteria | 974 |
| 119 | Ga0206356_10227172 | 3300020070 | Bacteria | 948 |
| 120 | Ga0206356_10387185 | 3300020070 | Bacteria | 1064 |
| 121 | Ga0213876_10000024 | 3300021384 | Bacteria | 237488 |
| 122 | Ga0213876_10000365 | 3300021384 | Bacteria | 38608 |
| 123 | Ga0213876_10001840 | 3300021384 | Bacteria | 12779 |
| 124 | Ga0213876_10019216 | 3300021384 | Bacteria | 3608 |
| 125 | Ga0209435_100081 | 3300025206 | Bacteria | 47006 |
| 126 | Ga0207427_104375 | 3300025231 | Bacteria | 2406 |
| 127 | Ga0209437_100023 | 3300025233 | Bacteria | 614195 |
| 128 | Ga0207425_1003651 | 3300025245 | Bacteria | 4849 |
| 129 | Ga0209646_1000064 | 3300025246 | Bacteria | 246524 |
| 130 | Ga0209026_1000053 | 3300025250 | Bacteria | 246524 |
| 131 | Ga0209759_1000042 | 3300025256 | Bacteria | 246524 |
| 132 | Ga0209129_1002199 | 3300025258 | Bacteria | 9802 |
| 133 | Ga0209233_1000219 | 3300025261 | Bacteria | 104797 |
| 134 | Ga0209233_1002689 | 3300025261 | Bacteria | 6419 |
| 135 | Ga0209673_1000632 | 3300025273 | Bacteria | 53357 |
| 136 | Ga0209673_1000922 | 3300025273 | Bacteria | 37220 |
| 137 | Ga0209130_1006700 | 3300025284 | Bacteria | 3690 |
| 138 | Ga0209676_1023934 | 3300025292 | Bacteria | 1989 |
| 139 | Ga0209025_1000082 | 3300025294 | Bacteria | 265613 |
| 140 | Ga0209025_1000152 | 3300025294 | Bacteria | 171558 |
| 141 | Ga0209025_1036031 | 3300025294 | Bacteria | 2223 |
| 142 | Ga0209564_1000128 | 3300025295 | Bacteria | 196532 |
| 143 | Ga0209758_1001112 | 3300025297 | Bacteria | 34604 |
| 144 | Ga0209758_1007593 | 3300025297 | Bacteria | 7322 |
| 145 | Ga0209256_1000564 | 3300025299 | Bacteria | 53001 |
| 146 | Ga0207426_1000228 | 3300025302 | Bacteria | 129261 |
| 147 | Ga0207426_1000928 | 3300025302 | Bacteria | 29240 |
| 148 | Ga0209051_1010691 | 3300025303 | Bacteria | 4601 |
| 149 | Ga0207680_10000678 | 3300025903 | Bacteria | 16104 |
| 150 | Ga0207645_10018578 | 3300025907 | Bacteria | 4570 |
| 151 | Ga0207645_10133031 | 3300025907 | Bacteria | 1619 |
| 152 | Ga0207643_10229360 | 3300025908 | Bacteria | 1139 |
| 153 | Ga0207705_10006222 | 3300025909 | Bacteria | 8869 |
| 154 | Ga0207654_10137253 | 3300025911 | Bacteria | 1555 |
| 155 | Ga0207693_10078434 | 3300025915 | Bacteria | 2585 |
| 156 | Ga0207693_10128573 | 3300025915 | Bacteria | 1991 |
| 157 | Ga0207662_10159941 | 3300025918 | Bacteria | 1438 |
| 158 | Ga0207694_10000013 | 3300025924 | Bacteria | 384823 |
| 159 | Ga0207687_10062365 | 3300025927 | Bacteria | 2636 |
| 160 | Ga0207664_10001490 | 3300025929 | Bacteria | 15333 |
| 161 | Ga0207664_10238552 | 3300025929 | Bacteria | 1583 |
| 162 | Ga0207644_10175382 | 3300025931 | Bacteria | 1677 |
| 163 | Ga0207711_10046920 | 3300025941 | Bacteria | 3691 |
| 164 | Ga0207711_10169450 | 3300025941 | Bacteria | 1981 |
| 165 | Ga0207661_10150481 | 3300025944 | Bacteria | 2011 |
| 166 | Ga0207679_10261856 | 3300025945 | Bacteria | 1475 |
| 167 | Ga0207651_10399140 | 3300025960 | Bacteria | 1169 |
| 168 | Ga0207712_10007003 | 3300025961 | Bacteria | 7111 |
| 169 | Ga0207668_10001389 | 3300025972 | Bacteria | 14278 |
| 170 | Ga0207640_10349672 | 3300025981 | Bacteria | 1187 |
| 171 | Ga0207703_10048287 | 3300026035 | Bacteria | 3435 |
| 172 | Ga0207703_10585077 | 3300026035 | Bacteria | 1055 |
| 173 | Ga0207639_10196824 | 3300026041 | Bacteria | 1725 |
| 174 | Ga0207678_10154256 | 3300026067 | Bacteria | 1961 |
| 175 | Ga0207702_10285107 | 3300026078 | Bacteria | 1563 |
| 176 | Ga0207702_10964022 | 3300026078 | Bacteria | 846 |
| 177 | Ga0207676_10046229 | 3300026095 | Bacteria | 3367 |
| 178 | Ga0207676_10452747 | 3300026095 | Bacteria | 1210 |
| 179 | Ga0207674_10035167 | 3300026116 | Bacteria | 5230 |
| 180 | Ga0207674_10139195 | 3300026116 | Bacteria | 2388 |
| 181 | Ga0207675_100011392 | 3300026118 | Bacteria | 8322 |
| 182 | Ga0207675_100017680 | 3300026118 | Bacteria | 6652 |
| 183 | Ga0207698_10265769 | 3300026142 | Bacteria | 1578 |
| 184 | Ga0209974_10107187 | 3300027876 | Bacteria | 981 |
| 185 | Ga0207428_10031980 | 3300027907 | Bacteria | 4333 |
| 186 | Ga0207428_10223677 | 3300027907 | Bacteria | 1410 |
| 187 | Ga0268266_10312453 | 3300028379 | Bacteria | 1469 |
| 188 | Ga0268265_10031095 | 3300028380 | Bacteria | 3853 |
| 189 | Ga0268265_10046914 | 3300028380 | Bacteria | 3233 |
| 190 | Ga0268264_10351445 | 3300028381 | Bacteria | 1403 |
| 191 | Ga0268264_10489095 | 3300028381 | Bacteria | 1198 |
| 192 | Ga0307511_10039338 | 3300030521 | Bacteria | 4043 |
| 193 | Ga0307512_10086845 | 3300030522 | Bacteria | 2207 |
| 194 | Ga0265325_10003829 | 3300031241 | Bacteria | 9683 |
| 195 | Ga0265325_10004490 | 3300031241 | Bacteria | 8804 |
| 196 | Ga0265339_10014452 | 3300031249 | Bacteria | 4756 |
| 197 | Ga0265339_10019330 | 3300031249 | Bacteria | 4002 |
| 198 | Ga0265331_10025302 | 3300031250 | Bacteria | 2998 |
| 199 | Ga0265316_10013588 | 3300031344 | Bacteria | 7224 |
| 200 | Ga0265316_10094631 | 3300031344 | Bacteria | 2276 |
| 201 | Ga0307513_10092470 | 3300031456 | Bacteria | 3079 |
| 202 | Ga0265313_10002553 | 3300031595 | Bacteria | 15556 |
| 203 | Ga0307508_10000370 | 3300031616 | Bacteria | 54530 |
| 204 | Ga0307508_10000419 | 3300031616 | Bacteria | 50420 |
| 205 | Ga0265314_10247210 | 3300031711 | Bacteria | 1026 |
| 206 | Ga0307405_10004043 | 3300031731 | Bacteria | 6886 |
| 207 | Ga0307405_10043399 | 3300031731 | Bacteria | 2743 |
| 208 | Ga0307413_10005895 | 3300031824 | Bacteria | 5532 |
| 209 | Ga0307413_10027571 | 3300031824 | Bacteria | 3149 |
| 210 | Ga0307410_10008166 | 3300031852 | Bacteria | 5788 |
| 211 | Ga0307410_10017834 | 3300031852 | Bacteria | 4273 |
| 212 | Ga0307410_10206287 | 3300031852 | Bacteria | 1504 |
| 213 | Ga0307406_10001235 | 3300031901 | Bacteria | 14320 |
| 214 | Ga0307406_10053531 | 3300031901 | Bacteria | 2571 |
| 215 | Ga0307407_10009187 | 3300031903 | Bacteria | 4589 |
| 216 | Ga0307409_100001305 | 3300031995 | Bacteria | 12090 |
| 217 | Ga0307409_100008093 | 3300031995 | Bacteria | 6349 |
| 218 | Ga0307409_100054455 | 3300031995 | Bacteria | 3081 |
| 219 | Ga0307409_100072959 | 3300031995 | Bacteria | 2735 |
| 220 | Ga0307409_101203074 | 3300031995 | Bacteria | 781 |
| 221 | Ga0307416_100001906 | 3300032002 | Bacteria | 11638 |
| 222 | Ga0307416_100033950 | 3300032002 | Bacteria | 3875 |
| 223 | Ga0307416_100039719 | 3300032002 | Bacteria | 3647 |
| 224 | Ga0307416_100359826 | 3300032002 | Bacteria | 1477 |
| 225 | Ga0307414_10033869 | 3300032004 | Bacteria | 3381 |
| 226 | Ga0307411_10153205 | 3300032005 | Bacteria | 1716 |
| 227 | Ga0307415_100001344 | 3300032126 | Bacteria | 11688 |
| 228 | Ga0307415_100135054 | 3300032126 | Bacteria | 1875 |
| 229 | Ga0307415_100498498 | 3300032126 | Bacteria | 1064 |
| 230 | Ga0307415_100568730 | 3300032126 | Bacteria | 1003 |
| 231 | Ga0307507_10189055 | 3300033179 | Bacteria | 1452 |
| 232 | Ga0307510_10334937 | 3300033180 | Bacteria | 967 |
| 233 | Ga0315911_1000003 | 3300033442 | Bacteria | 502217 |
| 234 | Ga0315911_1000072 | 3300033442 | Bacteria | 15680 |
| 235 | Ga0373959_0000270 | 3300034820 | Bacteria | 11184 |
| 236 | Ga0373959_0005071 | 3300034820 | Bacteria | 2151 |
| 237 | Ga0373938_0007226 | 3300034957 | Bacteria | 1949 |
| 238 | Ga0373926_0104618 | 3300035083 | Bacteria | 1060 |
| 239 | Ga0373934_0014714 | 3300035086 | Bacteria | 2964 |
| 240 | Ga0373940_0044750 | 3300035088 | Bacteria | 1227 |
