F455017

General Info

Members Datasets Scaffolds Average Seq Length
497 263 479 370

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1012100|Ga0079104_10121003
Length 412
Sequence MPLPGGQTRRGLSRQTPMTQSTFASQTAAAVATVTGASLLLPASVLAVTPAAGIDQSGMPGIAPLGAGGIAGGKRPLVFGHRGASALRPEHTLAAYAKAIVDGADYVEPDLCSTKDGVLVARHEAYLSETTDVASHKQFASRKTRKTIDGEAHDGWFVDDFTLAELKTLRAVERIPQFRPGSAEYNGMFQVVTFEEIIDFVAAEAAAHGRIIGIVPELKHSTYFASVGLPLEDRFLSIIAAHDYTRRNPVQIQSFEVANLKYLRSKLGGKQGTRANLRLMQLVVGEDVRPMDVAAAGGKLTFAQMCTPAGLRDIAAYADVVAPPTRSIIPLKKDGSLAAPSSLVEDAHQAGLRIEPWTFRPENRFLAADFRNGADTARNEAGSIAEMKRYIATGIDGFFTDDPALGRAALAG

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221645 Massilia sp. Root351 Isolate Unclassified
3 2738541297 Duganella sp. GV083 Isolate Unclassified
4 2738541357 Duganella sp. GV053 Isolate Unclassified
5 2738543003 Duganella sp. GV066 Isolate Unclassified
6 2738543026 Duganella sp. GV089 Isolate Unclassified
7 2738543029 Duganella sp. GV039 Isolate Unclassified
8 2821131069 Duganella sp. 1224 Isolate Unclassified
9 2842711865 Duganella sp. R-73148 Isolate Unclassified
10 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
11 2857553236 Duganella sp. R-74557 Isolate Unclassified
12 2857558681 Duganella sp. R-74565 Isolate Unclassified
13 2857564685 Duganella sp. R-74599 Isolate Unclassified
14 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
15 2904424332 Duganella sp. 1411 Isolate Rhizosphere
16 2919476304 Duganella sp. 3397 Isolate Unclassified
17 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
18 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
23 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
24 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
25 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
29 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
30 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
104 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
169 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
170 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
173 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
182 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
183 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
187 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
191 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
198 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
199 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
200 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
201 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
205 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
206 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
214 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
220 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
221 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
225 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
226 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
227 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
228 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
229 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
236 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
239 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
247 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
250 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
254 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
255 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
256 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
257 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
258 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
259 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
260 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
261 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
262 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
263 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.38
Metatranscriptomes 0
Isolates 3.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.86
Nodule 0.4
Rhizoplane 1.41
Rhizosphere 76.46
Stem 0
Stem Tuber 0