| 241 | Ga0373944_0003442 | 3300035089 | Bacteria | 4087 |
| 242 | Ga0373949_0057925 | 3300035090 | Bacteria | 991 |
| 243 | Ga0373949_0060406 | 3300035090 | Bacteria | 974 |
| 244 | Ga0373951_0019768 | 3300035091 | Bacteria | 1538 |
| 245 | Ga0373923_0017283 | 3300035111 | Bacteria | 2757 |
| 246 | Ga0373932_0006030 | 3300035112 | Bacteria | 2860 |
| 247 | Ga0373936_0109563 | 3300035113 | Bacteria | 1171 |
| 248 | Ga0373945_0002792 | 3300035116 | Bacteria | 5478 |
| 249 | Ga0373953_0053507 | 3300035117 | Bacteria | 1636 |
| 250 | Ga0373954_0124612 | 3300035118 | Bacteria | 1252 |
| 251 | Ga0373956_0013140 | 3300035119 | Bacteria | 3442 |
| 252 | Ga0373957_0055159 | 3300035120 | Bacteria | 1527 |
| 253 | Ga0373960_0045801 | 3300035121 | Bacteria | 1281 |
| 254 | Ga0373946_0062104 | 3300035171 | Bacteria | 1593 |
| 255 | Ga0373955_0061626 | 3300035172 | Bacteria | 2072 |
| 256 | Ga0373942_0000355 | 3300035207 | Bacteria | 12570 |
| 257 | Ga0373961_0100620 | 3300035241 | Bacteria | 935 |
| 258 | Ga0373924_0080286 | 3300035410 | Bacteria | 1386 |
| 259 | Ga0373935_0229353 | 3300035692 | Bacteria | 1292 |
| 260 | Ga0373933_0205014 | 3300035724 | Bacteria | 1262 |
| 261 | Ga0373947_0028232 | 3300035725 | Bacteria | 3287 |
| 262 | Ga0373947_0067873 | 3300035725 | Bacteria | 2179 |
| 263 | Ga0373937_0103327 | 3300036401 | Bacteria | 2646 |
| 264 | Ga0373925_0141443 | 3300037068 | Bacteria | 1883 |
| 265 | Ga0373925_0239233 | 3300037068 | Bacteria | 1453 |
| 266 | Ga0373925_0266491 | 3300037068 | Bacteria | 1377 |
| 267 | Ga0395899_0083861 | 3300037312 | Bacteria | 2317 |
| 268 | Ga0395900_0031585 | 3300037418 | Bacteria | 5443 |
| 269 | Ga0395900_0064015 | 3300037418 | Bacteria | 3780 |
| 270 | Ga0395898_0015769 | 3300037466 | Bacteria | 7744 |
| 271 | Ga0395898_0040177 | 3300037466 | Bacteria | 4627 |
| 272 | Ga0395905_0013760 | 3300037471 | Bacteria | 7746 |
| 273 | Ga0395905_0144024 | 3300037471 | Bacteria | 2242 |
| 274 | Ga0395905_0507007 | 3300037471 | Bacteria | 1107 |
| 275 | Ga0436364_0069694 | 3300037853 | Bacteria | 2100 |
| 276 | Ga0436364_1308164 | 3300037853 | Bacteria | 895 |
| 277 | Ga0395901_0017821 | 3300038443 | Bacteria | 7247 |
| 278 | Ga0395901_0039590 | 3300038443 | Bacteria | 4878 |
| 279 | Ga0395901_0087402 | 3300038443 | Bacteria | 3259 |
| 280 | Ga0436365_0410704 | 3300039437 | Bacteria | 3557 |
| 281 | Ga0436365_0672215 | 3300039437 | Bacteria | 6822 |
| 282 | Ga0436365_0693142 | 3300039437 | Bacteria | 69863 |
| 283 | Ga0436365_0861406 | 3300039437 | Bacteria | 61112 |
| 284 | Ga0436365_0871751 | 3300039437 | Bacteria | 4193 |
| 285 | Ga0436365_0962686 | 3300039437 | Bacteria | 2024 |
| 286 | Ga0436365_1017987 | 3300039437 | Bacteria | 20964 |
| 287 | Ga0436365_1919465 | 3300039437 | Bacteria | 19290 |
| 288 | Ga0436360_1016574 | 3300039438 | Bacteria | 1612 |
| 289 | Ga0436362_1015986 | 3300039453 | Bacteria | 1530 |
| 290 | Ga0439461_0044394 | 3300041410 | Bacteria | 969 |
| 291 | Ga0451793_0430880 | 3300041452 | Bacteria | 5314 |
| 292 | Ga0439433_0021504 | 3300041999 | Bacteria | 1444 |
| 293 | Ga0439443_009386 | 3300042003 | Bacteria | 1402 |
| 294 | Ga0439450_040650 | 3300042008 | Bacteria | 1078 |
| 295 | Ga0450915_000839 | 3300042119 | Bacteria | 1282 |
| 296 | Ga0450920_035302 | 3300042122 | Bacteria | 990 |
| 297 | Ga0450922_004491 | 3300042124 | Bacteria | 1283 |
| 298 | Ga0450888_004567 | 3300042126 | Bacteria | 1450 |
| 299 | Ga0450898_017735 | 3300042134 | Bacteria | 1227 |
| 300 | Ga0450900_013297 | 3300042136 | Bacteria | 1086 |
| 301 | Ga0450908_030455 | 3300042184 | Bacteria | 938 |
| 302 | Ga0439459_0038569 | 3300042438 | Bacteria | 1005 |
| 303 | Ga0439460_0021724 | 3300042461 | Bacteria | 1756 |
| 304 | Ga0450918_031430 | 3300042531 | Bacteria | 938 |
| 305 | Ga0450893_0029247 | 3300042532 | Bacteria | 977 |
| 306 | Ga0466963_0055640 | 3300044694 | Bacteria | 2631 |
| 307 | Ga0466968_0297175 | 3300044735 | Bacteria | 776 |
| 308 | Ga0466970_0003775 | 3300044765 | Bacteria | 7411 |
| 309 | Ga0466959_0019857 | 3300045049 | Bacteria | 4944 |
| 310 | Ga0466958_0029062 | 3300045836 | Bacteria | 3279 |
| 311 | Ga0466958_0300499 | 3300045836 | Bacteria | 1030 |
| 312 | Ga0466967_0070423 | 3300045976 | Bacteria | 3129 |
| 313 | Ga0466967_0165286 | 3300045976 | Bacteria | 2079 |
| 314 | Ga0495603_0065381 | 3300046455 | Bacteria | 2143 |
| 315 | Ga0495629_0008087 | 3300046459 | Bacteria | 7741 |
| 316 | Ga0495638_0004573 | 3300046460 | Bacteria | 10470 |
| 317 | Ga0495641_0083342 | 3300046461 | Bacteria | 1432 |
| 318 | Ga0495651_0064229 | 3300046462 | Bacteria | 2805 |
| 319 | Ga0495582_0044556 | 3300046473 | Bacteria | 2443 |
| 320 | Ga0495662_0025636 | 3300046476 | Bacteria | 2847 |
| 321 | Ga0495594_0060671 | 3300046499 | Bacteria | 2092 |
| 322 | Ga0495607_0094383 | 3300046501 | Bacteria | 1614 |
| 323 | Ga0495606_0172801 | 3300046507 | Bacteria | 1252 |
| 324 | Ga0495608_0019585 | 3300046511 | Bacteria | 4656 |
| 325 | Ga0495630_0387410 | 3300046517 | Bacteria | 1070 |
| 326 | Ga0495643_0188110 | 3300046522 | Bacteria | 999 |
| 327 | Ga0495652_0297191 | 3300046529 | Bacteria | 1175 |
| 328 | Ga0495665_0123716 | 3300046531 | Bacteria | 1354 |
| 329 | Ga0495586_0217397 | 3300046535 | Bacteria | 1085 |
| 330 | Ga0495587_0053195 | 3300046536 | Bacteria | 2387 |
| 331 | Ga0495645_0085240 | 3300046543 | Bacteria | 2261 |
| 332 | Ga0495667_0054748 | 3300046559 | Bacteria | 2624 |
| 333 | Ga0495668_0135901 | 3300046616 | Bacteria | 1346 |
| 334 | Ga0495668_0283385 | 3300046616 | Bacteria | 908 |
| 335 | Ga0495661_0078752 | 3300046665 | Bacteria | 1906 |
| 336 | Ga0495588_0087720 | 3300046674 | Bacteria | 1628 |
| 337 | Ga0495599_0044072 | 3300046678 | Bacteria | 2798 |
| 338 | Ga0495646_0151090 | 3300046680 | Bacteria | 1291 |
| 339 | Ga0495613_0363037 | 3300046689 | Bacteria | 993 |
| 340 | Ga0495670_0227088 | 3300046691 | Bacteria | 992 |
| 341 | Ga0495600_0035767 | 3300046809 | Bacteria | 3227 |
| 342 | Ga0495581_0394476 | 3300047315 | Bacteria | 807 |
| 343 | Ga0495674_0205527 | 3300047319 | Bacteria | 1632 |
| 344 | Ga0495676_0120076 | 3300047321 | Bacteria | 1913 |
| 345 | Ga0495680_0057346 | 3300047322 | Bacteria | 3012 |
| 346 | Ga0495684_0256648 | 3300047471 | Bacteria | 1270 |
| 347 | Ga0495593_0152501 | 3300047673 | Bacteria | 1168 |
| 348 | Ga0495593_0166797 | 3300047673 | Bacteria | 1111 |
| 349 | Ga0496101_0066766 | 3300048904 | Bacteria | 2625 |
| 350 | Ga0496101_0119057 | 3300048904 | Bacteria | 1995 |
| 351 | Ga0496102_0082922 | 3300048905 | Bacteria | 2957 |
| 352 | Ga0496102_0432496 | 3300048905 | Bacteria | 1236 |
| 353 | Ga0496103_0050700 | 3300048906 | Bacteria | 2568 |
| 354 | Ga0496103_0244947 | 3300048906 | Bacteria | 1153 |
| 355 | Ga0496104_0173975 | 3300048907 | Bacteria | 2063 |
| 356 | Ga0496104_0500559 | 3300048907 | Bacteria | 1126 |
| 357 | Ga0496105_0061875 | 3300048908 | Bacteria | 3089 |
| 358 | Ga0496105_0377993 | 3300048908 | Bacteria | 1127 |
| 359 | Ga0496106_0161341 | 3300048909 | Bacteria | 1773 |
| 360 | Ga0496106_0400874 | 3300048909 | Bacteria | 1102 |
| 361 | Ga0496106_0508891 | 3300048909 | Bacteria | 967 |
| 362 | Ga0496106_0531744 | 3300048909 | Bacteria | 944 |
| 363 | Ga0496107_0090006 | 3300048910 | Bacteria | 2241 |
| 364 | Ga0496108_0000113 | 3300048911 | Bacteria | 81461 |
| 365 | Ga0496108_0043171 | 3300048911 | Bacteria | 3766 |
| 366 | Ga0496108_0114110 | 3300048911 | Bacteria | 2313 |
| 367 | Ga0496108_0273776 | 3300048911 | Bacteria | 1470 |
| 368 | Ga0496109_0012395 | 3300048912 | Bacteria | 7361 |
| 369 | Ga0496109_0055258 | 3300048912 | Bacteria | 3622 |
| 370 | Ga0496109_0088212 | 3300048912 | Bacteria | 2866 |
| 371 | Ga0496111_0045334 | 3300048914 | Bacteria | 3163 |
| 372 | Ga0496111_0136972 | 3300048914 | Bacteria | 1814 |
| 373 | Ga0496112_0012981 | 3300048915 | Bacteria | 7677 |
| 374 | Ga0496112_0062242 | 3300048915 | Bacteria | 3680 |
| 375 | Ga0496112_0238521 | 3300048915 | Bacteria | 1771 |
| 376 | Ga0496112_0632748 | 3300048915 | Bacteria | 1000 |
| 377 | Ga0496113_0000366 | 3300048916 | Bacteria | 21747 |
| 378 | Ga0496114_0212400 | 3300048917 | Bacteria | 1697 |
| 379 | Ga0496114_0287737 | 3300048917 | Bacteria | 1450 |
| 380 | Ga0496114_0683662 | 3300048917 | Bacteria | 901 |
| 381 | Ga0496115_0013701 | 3300048918 | Bacteria | 6140 |
| 382 | Ga0496115_0034251 | 3300048918 | Bacteria | 4013 |
| 383 | Ga0496116_0258653 | 3300048919 | Bacteria | 860 |
| 384 | Ga0501031_0107979 | 3300049568 | Bacteria | 1817 |
| 385 | Ga0501032_0102188 | 3300049569 | Bacteria | 1899 |
| 386 | Ga0501034_0163866 | 3300049571 | Bacteria | 2193 |
| 387 | Ga0501034_0343573 | 3300049571 | Bacteria | 1422 |
| 388 | Ga0501036_0084876 | 3300049572 | Bacteria | 2677 |
| 389 | Ga0501036_0503546 | 3300049572 | Bacteria | 1007 |
| 390 | Ga0501037_0004319 | 3300049573 | Bacteria | 10307 |
| 391 | Ga0501037_0182978 | 3300049573 | Bacteria | 1486 |
| 392 | Ga0501038_0117966 | 3300049574 | Bacteria | 2191 |
| 393 | Ga0501038_0167703 | 3300049574 | Bacteria | 1780 |
| 394 | Ga0501039_0103056 | 3300049575 | Bacteria | 2227 |
| 395 | Ga0501040_0057689 | 3300049576 | Bacteria | 2666 |
| 396 | Ga0501040_0089588 | 3300049576 | Bacteria | 2137 |
| 397 | Ga0501041_0035401 | 3300049577 | Bacteria | 3024 |
| 398 | Ga0501042_0231609 | 3300049578 | Bacteria | 1332 |
| 399 | Ga0501043_0204300 | 3300049579 | Bacteria | 1532 |
| 400 | Ga0501047_0002351 | 3300049581 | Bacteria | 18082 |
| 401 | Ga0501047_0010811 | 3300049581 | Bacteria | 8626 |
| 402 | Ga0501047_0029373 | 3300049581 | Bacteria | 5302 |
| 403 | Ga0501048_0071586 | 3300049582 | Bacteria | 2448 |
| 404 | Ga0501048_0261848 | 3300049582 | Bacteria | 1228 |
| 405 | Ga0501067_0026769 | 3300049583 | Bacteria | 3193 |
| 406 | Ga0501068_0003400 | 3300049584 | Bacteria | 8559 |
| 407 | Ga0501069_0198749 | 3300049585 | Bacteria | 1161 |
| 408 | Ga0501069_0254584 | 3300049585 | Bacteria | 1024 |
| 409 | Ga0501070_0001898 | 3300049586 | Bacteria | 18497 |
| 410 | Ga0501071_0008105 | 3300049587 | Bacteria | 6928 |
| 411 | Ga0501071_0058103 | 3300049587 | Bacteria | 2796 |
| 412 | Ga0501072_0035419 | 3300049588 | Bacteria | 3909 |
| 413 | Ga0501074_0021872 | 3300049590 | Bacteria | 4643 |
| 414 | Ga0501076_0145081 | 3300049592 | Bacteria | 1930 |
| 415 | Ga0501076_0399857 | 3300049592 | Bacteria | 1130 |
| 416 | Ga0501079_0037889 | 3300049741 | Bacteria | 3717 |
| 417 | Ga0501080_0143711 | 3300049742 | Bacteria | 2205 |
| 418 | Ga0501083_0007143 | 3300049744 | Bacteria | 7929 |
| 419 | Ga0501035_0009930 | 3300049822 | Bacteria | 8839 |
| 420 | Ga0501044_0002645 | 3300049823 | Bacteria | 20386 |
| 421 | Ga0501044_0141906 | 3300049823 | Bacteria | 2390 |
| 422 | Ga0501045_0332063 | 3300049824 | Bacteria | 1131 |
| 423 | Ga0501045_0540169 | 3300049824 | Bacteria | 865 |
| 424 | nmdc:mga03683_23931_c1 | 3300050489 | Bacteria | 2385 |
| 425 | nmdc:mga03n38_326290_c1 | 3300050490 | Bacteria | 830 |
| 426 | nmdc:mga04h51_6132_c1 | 3300050495 | Bacteria | 3100 |
| 427 | nmdc:mga07m45_26648_c1 | 3300050496 | Bacteria | 3178 |
| 428 | nmdc:mga05p37_15521_c1 | 3300050507 | Bacteria | 9156 |
| 429 | nmdc:mga05p37_481_c1 | 3300050507 | Bacteria | 43634 |
| 430 | nmdc:mga05p37_52911_c1 | 3300050507 | Bacteria | 4994 |
| 431 | nmdc:mga05p37_659814_c1 | 3300050507 | Bacteria | 1170 |
| 432 | nmdc:mga05p37_7764_c1 | 3300050507 | Bacteria | 12665 |
| 433 | nmdc:mga05p37_89430_c1 | 3300050507 | Bacteria | 3795 |
| 434 | nmdc:mga09592_1486_c1 | 3300050508 | Bacteria | 18853 |
| 435 | nmdc:mga09592_18531_c1 | 3300050508 | Bacteria | 5710 |
| 436 | nmdc:mga09592_25442_c1 | 3300050508 | Bacteria | 4899 |
| 437 | nmdc:mga09592_307244_c1 | 3300050508 | Bacteria | 1375 |
| 438 | nmdc:mga09592_76809_c1 | 3300050508 | Bacteria | 2841 |
| 439 | nmdc:mga09592_790_c1 | 3300050508 | Bacteria | 24488 |
| 440 | nmdc:mga0qj67_13824_c1 | 3300050509 | Bacteria | 6094 |
| 441 | nmdc:mga0qj67_18090_c1 | 3300050509 | Bacteria | 5370 |
| 442 | nmdc:mga0qj67_24283_c1 | 3300050509 | Bacteria | 4672 |
| 443 | nmdc:mga0qj67_4547_c1 | 3300050509 | Bacteria | 10050 |
| 444 | nmdc:mga0qj67_60791_c1 | 3300050509 | Bacteria | 2999 |
| 445 | nmdc:mga06r32_10652_c1 | 3300050510 | Bacteria | 8294 |
| 446 | nmdc:mga06r32_32_c1 | 3300050510 | Bacteria | 83882 |
| 447 | nmdc:mga06r32_92816_c1 | 3300050510 | Bacteria | 2952 |
| 448 | nmdc:mga08y16_109333_c1 | 3300050511 | Bacteria | 2878 |
| 449 | nmdc:mga08y16_169606_c1 | 3300050511 | Bacteria | 2267 |
| 450 | nmdc:mga08y16_7002_c1 | 3300050511 | Bacteria | 11826 |
| 451 | nmdc:mga0n895_16745_c1 | 3300050512 | Bacteria | 6736 |
| 452 | nmdc:mga0a205_9218_c1 | 3300050515 | Bacteria | 9010 |
| 453 | Ga0495612_0080349 | 3300053078 | Bacteria | 1369 |
| 454 | Ga0495595_0067755 | 3300053084 | Bacteria | 1683 |
| 455 | Ga0495595_0208110 | 3300053084 | Bacteria | 975 |
| 456 | Ga0495619_0215597 | 3300053085 | Bacteria | 1329 |
| 457 | Ga0500646_0000287 | 3300053090 | Bacteria | 15428 |
| 458 | Ga0500651_0111141 | 3300053093 | Bacteria | 1672 |
| 459 | Ga0500568_0002126 | 3300053139 | Bacteria | 11964 |
| 460 | Ga0500600_0120797 | 3300053149 | Bacteria | 1350 |
| 461 | Ga0500616_0002369 | 3300053153 | Bacteria | 15819 |
| 462 | Ga0590075_047133 | 3300059424 | Bacteria | 1105 |
| 463 | Ga0501082_0204328 | 3300060353 | Bacteria | 1719 |
| 464 | Ga0501082_0637256 | 3300060353 | Bacteria | 933 |
| 465 | Ga0530510_0082648 | 3300061734 | Bacteria | 2339 |
| 466 | Ga0530510_0341537 | 3300061734 | Bacteria | 1124 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031456 | Ga0307513_10092470 | Ga0307513_100924701 | 228 |
| 2 | 3300003320 | rootH2_10015505 | rootH2_1001550512 | 229 |
| 3 | 3300012491 | Ga0157329_1003126 | Ga0157329_10031261 | 229 |
| 4 | 3300031995 | Ga0307409_100054455 | Ga0307409_1000544552 | 234 |
| 5 | 3300045976 | Ga0466967_0070423 | Ga0466967_0070423_130_849 | 237 |
| 6 | 3300013308 | Ga0157375_10742851 | Ga0157375_107428512 | 238 |
| 7 | iso_pu_bacteria | 2751185782 | 2753263941 | 239 |
| 8 | iso_pu_bacteria | 2816332119 | 2816422555 | 239 |
| 9 | iso_pu_bacteria | 2915650412 | 2915654443 | 239 |
| 10 | 3300037312 | Ga0395899_0083861 | Ga0395899_0083861_359_1105 | 240 |
| 11 | 3300037418 | Ga0395900_0031585 | Ga0395900_0031585_858_1622 | 240 |
| 12 | 3300037471 | Ga0395905_0013760 | Ga0395905_0013760_1082_1846 | 240 |
| 13 | 3300038443 | Ga0395901_0039590 | Ga0395901_0039590_1986_2750 | 240 |
| 14 | iso_pu_bacteria | 2515075009 | 2515110867 | 240 |
| 15 | iso_pu_bacteria | 2517093000 | 2517093689 | 240 |
| 16 | iso_pu_bacteria | 2585427528 | 2585538628 | 240 |
| 17 | iso_pu_bacteria | 2585427593 | 2585836581 | 240 |
| 18 | iso_pu_bacteria | 2615840698 | 2616556813 | 240 |
| 19 | iso_pu_bacteria | 2738541333 | 2739034059 | 240 |