Unclassified 11.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10001696 3300001989 Bacteria 8374
2 JGI24739J22299_10018418 3300001989 Bacteria 2510
3 JGI24739J22299_10021643 3300001989 Bacteria 2287
4 JGI24737J22298_10000864 3300001990 Bacteria 10811
5 JGI24737J22298_10002862 3300001990 Bacteria 6112
6 JGI24735J21928_10001679 3300002067 Bacteria 7828
7 JGI24738J21930_10003391 3300002075 Bacteria 4028
8 JGI24751J29686_10000387 3300002459 Bacteria 14778
9 JGI25158J39367_1000633 3300002739 Bacteria 6946
10 JGI25165J46597_1000188 3300003214 Bacteria 92329
11 JGI25153J46596_10033832 3300003215 Bacteria 1680
12 rootL2_10106073 3300003322 Bacteria 2609
13 JGI25161J50226_1000390 3300003374 Bacteria 22180
14 Ga0055525_1000028 3300003759 Bacteria 331683
15 Ga0055529_1000407 3300003763 Bacteria 45450
16 Ga0055526_1000366 3300003771 Bacteria 36475
17 Ga0055526_1000591 3300003771 Bacteria 28506
18 Ga0055537_1000062 3300003773 Bacteria 77862
19 Ga0055537_1000451 3300003773 Bacteria 26082
20 Ga0055524_1002341 3300003775 Bacteria 9852
21 Ga0055534_1000019 3300003784 Bacteria 137920
22 Ga0055528_1000048 3300003790 Bacteria 95179
23 Ga0055543_1000450 3300004625 Bacteria 24809
24 Ga0055543_1005027 3300004625 Bacteria 3452
25 Ga0065165_1000111 3300005262 Bacteria 136009
26 Ga0065165_1001392 3300005262 Bacteria 26467
27 Ga0070658_10041598 3300005327 Bacteria 3708
28 Ga0070658_10070822 3300005327 Bacteria 2855
29 Ga0070670_100000003 3300005331 Bacteria 529510
30 Ga0068869_100000848 3300005334 Bacteria 17540
31 Ga0070666_10012477 3300005335 Bacteria 5361
32 Ga0068868_100000154 3300005338 Bacteria 44616
33 Ga0070660_100000544 3300005339 Bacteria 25288
34 Ga0070660_100102891 3300005339 Bacteria 2264
35 Ga0070660_100149194 3300005339 Bacteria 1879
36 Ga0070668_100002381 3300005347 Bacteria 13811
37 Ga0070669_100000084 3300005353 Bacteria 91046
38 Ga0070675_100008581 3300005354 Bacteria 7934
39 Ga0070671_100001022 3300005355 Bacteria 20561
40 Ga0070671_100011487 3300005355 Bacteria 7121
41 Ga0070674_100001435 3300005356 Bacteria 12682
42 Ga0070673_100000023 3300005364 Bacteria 91936
43 Ga0070659_100059344 3300005366 Bacteria 3021
44 Ga0070659_100149929 3300005366 Bacteria 1902
45 Ga0070667_100000886 3300005367 Bacteria 27667
46 Ga0070667_100001390 3300005367 Bacteria 21662
47 Ga0070667_100093295 3300005367 Bacteria 2592
48 Ga0070662_100015094 3300005457 Bacteria 5168
49 Ga0070681_10010127 3300005458 Bacteria 9293
50 Ga0068867_100000007 3300005459 Bacteria 148726
51 Ga0068853_100119408 3300005539 Bacteria 2350
52 Ga0070672_100288368 3300005543 Bacteria 1389
53 Ga0070693_100008581 3300005547 Bacteria 5047
54 Ga0070665_100000388 3300005548 Bacteria 64921
55 Ga0068855_100000029 3300005563 Bacteria 171278
56 Ga0068857_100015770 3300005577 Bacteria 6612
57 Ga0068854_100000027 3300005578 Bacteria 117836
58 Ga0068856_100004098 3300005614 Bacteria 14566
59 Ga0068856_100247632 3300005614 Bacteria 1797
60 Ga0068852_100004278 3300005616 Bacteria 10072
61 Ga0068859_100002121 3300005617 Bacteria 20201
62 Ga0068859_100321934 3300005617 Bacteria 1640
63 Ga0068864_100000005 3300005618 Bacteria 400840
64 Ga0068866_10012667 3300005718 Bacteria 3680
65 Ga0068863_100001275 3300005841 Bacteria 25115
66 Ga0068863_100001578 3300005841 Bacteria 22542
67 Ga0068860_100000013 3300005843 Bacteria 323055
68 Ga0068862_100000697 3300005844 Bacteria 34312
69 Ga0068862_100030628 3300005844 Bacteria 4535
70 Ga0097621_100002061 3300006237 Bacteria 13748
71 Ga0068871_100002074 3300006358 Bacteria 13555
72 Ga0068865_100000010 3300006881 Bacteria 159548
73 Ga0097620_100002121 3300006931 Bacteria 20201
74 Ga0097620_100321933 3300006931 Bacteria 1640
75 Ga0079104_1012100 3300006946 Bacteria 2734
76 Ga0105251_10000574 3300009011 Bacteria 34289
77 Ga0105240_10070818 3300009093 Bacteria 4313
78 Ga0105240_10110430 3300009093 Bacteria 3328
79 Ga0105245_10002089 3300009098 Bacteria 18117
80 Ga0105243_10000950 3300009148 Bacteria 27049
81 Ga0105243_10042667 3300009148 Bacteria 3552
82 Ga0105241_10084693 3300009174 Bacteria 2489
83 Ga0105242_10000210 3300009176 Bacteria 45627
84 Ga0105248_10001468 3300009177 Bacteria 26237
85 Ga0105248_10001700 3300009177 Bacteria 24495