| 20 | iso_pu_bacteria | 2791355267 | 2793368114 | 240 |
| 21 | iso_pu_bacteria | 2802429633 | 2806042855 | 240 |
| 22 | iso_pu_bacteria | 2802429634 | 2806050807 | 240 |
| 23 | iso_pu_bacteria | 2802429635 | 2806058025 | 240 |
| 24 | iso_pu_bacteria | 2802429636 | 2806065262 | 240 |
| 25 | iso_pu_bacteria | 2802429637 | 2806076748 | 240 |
| 26 | iso_pu_bacteria | 2842110456 | 2842117170 | 240 |
| 27 | iso_pu_bacteria | 2856858025 | 2856863960 | 240 |
| 28 | iso_pu_bacteria | 2884693830 | 2884699561 | 240 |
| 29 | iso_pu_bacteria | 2895442618 | 2895443230 | 240 |
| 30 | iso_pu_bacteria | 2933586486 | 2933593311 | 240 |
| 31 | iso_pu_bacteria | 8001781756 | 8001785499 | 240 |
| 32 | iso_pu_bacteria | 8005460587 | 8005461505 | 240 |
| 33 | iso_pu_bacteria | 8005570704 | 8005575708 | 240 |
| 34 | iso_pu_bacteria | 8055412473 | 8055418842 | 240 |
| 35 | iso_pu_bacteria | 8056375014 | 8056379235 | 240 |
| 36 | 3300009147 | Ga0114129_10268506 | Ga0114129_102685063 | 242 |
| 37 | 3300042136 | Ga0450900_013297 | Ga0450900_013297_268_1017 | 242 |
| 38 | 3300050511 | nmdc:mga08y16_109333_c1 | nmdc:mga08y16_109333_c1_1751_2521 | 242 |
| 39 | iso_pu_bacteria | 2513237137 | 2513858710 | 242 |
| 40 | iso_pu_bacteria | 2513237137 | 2513862470 | 242 |
| 41 | iso_pu_bacteria | 2844533157 | 2844534854 | 242 |
| 42 | iso_pu_bacteria | 2904699407 | 2904701358 | 242 |
| 43 | 3300003187 | JGI25151J46595_10001406 | JGI25151J46595_1000140614 | 243 |
| 44 | 3300003214 | JGI25165J46597_1002418 | JGI25165J46597_10024187 | 243 |
| 45 | 3300003354 | JGI25160J50197_1010974 | JGI25160J50197_10109742 | 243 |
| 46 | 3300003373 | JGI25407J50210_10012174 | JGI25407J50210_100121743 | 243 |
| 47 | 3300003373 | JGI25407J50210_10059661 | JGI25407J50210_100596612 | 243 |
| 48 | 3300005262 | Ga0065165_1045387 | Ga0065165_10453872 | 243 |
| 49 | 3300005335 | Ga0070666_10000249 | Ga0070666_100002497 | 243 |
| 50 | 3300005337 | Ga0070682_100117776 | Ga0070682_1001177763 | 243 |
| 51 | 3300005339 | Ga0070660_100468560 | Ga0070660_1004685601 | 243 |
| 52 | 3300005340 | Ga0070689_100631105 | Ga0070689_1006311051 | 243 |
| 53 | 3300005344 | Ga0070661_100070111 | Ga0070661_1000701112 | 243 |
| 54 | 3300005345 | Ga0070692_10042551 | Ga0070692_100425512 | 243 |
| 55 | 3300005347 | Ga0070668_100002810 | Ga0070668_10000281013 | 243 |
| 56 | 3300005353 | Ga0070669_100126084 | Ga0070669_1001260842 | 243 |
| 57 | 3300005354 | Ga0070675_100073492 | Ga0070675_1000734924 | 243 |
| 58 | 3300005356 | Ga0070674_100066303 | Ga0070674_1000663032 | 243 |
| 59 | 3300005356 | Ga0070674_100396142 | Ga0070674_1003961422 | 243 |
| 60 | 3300005364 | Ga0070673_100030242 | Ga0070673_1000302425 | 243 |
| 61 | 3300005434 | Ga0070709_10337775 | Ga0070709_103377751 | 243 |
| 62 | 3300005455 | Ga0070663_100077351 | Ga0070663_1000773512 | 243 |
| 63 | 3300005456 | Ga0070678_100120250 | Ga0070678_1001202503 | 243 |
| 64 | 3300005457 | Ga0070662_100007024 | Ga0070662_1000070243 | 243 |
| 65 | 3300005459 | Ga0068867_100275364 | Ga0068867_1002753642 | 243 |
| 66 | 3300005466 | Ga0070685_10019858 | Ga0070685_100198585 | 243 |
| 67 | 3300005535 | Ga0070684_100034062 | Ga0070684_1000340623 | 243 |
| 68 | 3300005535 | Ga0070684_100251151 | Ga0070684_1002511511 | 243 |
| 69 | 3300005548 | Ga0070665_100442041 | Ga0070665_1004420412 | 243 |
| 70 | 3300005548 | Ga0070665_100488874 | Ga0070665_1004888741 | 243 |
| 71 | 3300005578 | Ga0068854_100228748 | Ga0068854_1002287483 | 243 |
| 72 | 3300005616 | Ga0068852_100329572 | Ga0068852_1003295722 | 243 |
| 73 | 3300005719 | Ga0068861_100223597 | Ga0068861_1002235971 | 243 |
| 74 | 3300005841 | Ga0068863_100026556 | Ga0068863_1000265566 | 243 |
| 75 | 3300005842 | Ga0068858_100657356 | Ga0068858_1006573561 | 243 |
| 76 | 3300005843 | Ga0068860_100108377 | Ga0068860_1001083773 | 243 |
| 77 | 3300005843 | Ga0068860_100477319 | Ga0068860_1004773191 | 243 |
| 78 | 3300005843 | Ga0068860_100477790 | Ga0068860_1004777902 | 243 |
| 79 | 3300005937 | Ga0081455_10105726 | Ga0081455_101057263 | 243 |
| 80 | 3300005981 | Ga0081538_10026994 | Ga0081538_100269942 | 243 |
| 81 | 3300005981 | Ga0081538_10031505 | Ga0081538_100315054 | 243 |
| 82 | 3300005983 | Ga0081540_1004395 | Ga0081540_10043954 | 243 |
| 83 | 3300005985 | Ga0081539_10006939 | Ga0081539_100069399 | 243 |
| 84 | 3300005985 | Ga0081539_10011776 | Ga0081539_100117762 | 243 |
| 85 | 3300005985 | Ga0081539_10049227 | Ga0081539_100492272 | 243 |
| 86 | 3300005985 | Ga0081539_10059376 | Ga0081539_100593762 | 243 |
| 87 | 3300006353 | Ga0075370_10276060 | Ga0075370_102760602 | 243 |
| 88 | 3300006844 | Ga0075428_100094031 | Ga0075428_1000940316 | 243 |
| 89 | 3300006847 | Ga0075431_100545168 | Ga0075431_1005451682 | 243 |
| 90 | 3300006852 | Ga0075433_10011812 | Ga0075433_100118122 | 243 |
| 91 | 3300006880 | Ga0075429_100126699 | Ga0075429_1001266994 | 243 |
| 92 | 3300006880 | Ga0075429_100529210 | Ga0075429_1005292102 | 243 |
| 93 | 3300006931 | Ga0097620_100401473 | Ga0097620_1004014732 | 243 |
| 94 | 3300009094 | Ga0111539_10014481 | Ga0111539_1001448110 | 243 |
| 95 | 3300009094 | Ga0111539_10054709 | Ga0111539_100547092 | 243 |
| 96 | 3300009098 | Ga0105245_10590525 | Ga0105245_105905251 | 243 |
| 97 | 3300009101 | Ga0105247_10346467 | Ga0105247_103464671 | 243 |
| 98 | 3300009177 | Ga0105248_10284340 | Ga0105248_102843402 | 243 |
| 99 | 3300009551 | Ga0105238_10000564 | Ga0105238_1000056434 | 243 |
| 100 | 3300009553 | Ga0105249_10017384 | Ga0105249_100173847 | 243 |
| 101 | 3300009553 | Ga0105249_10888123 | Ga0105249_108881231 | 243 |
| 102 | 3300010375 | Ga0105239_10080599 | Ga0105239_100805991 | 243 |
| 103 | 3300013104 | Ga0157370_10069573 | Ga0157370_100695731 | 243 |
| 104 | 3300013297 | Ga0157378_10025800 | Ga0157378_100258004 | 243 |
| 105 | 3300013307 | Ga0157372_10847127 | Ga0157372_108471272 | 243 |
| 106 | 3300020070 | Ga0206356_10227172 | Ga0206356_102271721 | 243 |
| 107 | 3300020070 | Ga0206356_10387185 | Ga0206356_103871851 | 243 |
| 108 | 3300021384 | Ga0213876_10000024 | Ga0213876_10000024105 | 243 |
| 109 | 3300021384 | Ga0213876_10000365 | Ga0213876_1000036527 | 243 |
| 110 | 3300021384 | Ga0213876_10001840 | Ga0213876_1000184013 | 243 |
| 111 | 3300021384 | Ga0213876_10019216 | Ga0213876_100192164 | 243 |
| 112 | 3300025231 | Ga0207427_104375 | Ga0207427_1043753 | 243 |
| 113 | 3300025261 | Ga0209233_1002689 | Ga0209233_10026892 | 243 |
| 114 | 3300025284 | Ga0209130_1006700 | Ga0209130_10067001 | 243 |
| 115 | 3300025294 | Ga0209025_1000152 | Ga0209025_100015211 | 243 |
| 116 | 3300025294 | Ga0209025_1036031 | Ga0209025_10360312 | 243 |
| 117 | 3300025297 | Ga0209758_1007593 | Ga0209758_10075934 | 243 |
| 118 | 3300025302 | Ga0207426_1000928 | Ga0207426_100092811 | 243 |
| 119 | 3300025903 | Ga0207680_10000678 | Ga0207680_100006784 | 243 |
| 120 | 3300025907 | Ga0207645_10018578 | Ga0207645_100185786 | 243 |
| 121 | 3300025907 | Ga0207645_10133031 | Ga0207645_101330312 | 243 |
| 122 | 3300025908 | Ga0207643_10229360 | Ga0207643_102293602 | 243 |
| 123 | 3300025909 | Ga0207705_10006222 | Ga0207705_100062223 | 243 |
| 124 | 3300025911 | Ga0207654_10137253 | Ga0207654_101372531 | 243 |
| 125 | 3300025915 | Ga0207693_10128573 | Ga0207693_101285732 | 243 |
| 126 | 3300025918 | Ga0207662_10159941 | Ga0207662_101599412 | 243 |
| 127 | 3300025924 | Ga0207694_10000013 | Ga0207694_10000013218 | 243 |
| 128 | 3300025927 | Ga0207687_10062365 | Ga0207687_100623654 | 243 |
| 129 | 3300025929 | Ga0207664_10001490 | Ga0207664_1000149013 | 243 |
| 130 | 3300025931 | Ga0207644_10175382 | Ga0207644_101753821 | 243 |
| 131 | 3300025941 | Ga0207711_10169450 | Ga0207711_101694501 | 243 |
| 132 | 3300025944 | Ga0207661_10150481 | Ga0207661_101504812 | 243 |
| 133 | 3300025945 | Ga0207679_10261856 | Ga0207679_102618562 | 243 |
| 134 | 3300025960 | Ga0207651_10399140 | Ga0207651_103991402 | 243 |
| 135 | 3300025961 | Ga0207712_10007003 | Ga0207712_100070039 | 243 |
| 136 | 3300025972 | Ga0207668_10001389 | Ga0207668_1000138914 | 243 |
| 137 | 3300025981 | Ga0207640_10349672 | Ga0207640_103496722 | 243 |
| 138 | 3300026035 | Ga0207703_10048287 | Ga0207703_100482872 | 243 |
| 139 | 3300026035 | Ga0207703_10585077 | Ga0207703_105850771 | 243 |
| 140 | 3300026041 | Ga0207639_10196824 | Ga0207639_101968243 | 243 |
| 141 | 3300026067 | Ga0207678_10154256 | Ga0207678_101542562 | 243 |
| 142 | 3300026078 | Ga0207702_10964022 | Ga0207702_109640221 | 243 |
| 143 | 3300026095 | Ga0207676_10452747 | Ga0207676_104527471 | 243 |
| 144 | 3300026116 | Ga0207674_10035167 | Ga0207674_100351672 | 243 |
| 145 | 3300026118 | Ga0207675_100011392 | Ga0207675_1000113921 | 243 |
| 146 | 3300026142 | Ga0207698_10265769 | Ga0207698_102657692 | 243 |
| 147 | 3300027876 | Ga0209974_10107187 | Ga0209974_101071871 | 243 |
| 148 | 3300027907 | Ga0207428_10031980 | Ga0207428_100319804 | 243 |
| 149 | 3300027907 | Ga0207428_10223677 | Ga0207428_102236772 | 243 |
| 150 | 3300028379 | Ga0268266_10312453 | Ga0268266_103124531 | 243 |
| 151 | 3300028380 | Ga0268265_10031095 | Ga0268265_100310952 | 243 |
| 152 | 3300028380 | Ga0268265_10046914 | Ga0268265_100469144 | 243 |
| 153 | 3300028381 | Ga0268264_10351445 | Ga0268264_103514451 | 243 |
| 154 | 3300028381 | Ga0268264_10489095 | Ga0268264_104890952 | 243 |
| 155 | 3300030521 | Ga0307511_10039338 | Ga0307511_100393384 | 243 |
| 156 | 3300030522 | Ga0307512_10086845 | Ga0307512_100868451 | 243 |
| 157 | 3300031241 | Ga0265325_10003829 | Ga0265325_100038294 | 243 |
| 158 | 3300031241 | Ga0265325_10004490 | Ga0265325_100044902 | 243 |
| 159 | 3300031249 | Ga0265339_10014452 | Ga0265339_100144522 | 243 |
| 160 | 3300031249 | Ga0265339_10019330 | Ga0265339_100193302 | 243 |
| 161 | 3300031250 | Ga0265331_10025302 | Ga0265331_100253023 | 243 |
| 162 | 3300031344 | Ga0265316_10013588 | Ga0265316_100135884 | 243 |
| 163 | 3300031344 | Ga0265316_10094631 | Ga0265316_100946312 | 243 |
| 164 | 3300031595 | Ga0265313_10002553 | Ga0265313_100025534 | 243 |
| 165 | 3300031616 | Ga0307508_10000370 | Ga0307508_1000037050 | 243 |
| 166 | 3300031616 | Ga0307508_10000419 | Ga0307508_1000041935 | 243 |
| 167 | 3300031711 | Ga0265314_10247210 | Ga0265314_102472102 | 243 |
| 168 | 3300031852 | Ga0307410_10008166 | Ga0307410_100081663 | 243 |
| 169 | 3300031903 | Ga0307407_10009187 | Ga0307407_100091875 | 243 |
| 170 | 3300031995 | Ga0307409_100008093 | Ga0307409_1000080933 | 243 |
| 171 | 3300031995 | Ga0307409_101203074 | Ga0307409_1012030741 | 243 |
| 172 | 3300032002 | Ga0307416_100039719 | Ga0307416_1000397193 | 243 |
| 173 | 3300032004 | Ga0307414_10033869 | Ga0307414_100338692 | 243 |
| 174 | 3300032126 | Ga0307415_100135054 | Ga0307415_1001350542 | 243 |
| 175 | 3300033179 | Ga0307507_10189055 | Ga0307507_101890552 | 243 |
| 176 | 3300033442 | Ga0315911_1000003 | Ga0315911_1000003103 | 243 |
| 177 | 3300033442 | Ga0315911_1000072 | Ga0315911_100007211 | 243 |
| 178 | 3300034820 | Ga0373959_0000270 | Ga0373959_0000270_2150_2881 | 243 |
| 179 | 3300035083 | Ga0373926_0104618 | Ga0373926_0104618_11_748 | 243 |
| 180 | 3300035086 | Ga0373934_0014714 | Ga0373934_0014714_533_1270 | 243 |
| 181 | 3300035089 | Ga0373944_0003442 | Ga0373944_0003442_419_1156 | 243 |
| 182 | 3300035090 | Ga0373949_0057925 | Ga0373949_0057925_226_981 | 243 |
| 183 | 3300035111 | Ga0373923_0017283 | Ga0373923_0017283_727_1464 | 243 |
| 184 | 3300035113 | Ga0373936_0109563 | Ga0373936_0109563_394_1131 | 243 |
| 185 | 3300035116 | Ga0373945_0002792 | Ga0373945_0002792_3421_4158 | 243 |
| 186 | 3300035117 | Ga0373953_0053507 | Ga0373953_0053507_143_880 | 243 |
| 187 | 3300035118 | Ga0373954_0124612 | Ga0373954_0124612_199_936 | 243 |
| 188 | 3300035119 | Ga0373956_0013140 | Ga0373956_0013140_632_1369 | 243 |
| 189 | 3300035120 | Ga0373957_0055159 | Ga0373957_0055159_628_1365 | 243 |
| 190 | 3300035172 | Ga0373955_0061626 | Ga0373955_0061626_258_995 | 243 |
| 191 | 3300035410 | Ga0373924_0080286 | Ga0373924_0080286_319_1056 | 243 |
| 192 | 3300035692 | Ga0373935_0229353 | Ga0373935_0229353_531_1268 | 243 |
| 193 | 3300035724 | Ga0373933_0205014 | Ga0373933_0205014_157_894 | 243 |
| 194 | 3300035725 | Ga0373947_0028232 | Ga0373947_0028232_1536_2273 | 243 |
| 195 | 3300036401 | Ga0373937_0103327 | Ga0373937_0103327_1714_2451 | 243 |
| 196 | 3300037068 | Ga0373925_0141443 | Ga0373925_0141443_530_1267 | 243 |
| 197 | 3300037418 | Ga0395900_0064015 | Ga0395900_0064015_823_1575 | 243 |
| 198 | 3300037466 | Ga0395898_0040177 | Ga0395898_0040177_817_1569 | 243 |
| 199 | 3300037471 | Ga0395905_0144024 | Ga0395905_0144024_754_1506 | 243 |
| 200 | 3300037471 | Ga0395905_0507007 | Ga0395905_0507007_329_1060 | 243 |
| 201 | 3300037853 | Ga0436364_0069694 | Ga0436364_0069694_796_1539 | 243 |
| 202 | 3300038443 | Ga0395901_0087402 | Ga0395901_0087402_1946_2698 | 243 |
| 203 | 3300039437 | Ga0436365_0693142 | Ga0436365_0693142_23799_24542 | 243 |
| 204 | 3300039437 | Ga0436365_0861406 | Ga0436365_0861406_9345_10088 | 243 |
| 205 | 3300039437 | Ga0436365_1017987 | Ga0436365_1017987_710_1447 | 243 |
| 206 | 3300039437 | Ga0436365_1919465 | Ga0436365_1919465_9633_10376 | 243 |
| 207 | 3300039438 | Ga0436360_1016574 | Ga0436360_1016574_676_1416 | 243 |
| 208 | 3300039453 | Ga0436362_1015986 | Ga0436362_1015986_12_743 | 243 |
| 209 | 3300041410 | Ga0439461_0044394 | Ga0439461_0044394_75_806 | 243 |
| 210 | 3300041452 | Ga0451793_0430880 | Ga0451793_0430880_1422_2153 | 243 |
| 211 | 3300042003 | Ga0439443_009386 | Ga0439443_009386_273_1013 | 243 |
| 212 | 3300042008 | Ga0439450_040650 | Ga0439450_040650_258_989 | 243 |
| 213 | 3300042119 | Ga0450915_000839 | Ga0450915_000839_308_1147 | 243 |
| 214 | 3300042122 | Ga0450920_035302 | Ga0450920_035302_77_817 | 243 |
| 215 | 3300042124 | Ga0450922_004491 | Ga0450922_004491_52_792 | 243 |
| 216 | 3300042126 | Ga0450888_004567 | Ga0450888_004567_301_1041 | 243 |
| 217 | 3300042134 | Ga0450898_017735 | Ga0450898_017735_200_940 | 243 |
| 218 | 3300042184 | Ga0450908_030455 | Ga0450908_030455_145_885 | 243 |
| 219 | 3300042438 | Ga0439459_0038569 | Ga0439459_0038569_209_949 | 243 |
| 220 | 3300042461 | Ga0439460_0021724 | Ga0439460_0021724_45_785 | 243 |
| 221 | 3300042531 | Ga0450918_031430 | Ga0450918_031430_40_780 | 243 |
| 222 | 3300042532 | Ga0450893_0029247 | Ga0450893_0029247_31_762 | 243 |
| 223 | 3300044735 | Ga0466968_0297175 | Ga0466968_0297175_10_741 | 243 |
| 224 | 3300045836 | Ga0466958_0029062 | Ga0466958_0029062_2358_3122 | 243 |
| 225 | 3300045836 | Ga0466958_0300499 | Ga0466958_0300499_187_933 | 243 |
| 226 | 3300045976 | Ga0466967_0165286 | Ga0466967_0165286_224_970 | 243 |
| 227 | 3300046455 | Ga0495603_0065381 | Ga0495603_0065381_294_1031 | 243 |