86 Ga0105248_10007301 3300009177 Bacteria 12126
87 Ga0105237_10155826 3300009545 Bacteria 2281
88 Ga0105238_10027777 3300009551 Bacteria 5766
89 Ga0105249_10000417 3300009553 Bacteria 40603
90 Ga0105249_10027062 3300009553 Bacteria 5173
91 Ga0105239_10000980 3300010375 Bacteria 40069
92 Ga0105239_10004123 3300010375 Bacteria 17464
93 Ga0105239_10046782 3300010375 Bacteria 4741
94 Ga0105246_10000472 3300011119 Bacteria 21681
95 Ga0157371_10083142 3300013102 Bacteria 2267
96 Ga0157370_10000203 3300013104 Bacteria 75249
97 Ga0157374_10000830 3300013296 Bacteria 27049
98 Ga0157378_10001477 3300013297 Bacteria 21228
99 Ga0157372_10012786 3300013307 Bacteria 8944
100 Ga0157372_10021148 3300013307 Bacteria 7027
101 Ga0157372_10200471 3300013307 Bacteria 2311
102 Ga0157372_10311479 3300013307 Bacteria 1832
103 Ga0157372_10633681 3300013307 Bacteria 1245
104 Ga0157375_10002120 3300013308 Bacteria 17145
105 Ga0157380_10000041 3300014326 Bacteria 75943
106 Ga0182008_10000357 3300014497 Bacteria 35568
107 Ga0157376_10000047 3300014969 Bacteria 107974
108 Ga0182006_1000002 3300015261 Bacteria 887990
109 Ga0182006_1000021 3300015261 Bacteria 280808
110 Ga0182007_10000162 3300015262 Bacteria 46148
111 Ga0182007_10015196 3300015262 Bacteria 2879
112 Ga0182005_1000020 3300015265 Bacteria 278671
113 Ga0182005_1000029 3300015265 Bacteria 214132
114 Ga0163161_10050708 3300017792 Bacteria 3004
115 Ga0213872_10000975 3300021361 Bacteria 19998
116 Ga0213872_10001897 3300021361 Bacteria 12851
117 Ga0213872_10008134 3300021361 Bacteria 5089
118 Ga0209436_100062 3300025208 Bacteria 56841
119 Ga0209563_100011 3300025230 Bacteria 1187808
120 Ga0209646_1000087 3300025246 Bacteria 193273
121 Ga0209026_1002441 3300025250 Bacteria 6982
122 Ga0209026_1002852 3300025250 Bacteria 6102
123 Ga0209148_1000061 3300025254 Bacteria 349575
124 Ga0209148_1001013 3300025254 Bacteria 17719
125 Ga0209233_1000120 3300025261 Bacteria 233311
126 Ga0209565_1000017 3300025263 Bacteria 462438
127 Ga0209455_1000330 3300025272 Bacteria 45609
128 Ga0209455_1000692 3300025272 Bacteria 19864
129 Ga0209673_1000007 3300025273 Bacteria 634477
130 Ga0209130_1000139 3300025284 Bacteria 115951
131 Ga0209130_1000336 3300025284 Bacteria 53924
132 Ga0209675_1000009 3300025291 Bacteria 562872
133 Ga0209025_1008705 3300025294 Bacteria 7242
134 Ga0209564_1000009 3300025295 Bacteria 950196
135 Ga0209564_1000036 3300025295 Bacteria 423455
136 Ga0209564_1000045 3300025295 Bacteria 376549
137 Ga0209758_1000456 3300025297 Bacteria 68269
138 Ga0209256_1000091 3300025299 Bacteria 210945
139 Ga0207655_1006948 3300025728 Bacteria 7419
140 Ga0207655_1009877 3300025728 Bacteria 5873
141 Ga0207713_1002768 3300025735 Bacteria 12413
142 Ga0207642_10007810 3300025899 Bacteria 3631
143 Ga0207647_10005555 3300025904 Bacteria 9227
144 Ga0207647_10040018 3300025904 Bacteria 2954
145 Ga0207647_10150770 3300025904 Bacteria 1359
146 Ga0207705_10000316 3300025909 Bacteria 44059
147 Ga0207705_10000963 3300025909 Bacteria 23546
148 Ga0207705_10009514 3300025909 Bacteria 7072
149 Ga0207654_10091068 3300025911 Bacteria 1859
150 Ga0207695_10041776 3300025913 Bacteria 4905
151 Ga0207695_10132278 3300025913 Bacteria 2451
152 Ga0207671_10001304 3300025914 Bacteria 29270
153 Ga0207671_10103565 3300025914 Bacteria 2158
154 Ga0207657_10003918 3300025919 Bacteria 15794
155 Ga0207657_10121410 3300025919 Bacteria 2150
156 Ga0207657_10122603 3300025919 Bacteria 2138
157 Ga0207681_10000005 3300025923 Bacteria 555724
158 Ga0207694_10045106 3300025924 Bacteria 3405
159 Ga0207694_10048035 3300025924 Bacteria 3302
160 Ga0207650_10000004 3300025925 Bacteria 743372
161 Ga0207659_10024690 3300025926 Bacteria 4031
162 Ga0207644_10001031 3300025931 Bacteria 17843
163 Ga0207644_10159172 3300025931 Bacteria 1754
164 Ga0207690_10008359 3300025932 Bacteria 6144
165 Ga0207706_10004690 3300025933 Bacteria 12810
166 Ga0207706_10031591 3300025933 Bacteria 4717
167 Ga0207706_10111154 3300025933 Bacteria 2410
168 Ga0207686_10033791 3300025934 Bacteria 3055
169 Ga0207709_10000050 3300025935 Bacteria 234391
170 Ga0207709_10046973 3300025935 Bacteria 2623
171 Ga0207669_10041392 3300025937 Bacteria 2681