| 228 | 3300046459 | Ga0495629_0008087 | Ga0495629_0008087_1497_2234 | 243 |
| 229 | 3300046461 | Ga0495641_0083342 | Ga0495641_0083342_648_1379 | 243 |
| 230 | 3300046462 | Ga0495651_0064229 | Ga0495651_0064229_932_1669 | 243 |
| 231 | 3300046473 | Ga0495582_0044556 | Ga0495582_0044556_1270_2007 | 243 |
| 232 | 3300046476 | Ga0495662_0025636 | Ga0495662_0025636_742_1479 | 243 |
| 233 | 3300046499 | Ga0495594_0060671 | Ga0495594_0060671_1015_1752 | 243 |
| 234 | 3300046507 | Ga0495606_0172801 | Ga0495606_0172801_70_801 | 243 |
| 235 | 3300046511 | Ga0495608_0019585 | Ga0495608_0019585_2143_2880 | 243 |
| 236 | 3300046517 | Ga0495630_0387410 | Ga0495630_0387410_286_1023 | 243 |
| 237 | 3300046529 | Ga0495652_0297191 | Ga0495652_0297191_386_1123 | 243 |
| 238 | 3300046531 | Ga0495665_0123716 | Ga0495665_0123716_589_1326 | 243 |
| 239 | 3300046535 | Ga0495586_0217397 | Ga0495586_0217397_313_1050 | 243 |
| 240 | 3300046536 | Ga0495587_0053195 | Ga0495587_0053195_1201_1938 | 243 |
| 241 | 3300046543 | Ga0495645_0085240 | Ga0495645_0085240_191_928 | 243 |
| 242 | 3300046559 | Ga0495667_0054748 | Ga0495667_0054748_375_1112 | 243 |
| 243 | 3300046616 | Ga0495668_0135901 | Ga0495668_0135901_15_773 | 243 |
| 244 | 3300046616 | Ga0495668_0283385 | Ga0495668_0283385_73_843 | 243 |
| 245 | 3300046665 | Ga0495661_0078752 | Ga0495661_0078752_1025_1783 | 243 |
| 246 | 3300046674 | Ga0495588_0087720 | Ga0495588_0087720_861_1598 | 243 |
| 247 | 3300046678 | Ga0495599_0044072 | Ga0495599_0044072_943_1680 | 243 |
| 248 | 3300046680 | Ga0495646_0151090 | Ga0495646_0151090_530_1267 | 243 |
| 249 | 3300046689 | Ga0495613_0363037 | Ga0495613_0363037_97_837 | 243 |
| 250 | 3300046691 | Ga0495670_0227088 | Ga0495670_0227088_94_939 | 243 |
| 251 | 3300046809 | Ga0495600_0035767 | Ga0495600_0035767_928_1665 | 243 |
| 252 | 3300047315 | Ga0495581_0394476 | Ga0495581_0394476_53_793 | 243 |
| 253 | 3300047319 | Ga0495674_0205527 | Ga0495674_0205527_611_1348 | 243 |
| 254 | 3300047321 | Ga0495676_0120076 | Ga0495676_0120076_212_949 | 243 |
| 255 | 3300047322 | Ga0495680_0057346 | Ga0495680_0057346_2213_2944 | 243 |
| 256 | 3300047673 | Ga0495593_0152501 | Ga0495593_0152501_244_981 | 243 |
| 257 | 3300048904 | Ga0496101_0119057 | Ga0496101_0119057_74_805 | 243 |
| 258 | 3300048905 | Ga0496102_0082922 | Ga0496102_0082922_811_1566 | 243 |
| 259 | 3300048906 | Ga0496103_0050700 | Ga0496103_0050700_1049_1780 | 243 |
| 260 | 3300048906 | Ga0496103_0244947 | Ga0496103_0244947_371_1126 | 243 |
| 261 | 3300048907 | Ga0496104_0500559 | Ga0496104_0500559_122_862 | 243 |
| 262 | 3300048908 | Ga0496105_0377993 | Ga0496105_0377993_216_956 | 243 |
| 263 | 3300048909 | Ga0496106_0400874 | Ga0496106_0400874_18_773 | 243 |
| 264 | 3300048909 | Ga0496106_0508891 | Ga0496106_0508891_109_852 | 243 |
| 265 | 3300048909 | Ga0496106_0531744 | Ga0496106_0531744_125_856 | 243 |
| 266 | 3300048910 | Ga0496107_0090006 | Ga0496107_0090006_173_913 | 243 |
| 267 | 3300048911 | Ga0496108_0000113 | Ga0496108_0000113_32472_33203 | 243 |
| 268 | 3300048911 | Ga0496108_0114110 | Ga0496108_0114110_1224_1964 | 243 |
| 269 | 3300048912 | Ga0496109_0088212 | Ga0496109_0088212_34_774 | 243 |
| 270 | 3300048914 | Ga0496111_0136972 | Ga0496111_0136972_804_1544 | 243 |
| 271 | 3300048915 | Ga0496112_0012981 | Ga0496112_0012981_5931_6671 | 243 |
| 272 | 3300048915 | Ga0496112_0238521 | Ga0496112_0238521_828_1568 | 243 |
| 273 | 3300048917 | Ga0496114_0212400 | Ga0496114_0212400_115_846 | 243 |
| 274 | 3300048917 | Ga0496114_0287737 | Ga0496114_0287737_302_1057 | 243 |
| 275 | 3300048917 | Ga0496114_0683662 | Ga0496114_0683662_76_816 | 243 |
| 276 | 3300048918 | Ga0496115_0034251 | Ga0496115_0034251_3256_3996 | 243 |
| 277 | 3300049568 | Ga0501031_0107979 | Ga0501031_0107979_898_1629 | 243 |
| 278 | 3300049569 | Ga0501032_0102188 | Ga0501032_0102188_731_1462 | 243 |
| 279 | 3300049571 | Ga0501034_0163866 | Ga0501034_0163866_982_1722 | 243 |
| 280 | 3300049571 | Ga0501034_0343573 | Ga0501034_0343573_235_966 | 243 |
| 281 | 3300049572 | Ga0501036_0084876 | Ga0501036_0084876_1089_1820 | 243 |
| 282 | 3300049572 | Ga0501036_0503546 | Ga0501036_0503546_130_861 | 243 |
| 283 | 3300049573 | Ga0501037_0004319 | Ga0501037_0004319_9407_10138 | 243 |
| 284 | 3300049573 | Ga0501037_0182978 | Ga0501037_0182978_389_1120 | 243 |
| 285 | 3300049574 | Ga0501038_0117966 | Ga0501038_0117966_351_1082 | 243 |
| 286 | 3300049574 | Ga0501038_0167703 | Ga0501038_0167703_865_1596 | 243 |
| 287 | 3300049575 | Ga0501039_0103056 | Ga0501039_0103056_170_901 | 243 |
| 288 | 3300049576 | Ga0501040_0057689 | Ga0501040_0057689_153_884 | 243 |
| 289 | 3300049576 | Ga0501040_0089588 | Ga0501040_0089588_415_1146 | 243 |
| 290 | 3300049577 | Ga0501041_0035401 | Ga0501041_0035401_1305_2036 | 243 |
| 291 | 3300049578 | Ga0501042_0231609 | Ga0501042_0231609_187_918 | 243 |
| 292 | 3300049579 | Ga0501043_0204300 | Ga0501043_0204300_393_1124 | 243 |
| 293 | 3300049581 | Ga0501047_0002351 | Ga0501047_0002351_5998_6729 | 243 |
| 294 | 3300049581 | Ga0501047_0010811 | Ga0501047_0010811_1776_2507 | 243 |
| 295 | 3300049581 | Ga0501047_0029373 | Ga0501047_0029373_4098_4838 | 243 |
| 296 | 3300049582 | Ga0501048_0071586 | Ga0501048_0071586_528_1259 | 243 |
| 297 | 3300049582 | Ga0501048_0261848 | Ga0501048_0261848_147_878 | 243 |
| 298 | 3300049583 | Ga0501067_0026769 | Ga0501067_0026769_1611_2342 | 243 |
| 299 | 3300049584 | Ga0501068_0003400 | Ga0501068_0003400_1322_2053 | 243 |
| 300 | 3300049585 | Ga0501069_0198749 | Ga0501069_0198749_128_859 | 243 |
| 301 | 3300049585 | Ga0501069_0254584 | Ga0501069_0254584_20_751 | 243 |
| 302 | 3300049586 | Ga0501070_0001898 | Ga0501070_0001898_9300_10031 | 243 |
| 303 | 3300049587 | Ga0501071_0008105 | Ga0501071_0008105_782_1513 | 243 |
| 304 | 3300049587 | Ga0501071_0058103 | Ga0501071_0058103_1680_2411 | 243 |
| 305 | 3300049588 | Ga0501072_0035419 | Ga0501072_0035419_3044_3775 | 243 |
| 306 | 3300049590 | Ga0501074_0021872 | Ga0501074_0021872_869_1600 | 243 |
| 307 | 3300049592 | Ga0501076_0399857 | Ga0501076_0399857_322_1053 | 243 |
| 308 | 3300049741 | Ga0501079_0037889 | Ga0501079_0037889_1674_2405 | 243 |
| 309 | 3300049742 | Ga0501080_0143711 | Ga0501080_0143711_20_751 | 243 |
| 310 | 3300049744 | Ga0501083_0007143 | Ga0501083_0007143_6253_6984 | 243 |
| 311 | 3300049822 | Ga0501035_0009930 | Ga0501035_0009930_1989_2720 | 243 |
| 312 | 3300049823 | Ga0501044_0002645 | Ga0501044_0002645_322_1053 | 243 |
| 313 | 3300049823 | Ga0501044_0141906 | Ga0501044_0141906_781_1512 | 243 |
| 314 | 3300049824 | Ga0501045_0332063 | Ga0501045_0332063_225_956 | 243 |
| 315 | 3300050507 | nmdc:mga05p37_659814_c1 | nmdc:mga05p37_659814_c1_113_880 | 243 |
| 316 | 3300050507 | nmdc:mga05p37_89430_c1 | nmdc:mga05p37_89430_c1_869_1600 | 243 |
| 317 | 3300050508 | nmdc:mga09592_25442_c1 | nmdc:mga09592_25442_c1_3939_4670 | 243 |
| 318 | 3300050508 | nmdc:mga09592_307244_c1 | nmdc:mga09592_307244_c1_113_880 | 243 |
| 319 | 3300050509 | nmdc:mga0qj67_60791_c1 | nmdc:mga0qj67_60791_c1_1682_2449 | 243 |
| 320 | 3300050511 | nmdc:mga08y16_169606_c1 | nmdc:mga08y16_169606_c1_12_758 | 243 |
| 321 | 3300050511 | nmdc:mga08y16_7002_c1 | nmdc:mga08y16_7002_c1_9819_10610 | 243 |
| 322 | 3300053078 | Ga0495612_0080349 | Ga0495612_0080349_531_1268 | 243 |
| 323 | 3300053084 | Ga0495595_0067755 | Ga0495595_0067755_538_1278 | 243 |