172 Ga0207704_10000020 3300025938 Bacteria 148847
173 Ga0207711_10001028 3300025941 Bacteria 26716
174 Ga0207711_10002707 3300025941 Bacteria 15647
175 Ga0207711_10005807 3300025941 Bacteria 10429
176 Ga0207689_10001541 3300025942 Bacteria 21894
177 Ga0207667_10000035 3300025949 Bacteria 301056
178 Ga0207651_10000005 3300025960 Bacteria 246132
179 Ga0207712_10000308 3300025961 Bacteria 44940
180 Ga0207668_10000772 3300025972 Bacteria 19601
181 Ga0207640_10000145 3300025981 Bacteria 51603
182 Ga0207640_10015331 3300025981 Bacteria 4434
183 Ga0207658_10000067 3300025986 Bacteria 116584
184 Ga0207658_10003849 3300025986 Bacteria 10572
185 Ga0207658_10010932 3300025986 Bacteria 6179
186 Ga0207677_10000373 3300026023 Bacteria 31103
187 Ga0207703_10179181 3300026035 Bacteria 1869
188 Ga0207639_10007809 3300026041 Bacteria 7304
189 Ga0207702_10012620 3300026078 Bacteria 7034
190 Ga0207641_10004468 3300026088 Bacteria 12112
191 Ga0207641_10004653 3300026088 Bacteria 11842
192 Ga0207648_10000017 3300026089 Bacteria 148699
193 Ga0207676_10000006 3300026095 Bacteria 681936
194 Ga0207674_10029429 3300026116 Bacteria 5782
195 Ga0207683_10029414 3300026121 Bacteria 4757
196 Ga0207698_10000712 3300026142 Bacteria 19239
197 Ga0207698_10091126 3300026142 Bacteria 2495
198 Ga0207698_10109382 3300026142 Bacteria 2312
199 Ga0209281_1011866 3300027111 Bacteria 1936
200 Ga0268266_10001970 3300028379 Bacteria 23039
201 Ga0268265_10000616 3300028380 Bacteria 35508
202 Ga0268264_10000039 3300028381 Bacteria 376641
203 Ga0268264_10000913 3300028381 Bacteria 30954
204 Ga0268264_10020157 3300028381 Bacteria 5449
205 Ga0307515_10136714 3300028794 Bacteria 2659
206 Ga0307513_10046357 3300031456 Bacteria 4740
207 Ga0307509_10000022 3300031507 Bacteria 247822
208 Ga0307414_10128848 3300032004 Bacteria 1960
209 Ga0395899_0002116 3300037312 Bacteria 16321
210 Ga0395900_0000322 3300037418 Bacteria 70864
211 Ga0395900_0108389 3300037418 Bacteria 2853
212 Ga0395905_0082091 3300037471 Bacteria 3020
213 Ga0395905_0118935 3300037471 Bacteria 2483
214 Ga0395901_0000332 3300038443 Bacteria 57814
215 Ga0395901_0000712 3300038443 Bacteria 38055
216 Ga0395901_0559257 3300038443 Bacteria 1158
217 Ga0237819_02012 3300038705 Bacteria 4528
218 Ga0436361_0089506 3300039447 Bacteria 38272
219 Ga0436361_0471040 3300039447 Bacteria 15880
220 Ga0436361_0887554 3300039447 Bacteria 20445
221 Ga0436361_1096673 3300039447 Bacteria 2304
222 Ga0451806_567525 3300041462 Bacteria 4260
223 Ga0451807_2303118 3300041486 Bacteria 3580
224 Ga0451833_0691704 3300041491 Bacteria 1744
225 Ga0439448_0000332 3300042005 Bacteria 10506
226 Ga0439448_0003494 3300042005 Bacteria 4352
227 Ga0439455_0000252 3300042012 Bacteria 6482
228 Ga0439455_0000304 3300042012 Bacteria 6168
229 Ga0439458_0000255 3300042157 Bacteria 12956
230 Ga0439458_0000305 3300042157 Bacteria 12201
231 Ga0466972_0002161 3300044658 Bacteria 9648
232 Ga0466965_0029309 3300044683 Bacteria 2678
233 Ga0466965_0155838 3300044683 Bacteria 1196
234 Ga0466968_0072018 3300044735 Bacteria 1506
235 Ga0466970_0027698 3300044765 Bacteria 2974
236 Ga0466960_0012052 3300044901 Bacteria 3639
237 Ga0466959_0224286 3300045049 Bacteria 1302
238 Ga0466958_0030310 3300045836 Bacteria 3212
239 Ga0466958_0191697 3300045836 Bacteria 1299
240 Ga0495617_000006 3300046452 Bacteria 398279
241 Ga0495617_002143 3300046452 Bacteria 8114
242 Ga0495617_003370 3300046452 Bacteria 6022
243 Ga0495617_013183 3300046452 Bacteria 2815
244 Ga0495627_000005 3300046453 Bacteria 630805
245 Ga0495590_0000003 3300046457 Bacteria 478593
246 Ga0495638_0000198 3300046460 Bacteria 86199
247 Ga0495638_0011182 3300046460 Bacteria 6198
248 Ga0495653_0000011 3300046463 Bacteria 272314
249 Ga0495650_0000015 3300046471 Bacteria 557595
250 Ga0495650_0000131 3300046471 Bacteria 174698
251 Ga0495650_0000189 3300046471 Bacteria 133931
252 Ga0495650_0000339 3300046471 Bacteria 83278
253 Ga0495650_0001195 3300046471 Bacteria 27437
254 Ga0495650_0017461 3300046471 Bacteria 3597
255 Ga0495605_0000003 3300046474 Bacteria 491502
256 Ga0495639_0019942 3300046475 Bacteria 2927
257 Ga0495584_0001074 3300046491 Bacteria 16979