| 324 | 3300053085 | Ga0495619_0215597 | Ga0495619_0215597_453_1190 | 243 |
| 325 | 3300053093 | Ga0500651_0111141 | Ga0500651_0111141_510_1250 | 243 |
| 326 | 3300053139 | Ga0500568_0002126 | Ga0500568_0002126_6063_6815 | 243 |
| 327 | 3300060353 | Ga0501082_0204328 | Ga0501082_0204328_931_1662 | 243 |
| 328 | 3300060353 | Ga0501082_0637256 | Ga0501082_0637256_104_916 | 243 |
| 329 | 3300061734 | Ga0530510_0082648 | Ga0530510_0082648_520_1251 | 243 |
| 330 | iso_pu_bacteria | 2517093001 | 2517108341 | 243 |
| 331 | iso_pu_bacteria | 2996221748 | 2996225960 | 243 |
| 332 | 3300002704 | JGI25155J39150_1000061 | JGI25155J39150_100006154 | 244 |
| 333 | 3300002705 | JGI25156J39149_1000122 | JGI25156J39149_100012226 | 244 |
| 334 | 3300002737 | JGI25162J39368_1000481 | JGI25162J39368_10004816 | 244 |
| 335 | 3300002738 | JGI25154J39366_1000132 | JGI25154J39366_100013237 | 244 |
| 336 | 3300002741 | JGI25157J39369_1000106 | JGI25157J39369_100010654 | 244 |
| 337 | 3300003187 | JGI25151J46595_10001671 | JGI25151J46595_100016719 | 244 |
| 338 | 3300003215 | JGI25153J46596_10007996 | JGI25153J46596_100079966 | 244 |
| 339 | 3300003354 | JGI25160J50197_1005187 | JGI25160J50197_10051877 | 244 |
| 340 | 3300003771 | Ga0055526_1008562 | Ga0055526_10085622 | 244 |
| 341 | 3300003775 | Ga0055524_1003462 | Ga0055524_10034626 | 244 |
| 342 | 3300003790 | Ga0055528_1009329 | Ga0055528_10093296 | 244 |
| 343 | 3300004625 | Ga0055543_1001273 | Ga0055543_10012737 | 244 |
| 344 | 3300005262 | Ga0065165_1013147 | Ga0065165_10131472 | 244 |
| 345 | 3300005339 | Ga0070660_100654853 | Ga0070660_1006548531 | 244 |
| 346 | 3300005435 | Ga0070714_100669580 | Ga0070714_1006695802 | 244 |
| 347 | 3300005466 | Ga0070685_10071785 | Ga0070685_100717853 | 244 |
| 348 | 3300005530 | Ga0070679_100736306 | Ga0070679_1007363061 | 244 |
| 349 | 3300005545 | Ga0070695_100024276 | Ga0070695_1000242765 | 244 |
| 350 | 3300005577 | Ga0068857_100412094 | Ga0068857_1004120942 | 244 |
| 351 | 3300005614 | Ga0068856_100278900 | Ga0068856_1002789002 | 244 |
| 352 | 3300005618 | Ga0068864_100072416 | Ga0068864_1000724162 | 244 |
| 353 | 3300005937 | Ga0081455_10000122 | Ga0081455_1000012227 | 244 |
| 354 | 3300005937 | Ga0081455_10003424 | Ga0081455_1000342410 | 244 |
| 355 | 3300005981 | Ga0081538_10022987 | Ga0081538_100229872 | 244 |
| 356 | 3300005983 | Ga0081540_1065098 | Ga0081540_10650982 | 244 |
| 357 | 3300006042 | Ga0075368_10014604 | Ga0075368_100146045 | 244 |
| 358 | 3300006048 | Ga0075363_100403132 | Ga0075363_1004031321 | 244 |
| 359 | 3300006177 | Ga0075362_10040214 | Ga0075362_100402142 | 244 |
| 360 | 3300006186 | Ga0075369_10014082 | Ga0075369_100140821 | 244 |
| 361 | 3300006353 | Ga0075370_10003802 | Ga0075370_100038028 | 244 |
| 362 | 3300006844 | Ga0075428_100005363 | Ga0075428_1000053636 | 244 |
| 363 | 3300006844 | Ga0075428_100041973 | Ga0075428_1000419734 | 244 |
| 364 | 3300006844 | Ga0075428_100173087 | Ga0075428_1001730872 | 244 |
| 365 | 3300006846 | Ga0075430_100005225 | Ga0075430_1000052258 | 244 |
| 366 | 3300006846 | Ga0075430_100014770 | Ga0075430_1000147701 | 244 |
| 367 | 3300006846 | Ga0075430_100039283 | Ga0075430_1000392833 | 244 |
| 368 | 3300006847 | Ga0075431_100000020 | Ga0075431_10000002061 | 244 |
| 369 | 3300006847 | Ga0075431_100008347 | Ga0075431_1000083476 | 244 |
| 370 | 3300006847 | Ga0075431_100009543 | Ga0075431_1000095436 | 244 |
| 371 | 3300006847 | Ga0075431_100016504 | Ga0075431_1000165045 | 244 |
| 372 | 3300006852 | Ga0075433_10079926 | Ga0075433_100799264 | 244 |
| 373 | 3300006871 | Ga0075434_100059687 | Ga0075434_1000596875 | 244 |
| 374 | 3300006871 | Ga0075434_100076654 | Ga0075434_1000766542 | 244 |
| 375 | 3300006880 | Ga0075429_100006187 | Ga0075429_1000061876 | 244 |
| 376 | 3300009147 | Ga0114129_10000804 | Ga0114129_1000080437 | 244 |
| 377 | 3300009147 | Ga0114129_10079084 | Ga0114129_100790844 | 244 |
| 378 | 3300009177 | Ga0105248_10136877 | Ga0105248_101368771 | 244 |
| 379 | 3300009766 | Ga0123342_1016896 | Ga0123342_10168969 | 244 |
| 380 | 3300012513 | Ga0157326_1013789 | Ga0157326_10137891 | 244 |
| 381 | 3300014325 | Ga0163163_10013192 | Ga0163163_100131922 | 244 |
| 382 | 3300014745 | Ga0157377_10364094 | Ga0157377_103640942 | 244 |
| 383 | 3300025206 | Ga0209435_100081 | Ga0209435_10008133 | 244 |
| 384 | 3300025233 | Ga0209437_100023 | Ga0209437_10002327 | 244 |
| 385 | 3300025245 | Ga0207425_1003651 | Ga0207425_10036515 | 244 |
| 386 | 3300025246 | Ga0209646_1000064 | Ga0209646_1000064234 | 244 |
| 387 | 3300025250 | Ga0209026_1000053 | Ga0209026_1000053234 | 244 |
| 388 | 3300025256 | Ga0209759_1000042 | Ga0209759_1000042234 | 244 |
| 389 | 3300025258 | Ga0209129_1002199 | Ga0209129_10021994 | 244 |
| 390 | 3300025261 | Ga0209233_1000219 | Ga0209233_100021927 | 244 |
| 391 | 3300025273 | Ga0209673_1000632 | Ga0209673_10006328 | 244 |
| 392 | 3300025273 | Ga0209673_1000922 | Ga0209673_100092215 | 244 |
| 393 | 3300025292 | Ga0209676_1023934 | Ga0209676_10239343 | 244 |
| 394 | 3300025294 | Ga0209025_1000082 | Ga0209025_100008245 | 244 |
| 395 | 3300025295 | Ga0209564_1000128 | Ga0209564_100012846 | 244 |
| 396 | 3300025297 | Ga0209758_1001112 | Ga0209758_100111232 | 244 |
| 397 | 3300025299 | Ga0209256_1000564 | Ga0209256_100056456 | 244 |
| 398 | 3300025302 | Ga0207426_1000228 | Ga0207426_10002288 | 244 |
| 399 | 3300025303 | Ga0209051_1010691 | Ga0209051_10106913 | 244 |
| 400 | 3300025915 | Ga0207693_10078434 | Ga0207693_100784343 | 244 |
| 401 | 3300025929 | Ga0207664_10238552 | Ga0207664_102385522 | 244 |
| 402 | 3300025941 | Ga0207711_10046920 | Ga0207711_100469202 | 244 |
| 403 | 3300026078 | Ga0207702_10285107 | Ga0207702_102851072 | 244 |
| 404 | 3300026095 | Ga0207676_10046229 | Ga0207676_100462292 | 244 |
| 405 | 3300026116 | Ga0207674_10139195 | Ga0207674_101391952 | 244 |
| 406 | 3300026118 | Ga0207675_100017680 | Ga0207675_1000176805 | 244 |
| 407 | 3300031731 | Ga0307405_10004043 | Ga0307405_100040434 | 244 |
| 408 | 3300031731 | Ga0307405_10043399 | Ga0307405_100433993 | 244 |
| 409 | 3300031824 | Ga0307413_10005895 | Ga0307413_100058954 | 244 |
| 410 | 3300031824 | Ga0307413_10027571 | Ga0307413_100275711 | 244 |
| 411 | 3300031852 | Ga0307410_10017834 | Ga0307410_100178343 | 244 |
| 412 | 3300031852 | Ga0307410_10206287 | Ga0307410_102062872 | 244 |
| 413 | 3300031901 | Ga0307406_10001235 | Ga0307406_100012359 | 244 |
| 414 | 3300031901 | Ga0307406_10053531 | Ga0307406_100535311 | 244 |
| 415 | 3300031995 | Ga0307409_100001305 | Ga0307409_10000130510 | 244 |
| 416 | 3300031995 | Ga0307409_100072959 | Ga0307409_1000729595 | 244 |
| 417 | 3300032002 | Ga0307416_100001906 | Ga0307416_1000019069 | 244 |
| 418 | 3300032002 | Ga0307416_100033950 | Ga0307416_1000339504 | 244 |
| 419 | 3300032002 | Ga0307416_100359826 | Ga0307416_1003598262 | 244 |
| 420 | 3300032005 | Ga0307411_10153205 | Ga0307411_101532052 | 244 |
| 421 | 3300032126 | Ga0307415_100001344 | Ga0307415_10000134416 | 244 |
| 422 | 3300032126 | Ga0307415_100498498 | Ga0307415_1004984981 | 244 |
| 423 | 3300032126 | Ga0307415_100568730 | Ga0307415_1005687301 | 244 |
| 424 | 3300033180 | Ga0307510_10334937 | Ga0307510_103349371 | 244 |
| 425 | 3300034820 | Ga0373959_0005071 | Ga0373959_0005071_1124_1867 | 244 |
| 426 | 3300034957 | Ga0373938_0007226 | Ga0373938_0007226_563_1306 | 244 |
| 427 | 3300035088 | Ga0373940_0044750 | Ga0373940_0044750_159_902 | 244 |