258 Ga0495584_0004303 3300046491 Bacteria 7675
259 Ga0495584_0004746 3300046491 Bacteria 7276
260 Ga0495585_0001792 3300046492 Bacteria 16324
261 Ga0495585_0001983 3300046492 Bacteria 15214
262 Ga0495585_0004903 3300046492 Bacteria 8574
263 Ga0495596_0000359 3300046500 Bacteria 29317
264 Ga0495596_0012606 3300046500 Bacteria 3612
265 Ga0495607_0004417 3300046501 Bacteria 10356
266 Ga0495607_0005378 3300046501 Bacteria 9187
267 Ga0495607_0005421 3300046501 Bacteria 9135
268 Ga0495607_0006440 3300046501 Bacteria 8264
269 Ga0495607_0021458 3300046501 Bacteria 4063
270 Ga0495583_0000033 3300046506 Bacteria 246882
271 Ga0495583_0000060 3300046506 Bacteria 199091
272 Ga0495583_0000165 3300046506 Bacteria 111940
273 Ga0495583_0000265 3300046506 Bacteria 86085
274 Ga0495583_0053552 3300046506 Bacteria 1831
275 Ga0495606_0000068 3300046507 Bacteria 179653
276 Ga0495606_0000304 3300046507 Bacteria 84652
277 Ga0495606_0001448 3300046507 Bacteria 31815
278 Ga0495606_0001581 3300046507 Bacteria 29777
279 Ga0495606_0001638 3300046507 Bacteria 29168
280 Ga0495606_0001656 3300046507 Bacteria 28966
281 Ga0495606_0008588 3300046507 Bacteria 8841
282 Ga0495606_0011131 3300046507 Bacteria 7373
283 Ga0495606_0079839 3300046507 Bacteria 2037
284 Ga0495606_0117352 3300046507 Bacteria 1597
285 Ga0495606_0162843 3300046507 Bacteria 1300
286 Ga0495610_0000004 3300046512 Bacteria 1006135
287 Ga0495610_0000669 3300046512 Bacteria 33348
288 Ga0495610_0027246 3300046512 Bacteria 3039
289 Ga0495616_0001483 3300046513 Bacteria 16267
290 Ga0495616_0008581 3300046513 Bacteria 6037
291 Ga0495616_0017476 3300046513 Bacteria 3956
292 Ga0495616_0089918 3300046513 Bacteria 1455
293 Ga0495616_0131214 3300046513 Bacteria 1148
294 Ga0495631_0000750 3300046518 Bacteria 20777
295 Ga0495631_0001299 3300046518 Bacteria 15314
296 Ga0495632_0003011 3300046519 Bacteria 12299
297 Ga0495632_0082001 3300046519 Bacteria 1537
298 Ga0495637_0000747 3300046520 Bacteria 21946
299 Ga0495643_0000106 3300046522 Bacteria 138657
300 Ga0495643_0000902 3300046522 Bacteria 31450
301 Ga0495643_0032393 3300046522 Bacteria 2902
302 Ga0495643_0066802 3300046522 Bacteria 1896
303 Ga0495644_0000624 3300046523 Bacteria 14822
304 Ga0495644_0000854 3300046523 Bacteria 12569
305 Ga0495648_0000087 3300046524 Bacteria 116394
306 Ga0495648_0000456 3300046524 Bacteria 44289
307 Ga0495648_0008685 3300046524 Bacteria 7964
308 Ga0495648_0022146 3300046524 Bacteria 4383
309 Ga0495648_0052523 3300046524 Bacteria 2475
310 Ga0495642_0000767 3300046528 Bacteria 15723
311 Ga0495642_0007637 3300046528 Bacteria 4146
312 Ga0495642_0065706 3300046528 Bacteria 1511
313 Ga0495654_0000035 3300046530 Bacteria 192768
314 Ga0495609_0000293 3300046538 Bacteria 46162
315 Ga0495609_0000996 3300046538 Bacteria 20156
316 Ga0495609_0002236 3300046538 Bacteria 12103
317 Ga0495609_0010890 3300046538 Bacteria 4344
318 Ga0495609_0014079 3300046538 Bacteria 3765
319 Ga0495609_0021580 3300046538 Bacteria 2971
320 Ga0495609_0042192 3300046538 Bacteria 2049
321 Ga0495597_0000119 3300046542 Bacteria 71150
322 Ga0495597_0000273 3300046542 Bacteria 46966
323 Ga0495622_0000004 3300046557 Bacteria 258984
324 Ga0495622_0000498 3300046557 Bacteria 24660
325 Ga0495622_0008114 3300046557 Bacteria 4866
326 Ga0495622_0034780 3300046557 Bacteria 2350
327 Ga0495633_0000617 3300046558 Bacteria 33789
328 Ga0495633_0001445 3300046558 Bacteria 18469
329 Ga0495633_0001486 3300046558 Bacteria 18179
330 Ga0495633_0005153 3300046558 Bacteria 8095
331 Ga0495633_0007281 3300046558 Bacteria 6397
332 Ga0495633_0007560 3300046558 Bacteria 6235
333 Ga0495633_0012880 3300046558 Bacteria 4427
334 Ga0495633_0016536 3300046558 Bacteria 3801
335 Ga0495656_0001555 3300046615 Bacteria 7501
336 Ga0495656_0008629 3300046615 Bacteria 3645
337 Ga0495656_0058264 3300046615 Bacteria 1675
338 Ga0495668_0000018 3300046616 Bacteria 417480
339 Ga0495668_0000104 3300046616 Bacteria 134968
340 Ga0495668_0001257 3300046616 Bacteria 25275
341 Ga0495668_0001909 3300046616 Bacteria 18614
342 Ga0495668_0043248 3300046616 Bacteria 2506
343 Ga0495611_0000992 3300046648 Bacteria 15071
344 Ga0495611_0001776 3300046648 Bacteria 10398
345 Ga0495625_0000038 3300046660 Bacteria 211808
346 Ga0495625_0000335 3300046660 Bacteria 71730
347 Ga0495625_0010738 3300046660 Bacteria 7538
348 Ga0495625_0043220 3300046660 Bacteria 3269
349 Ga0495625_0060507 3300046660 Bacteria 2683
350 Ga0495625_0097716 3300046660 Bacteria 2020
351 Ga0495625_0134330 3300046660 Bacteria 1673
352 Ga0495625_0151662 3300046660 Bacteria 1557
353 Ga0495659_0000397 3300046664 Bacteria 16662
354 Ga0495661_0000324 3300046665 Bacteria 52421
355 Ga0495661_0022896 3300046665 Bacteria 4060
356 Ga0495661_0046638 3300046665 Bacteria 2644
357 Ga0495661_0061247 3300046665 Bacteria 2234
358 Ga0495588_0000172 3300046674 Bacteria 81934
359 Ga0495588_0067834 3300046674 Bacteria 1852
360 Ga0495669_0001330 3300046684 Bacteria 10221
361 Ga0495669_0037689 3300046684 Bacteria 2140
362 Ga0495670_0000931 3300046691 Bacteria 14148
363 Ga0495670_0002420 3300046691 Bacteria 9211
364 Ga0495670_0015948 3300046691 Bacteria 3693
365 Ga0495671_0000001 3300046692 Bacteria 1169494
366 Ga0495671_0006624 3300046692 Bacteria 6678
367 Ga0495671_0014070 3300046692 Bacteria 4313
368 Ga0495671_0035481 3300046692 Bacteria 2532
369 Ga0495589_0024804 3300046794 Bacteria 3046
370 Ga0495660_0000126 3300046810 Bacteria 84046
371 Ga0495660_0001205 3300046810 Bacteria 18096
372 Ga0495660_0008367 3300046810 Bacteria 6052
373 Ga0495660_0011189 3300046810 Bacteria 5208
374 Ga0495660_0066474 3300046810 Bacteria 1922
375 Ga0495636_0000323 3300047318 Bacteria 18272
376 Ga0495672_0000032 3300047320 Bacteria 295356
377 Ga0495672_0000141 3300047320 Bacteria 106630
378 Ga0495672_0006210 3300047320 Bacteria 9319
379 Ga0495672_0123895 3300047320 Bacteria 1369
380 Ga0495676_0043551 3300047321 Bacteria 3671
381 Ga0495676_0051098 3300047321 Bacteria 3310
382 Ga0495683_0004190 3300047323 Bacteria 8240
383 Ga0495683_0005815 3300047323 Bacteria 6788
384 Ga0495683_0036403 3300047323 Bacteria 2498
385 Ga0495687_000173 3300047443 Bacteria 95361
386 Ga0495687_001010 3300047443 Bacteria 28108
387 Ga0495687_002259 3300047443 Bacteria 15808
388 Ga0495687_009416 3300047443 Bacteria 5462
389 Ga0495687_017487 3300047443 Bacteria 3575
390 Ga0495677_0000185 3300047445 Bacteria 28982
391 Ga0495677_0001794 3300047445 Bacteria 8593
392 Ga0495677_0020491 3300047445 Bacteria 2397
393 Ga0495685_000027 3300047447 Bacteria 62875
394 Ga0495673_0000006 3300047469 Bacteria 908691
395 Ga0495673_0000024 3300047469 Bacteria 521349
396 Ga0495673_0000141 3300047469 Bacteria 128600
397 Ga0495673_0025814 3300047469 Bacteria 2816
398 Ga0495673_0039632 3300047469 Bacteria 2136
399 Ga0495681_0000323 3300047470 Bacteria 38034
400 Ga0495681_0000900 3300047470 Bacteria 22976
401 Ga0495681_0005585 3300047470 Bacteria 8395
402 Ga0495686_0000147 3300047472 Bacteria 139008
403 Ga0495686_0000225 3300047472 Bacteria 104121
404 Ga0495686_0000407 3300047472 Bacteria 68110
405 Ga0495686_0000844 3300047472 Bacteria 39354
406 Ga0495686_0001226 3300047472 Bacteria 29331
407 Ga0495686_0001900 3300047472 Bacteria 20870
408 Ga0495686_0009599 3300047472 Bacteria 6953
409 Ga0495686_0012927 3300047472 Bacteria 5821
410 Ga0495686_0038895 3300047472 Bacteria 3041
411 Ga0495686_0047544 3300047472 Bacteria 2708
412 Ga0495626_0063968 3300048091 Bacteria 1667
413 Ga0496102_0122660 3300048905 Bacteria 2428
414 Ga0496103_0001278 3300048906 Bacteria 17158
415 Ga0496103_0002431 3300048906 Bacteria 11721
416 Ga0496113_0022033 3300048916 Bacteria 4500
417 Ga0496116_0009789 3300048919 Bacteria 8128
418 Ga0496116_0046608 3300048919 Bacteria 2925
419 Ga0496116_0081891 3300048919 Bacteria 1999
420 Ga0496116_0099483 3300048919 Bacteria 1741
421 Ga0496117_0000001 3300048920 Bacteria 2526244
422 Ga0496117_0007559 3300048920 Bacteria 10584
423 Ga0496117_0014903 3300048920 Bacteria 6666
424 Ga0496117_0037156 3300048920 Bacteria 3632
425 Ga0496117_0100800 3300048920 Bacteria 1828
426 Ga0496118_0000008 3300048921 Bacteria 644537
427 Ga0496118_0031397 3300048921 Bacteria 4404
428 Ga0496119_0061244 3300048922 Bacteria 2249
429 Ga0496120_0046529 3300048923 Bacteria 2507
430 Ga0496120_0071956 3300048923 Bacteria 1896
431 Ga0496121_0003499 3300048924 Bacteria 22330
432 Ga0496121_0005228 3300048924 Bacteria 16801
433 Ga0496121_0005483 3300048924 Bacteria 16244
434 Ga0496121_0009467 3300048924 Bacteria 11193
435 Ga0496121_0015509 3300048924 Bacteria 7976
436 Ga0496121_0053674 3300048924 Bacteria 3375
437 Ga0496121_0056640 3300048924 Bacteria 3254
438 Ga0496122_0006027 3300048925 Bacteria 14139
439 Ga0496122_0006290 3300048925 Bacteria 13694
440 Ga0496122_0009790 3300048925 Bacteria 10009
441 Ga0496122_0017615 3300048925 Bacteria 6664
442 Ga0496122_0090148 3300048925 Bacteria 2093
443 Ga0496122_0161094 3300048925 Bacteria 1368
444 Ga0496123_0002569 3300048926 Bacteria 22100
445 Ga0496123_0003542 3300048926 Bacteria 17370
446 Ga0496123_0018098 3300048926 Bacteria 5629
447 Ga0496124_0125439 3300048927 Bacteria 2046
448 Ga0496125_0012910 3300048928 Bacteria 8247
449 Ga0496125_0018792 3300048928 Bacteria 6547
450 Ga0496125_0039508 3300048928 Bacteria 4061
451 Ga0496125_0089219 3300048928 Bacteria 2320
452 Ga0496126_0003811 3300048929 Bacteria 18697
453 Ga0496126_0050681 3300048929 Bacteria 3782
454 Ga0495678_000016 3300049459 Bacteria 303426
455 Ga0495678_000101 3300049459 Bacteria 104596
456 Ga0495678_004137 3300049459 Bacteria 8577
457 Ga0495678_009262 3300049459 Bacteria 4889
458 Ga0495678_043885 3300049459 Bacteria 1773
459 Ga0495682_0000388 3300049460 Bacteria 31810
460 Ga0495682_0000800 3300049460 Bacteria 19901
461 Ga0495682_0010270 3300049460 Bacteria 3632
462 Ga0501036_0085766 3300049572 Bacteria 2662
463 Ga0501249_000185 3300049679 Bacteria 19045
464 Ga0501269_000195 3300049766 Bacteria 18239
465 Ga0501044_0010579 3300049823 Bacteria 10009
466 Ga0500643_001312 3300053087 Bacteria 14605
467 Ga0500566_0143230 3300053094 Bacteria 1266
468 Ga0500641_0013166 3300053096 Bacteria 3036
469 Ga0500555_000072 3300053103 Bacteria 49690
470 Ga0500594_0024621 3300053118 Bacteria 1535
471 Ga0500594_0039531 3300053118 Bacteria 1283
472 Ga0500607_001611 3300053121 Bacteria 19933
473 Ga0500608_093429 3300053122 Bacteria 1402
474 Ga0500618_000816 3300053125 Bacteria 17142
475 Ga0500586_000584 3300053145 Bacteria 7421
476 Ga0500586_001585 3300053145 Bacteria 4855
477 Ga0500616_0003309 3300053153 Bacteria 12426
478 Ga0500624_000053 3300053157 Bacteria 74086
479 Ga0500645_003142 3300053730 Bacteria 6871

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0100800 Ga0496117_0100800_18_914 298
2 3300038443 Ga0395901_0000332 Ga0395901_0000332_21114_22037 303
3 3300048925 Ga0496122_0161094 Ga0496122_0161094_26_949 307
4 3300046519 Ga0495632_0003011 Ga0495632_0003011_10946_12073 311
5 3300046665 Ga0495661_0061247 Ga0495661_0061247_867_1994 311
6 3300028381 Ga0268264_10000913 Ga0268264_1000091315 314
7 3300038443 Ga0395901_0559257 Ga0395901_0559257_98_1102 314
8 3300046452 Ga0495617_013183 Ga0495617_013183_166_1350 316
9 3300037418 Ga0395900_0108389 Ga0395900_0108389_1005_2129 323
10 3300037471 Ga0395905_0082091 Ga0395905_0082091_638_1762 323
11 3300037418 Ga0395900_0000322 Ga0395900_0000322_34616_35677 324
12 3300045836 Ga0466958_0030310 Ga0466958_0030310_917_2041 324
13 3300046506 Ga0495583_0000060 Ga0495583_0000060_75775_76785 325
14 3300046674 Ga0495588_0000172 Ga0495588_0000172_37465_38571 325
15 3300045836 Ga0466958_0191697 Ga0466958_0191697_19_1125 326
16 3300047472 Ga0495686_0001226 Ga0495686_0001226_13704_14849 326
17 3300046506 Ga0495583_0053552 Ga0495583_0053552_610_1752 327
18 3300046507 Ga0495606_0011131 Ga0495606_0011131_2740_3882 327
19 3300046558 Ga0495633_0012880 Ga0495633_0012880_53_1195 327
20 3300046501 Ga0495607_0006440 Ga0495607_0006440_7039_8226 328
21 3300046615 Ga0495656_0058264 Ga0495656_0058264_463_1650 328
22 3300047320 Ga0495672_0006210 Ga0495672_0006210_210_1397 328
23 3300003759 Ga0055525_1000028 Ga0055525_1000028274 329
24 3300025230 Ga0209563_100011 Ga0209563_10001135 329
25 3300038705 Ga0237819_02012 Ga0237819_02012_754_1791 330
26 3300047469 Ga0495673_0039632 Ga0495673_0039632_732_1838 330
27 3300048929 Ga0496126_0050681 Ga0496126_0050681_32_1024 330
28 iso_pu_bacteria 2885080285 2885086445 331
29 3300048916 Ga0496113_0022033 Ga0496113_0022033_1670_2815 333
30 3300048925 Ga0496122_0006290 Ga0496122_0006290_9885_11030 333
31 3300048928 Ga0496125_0089219 Ga0496125_0089219_362_1507 333
32 3300046492 Ga0495585_0004903 Ga0495585_0004903_752_1927 335
33 3300046501 Ga0495607_0021458 Ga0495607_0021458_2404_3582 335
34 3300046506 Ga0495583_0000165 Ga0495583_0000165_63100_64278 335
35 3300046513 Ga0495616_0089918 Ga0495616_0089918_166_1344 335
36 3300046519 Ga0495632_0082001 Ga0495632_0082001_56_1177 335
37 3300046523 Ga0495644_0000624 Ga0495644_0000624_9514_10692 335
38 3300046523 Ga0495644_0000854 Ga0495644_0000854_7365_8543 335
39 3300046524 Ga0495648_0000456 Ga0495648_0000456_6716_7894 335
40 3300046538 Ga0495609_0000996 Ga0495609_0000996_1541_2719 335
41 3300046615 Ga0495656_0001555 Ga0495656_0001555_112_1287 335
42 3300046648 Ga0495611_0000992 Ga0495611_0000992_7225_8403 335
43 3300046648 Ga0495611_0001776 Ga0495611_0001776_749_1927 335
44 3300046660 Ga0495625_0134330 Ga0495625_0134330_329_1507 335
45 3300046660 Ga0495625_0151662 Ga0495625_0151662_167_1342 335
46 3300046664 Ga0495659_0000397 Ga0495659_0000397_8860_10038 335
47 3300046692 Ga0495671_0014070 Ga0495671_0014070_2387_3565 335
48 3300047318 Ga0495636_0000323 Ga0495636_0000323_7784_8962 335
49 3300047323 Ga0495683_0005815 Ga0495683_0005815_218_1393 335
50 3300047443 Ga0495687_000173 Ga0495687_000173_19071_20249 335
51 3300047445 Ga0495677_0001794 Ga0495677_0001794_515_1693 335
52 3300047447 Ga0495685_000027 Ga0495685_000027_30848_32026 335
53 3300047469 Ga0495673_0025814 Ga0495673_0025814_216_1391 335
54 3300047472 Ga0495686_0000147 Ga0495686_0000147_79740_80861 335
55 3300047472 Ga0495686_0038895 Ga0495686_0038895_1368_2546 335
56 3300049459 Ga0495678_004137 Ga0495678_004137_6950_8128 335
57 3300049460 Ga0495682_0000388 Ga0495682_0000388_12651_13829 335
58 3300053096 Ga0500641_0013166 Ga0500641_0013166_837_1949 335
59 3300053125 Ga0500618_000816 Ga0500618_000816_15948_17072 335
60 3300003322 rootL2_10106073 rootL2_101060731 336
61 3300046513 Ga0495616_0008581 Ga0495616_0008581_3259_4434 336
62 3300046538 Ga0495609_0000293 Ga0495609_0000293_12450_13625 336
63 3300046660 Ga0495625_0097716 Ga0495625_0097716_335_1510 336
64 3300047321 Ga0495676_0051098 Ga0495676_0051098_1003_2139 336
65 3300009177 Ga0105248_10001468 Ga0105248_100014683 337
66 3300025941 Ga0207711_10001028 Ga0207711_1000102810 337
67 3300031507 Ga0307509_10000022 Ga0307509_10000022218 337
68 3300046557 Ga0495622_0000004 Ga0495622_0000004_112150_113289 337
69 3300046684 Ga0495669_0001330 Ga0495669_0001330_6790_7965 337
70 3300046810 Ga0495660_0001205 Ga0495660_0001205_4239_5399 337
71 3300047443 Ga0495687_017487 Ga0495687_017487_934_2109 337
72 3300047445 Ga0495677_0020491 Ga0495677_0020491_1190_2365 337
73 3300047470 Ga0495681_0005585 Ga0495681_0005585_4984_6159 337
74 3300047472 Ga0495686_0012927 Ga0495686_0012927_1396_2556 337
75 3300002459 JGI24751J29686_10000387 JGI24751J29686_1000038710 338
76 3300005331 Ga0070670_100000003 Ga0070670_100000003237 338
77 3300005353 Ga0070669_100000084 Ga0070669_10000008423 338
78 3300005367 Ga0070667_100000886 Ga0070667_1000008864 338
79 3300005617 Ga0068859_100002121 Ga0068859_1000021219 338
80 3300005618 Ga0068864_100000005 Ga0068864_100000005102 338
81 3300006931 Ga0097620_100002121 Ga0097620_1000021219 338
82 3300009177 Ga0105248_10001700 Ga0105248_1000170017 338
83 3300009553 Ga0105249_10027062 Ga0105249_100270624 338
84 3300014326 Ga0157380_10000041 Ga0157380_1000004134 338
85 3300025923 Ga0207681_10000005 Ga0207681_10000005495 338
86 3300025925 Ga0207650_10000004 Ga0207650_10000004234 338
87 3300025941 Ga0207711_10005807 Ga0207711_100058073 338
88 3300025986 Ga0207658_10003849 Ga0207658_1000384910 338
89 3300026095 Ga0207676_10000006 Ga0207676_10000006477 338
90 3300046500 Ga0495596_0000359 Ga0495596_0000359_24540_25685 338
91 3300031456 Ga0307513_10046357 Ga0307513_100463572 339
92 3300046452 Ga0495617_003370 Ga0495617_003370_2457_3644 339
93 3300046491 Ga0495584_0001074 Ga0495584_0001074_8059_9243 339
94 3300046513 Ga0495616_0001483 Ga0495616_0001483_7000_8184 339
95 3300046520 Ga0495637_0000747 Ga0495637_0000747_7031_8212 339
96 3300046530 Ga0495654_0000035 Ga0495654_0000035_85567_86748 339
97 3300046538 Ga0495609_0014079 Ga0495609_0014079_1541_2728 339
98 3