| 428 | 3300035090 | Ga0373949_0060406 | Ga0373949_0060406_27_770 | 244 |
| 429 | 3300035091 | Ga0373951_0019768 | Ga0373951_0019768_463_1206 | 244 |
| 430 | 3300035112 | Ga0373932_0006030 | Ga0373932_0006030_1233_1976 | 244 |
| 431 | 3300035121 | Ga0373960_0045801 | Ga0373960_0045801_33_776 | 244 |
| 432 | 3300035171 | Ga0373946_0062104 | Ga0373946_0062104_711_1472 | 244 |
| 433 | 3300035207 | Ga0373942_0000355 | Ga0373942_0000355_9486_10229 | 244 |
| 434 | 3300035241 | Ga0373961_0100620 | Ga0373961_0100620_43_786 | 244 |
| 435 | 3300035725 | Ga0373947_0067873 | Ga0373947_0067873_451_1212 | 244 |
| 436 | 3300037068 | Ga0373925_0239233 | Ga0373925_0239233_295_1056 | 244 |
| 437 | 3300037068 | Ga0373925_0266491 | Ga0373925_0266491_227_970 | 244 |
| 438 | 3300037466 | Ga0395898_0015769 | Ga0395898_0015769_6165_6908 | 244 |
| 439 | 3300037853 | Ga0436364_1308164 | Ga0436364_1308164_142_876 | 244 |
| 440 | 3300038443 | Ga0395901_0017821 | Ga0395901_0017821_2832_3575 | 244 |
| 441 | 3300039437 | Ga0436365_0410704 | Ga0436365_0410704_1024_1767 | 244 |
| 442 | 3300039437 | Ga0436365_0672215 | Ga0436365_0672215_1205_1948 | 244 |
| 443 | 3300039437 | Ga0436365_0871751 | Ga0436365_0871751_603_1346 | 244 |
| 444 | 3300039437 | Ga0436365_0962686 | Ga0436365_0962686_137_964 | 244 |
| 445 | 3300041999 | Ga0439433_0021504 | Ga0439433_0021504_143_886 | 244 |
| 446 | 3300044694 | Ga0466963_0055640 | Ga0466963_0055640_1508_2242 | 244 |
| 447 | 3300044765 | Ga0466970_0003775 | Ga0466970_0003775_1161_1895 | 244 |
| 448 | 3300045049 | Ga0466959_0019857 | Ga0466959_0019857_3865_4605 | 244 |
| 449 | 3300046460 | Ga0495638_0004573 | Ga0495638_0004573_1270_2013 | 244 |
| 450 | 3300046501 | Ga0495607_0094383 | Ga0495607_0094383_671_1405 | 244 |
| 451 | 3300046522 | Ga0495643_0188110 | Ga0495643_0188110_208_942 | 244 |
| 452 | 3300047471 | Ga0495684_0256648 | Ga0495684_0256648_172_933 | 244 |
| 453 | 3300047673 | Ga0495593_0166797 | Ga0495593_0166797_20_781 | 244 |
| 454 | 3300048904 | Ga0496101_0066766 | Ga0496101_0066766_1845_2579 | 244 |
| 455 | 3300048905 | Ga0496102_0432496 | Ga0496102_0432496_210_944 | 244 |
| 456 | 3300048907 | Ga0496104_0173975 | Ga0496104_0173975_704_1438 | 244 |
| 457 | 3300048908 | Ga0496105_0061875 | Ga0496105_0061875_761_1546 | 244 |
| 458 | 3300048909 | Ga0496106_0161341 | Ga0496106_0161341_715_1449 | 244 |
| 459 | 3300048911 | Ga0496108_0043171 | Ga0496108_0043171_2200_2985 | 244 |
| 460 | 3300048911 | Ga0496108_0273776 | Ga0496108_0273776_648_1382 | 244 |
| 461 | 3300048912 | Ga0496109_0012395 | Ga0496109_0012395_731_1516 | 244 |
| 462 | 3300048912 | Ga0496109_0055258 | Ga0496109_0055258_364_1098 | 244 |
| 463 | 3300048914 | Ga0496111_0045334 | Ga0496111_0045334_649_1434 | 244 |
| 464 | 3300048915 | Ga0496112_0062242 | Ga0496112_0062242_1225_2010 | 244 |
| 465 | 3300048915 | Ga0496112_0632748 | Ga0496112_0632748_100_834 | 244 |
| 466 | 3300048916 | Ga0496113_0000366 | Ga0496113_0000366_18391_19176 | 244 |
| 467 | 3300048918 | Ga0496115_0013701 | Ga0496115_0013701_1670_2404 | 244 |
| 468 | 3300048919 | Ga0496116_0258653 | Ga0496116_0258653_27_761 | 244 |
| 469 | 3300049592 | Ga0501076_0145081 | Ga0501076_0145081_395_1129 | 244 |
| 470 | 3300049824 | Ga0501045_0540169 | Ga0501045_0540169_63_797 | 244 |
| 471 | 3300050489 | nmdc:mga03683_23931_c1 | nmdc:mga03683_23931_c1_721_1455 | 244 |
| 472 | 3300050490 | nmdc:mga03n38_326290_c1 | nmdc:mga03n38_326290_c1_32_766 | 244 |
| 473 | 3300050495 | nmdc:mga04h51_6132_c1 | nmdc:mga04h51_6132_c1_1730_2464 | 244 |
| 474 | 3300050496 | nmdc:mga07m45_26648_c1 | nmdc:mga07m45_26648_c1_911_1645 | 244 |
| 475 | 3300050507 | nmdc:mga05p37_15521_c1 | nmdc:mga05p37_15521_c1_512_1291 | 244 |
| 476 | 3300050507 | nmdc:mga05p37_481_c1 | nmdc:mga05p37_481_c1_26422_27165 | 244 |
| 477 | 3300050507 | nmdc:mga05p37_52911_c1 | nmdc:mga05p37_52911_c1_1058_1801 | 244 |
| 478 | 3300050507 | nmdc:mga05p37_7764_c1 | nmdc:mga05p37_7764_c1_7646_8380 | 244 |
| 479 | 3300050508 | nmdc:mga09592_1486_c1 | nmdc:mga09592_1486_c1_17319_18062 | 244 |
| 480 | 3300050508 | nmdc:mga09592_18531_c1 | nmdc:mga09592_18531_c1_583_1362 | 244 |
| 481 | 3300050508 | nmdc:mga09592_76809_c1 | nmdc:mga09592_76809_c1_1897_2640 | 244 |
| 482 | 3300050508 | nmdc:mga09592_790_c1 | nmdc:mga09592_790_c1_21875_22609 | 244 |
| 483 | 3300050509 | nmdc:mga0qj67_13824_c1 | nmdc:mga0qj67_13824_c1_2948_3682 | 244 |
| 484 | 3300050509 | nmdc:mga0qj67_18090_c1 | nmdc:mga0qj67_18090_c1_4136_4936 | 244 |
| 485 | 3300050509 | nmdc:mga0qj67_24283_c1 | nmdc:mga0qj67_24283_c1_1638_2381 | 244 |
| 486 | 3300050509 | nmdc:mga0qj67_4547_c1 | nmdc:mga0qj67_4547_c1_5043_5777 | 244 |
| 487 | 3300050510 | nmdc:mga06r32_10652_c1 | nmdc:mga06r32_10652_c1_5649_6383 | 244 |
| 488 | 3300050510 | nmdc:mga06r32_32_c1 | nmdc:mga06r32_32_c1_34247_34990 | 244 |
| 489 | 3300050510 | nmdc:mga06r32_92816_c1 | nmdc:mga06r32_92816_c1_1029_1772 | 244 |
| 490 | 3300050512 | nmdc:mga0n895_16745_c1 | nmdc:mga0n895_16745_c1_4752_5495 | 244 |
| 491 | 3300050515 | nmdc:mga0a205_9218_c1 | nmdc:mga0a205_9218_c1_3915_4658 | 244 |
| 492 | 3300053084 | Ga0495595_0208110 | Ga0495595_0208110_171_932 | 244 |
| 493 | 3300053090 | Ga0500646_0000287 | Ga0500646_0000287_12418_13161 | 244 |
| 494 | 3300053149 | Ga0500600_0120797 | Ga0500600_0120797_195_929 | 244 |
| 495 | 3300053153 | Ga0500616_0002369 | Ga0500616_0002369_14029_14787 | 244 |
| 496 | 3300059424 | Ga0590075_047133 | Ga0590075_047133_217_960 | 244 |
| 497 | 3300061734 | Ga0530510_0341537 | Ga0530510_0341537_31_765 | 244 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5bv3-assembly2.cif.gz_C | yeast scavenger decapping enzyme in complex with m7gdp | 0.7716 | 11 | 45 |
| 6trq-assembly2.cif.gz_D | s.c. scavenger decapping enzyme dcps in complex with the capped rna dinucleotide m7g-gu | 0.7714 | 11 | 45 |
| 5bv3-assembly1.cif.gz_B | yeast scavenger decapping enzyme in complex with m7gdp | 0.7698 | 11 | 45 |
| 5bv3-assembly1.cif.gz_A | yeast scavenger decapping enzyme in complex with m7gdp | 0.7664 | 11 | 45 |
| 5h3x-assembly1.cif.gz_A | the structure of the n-terminal of the fibronectin/fibrinogen-binding protein from streptococcus suis (fbps) | 0.7344 | 12 | 42 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5bv3C01 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Scavenger mRNA decapping enzyme, N-terminal domain | 0.7716 | 11 | 45 | 3.30.200.40 |
| af_E7FEY1_207_349_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.7609 | 10 | 40 | 3.30.200.20 |
| 2ppqA01 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.7443 | 13 | 87 | 3.30.200.20 |
| af_A0A1D6L995_64_160_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.7406 | 11 | 65 | 3.30.200.20 |
| 2q83B01 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.74 | 3 | 88 | 3.30.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S3LRW4-F1-model_v4 | Aminoglycoside phosphotransferase | 0.9982 | 90 | 244 |
GO:0016740
|
| AF-A0A7W6YPP2-F1-model_v4 | deleted | 0.996 | 56 | 244 |
|
| AF-A0A829XYT2-F1-model_v4 | deleted | 0.9949 | 1 | 244 |
|
| AF-A0A1C5J9L4-F1-model_v4 | Ser/Thr protein kinase RdoA involved in Cpx stress response, MazF antagonist | 0.9947 | 2 | 244 |
GO:0016301
|
| AF-A0A7W1E3K7-F1-model_v4 | Phosphotransferase | 0.9943 | 1 | 244 |
GO:0016740
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar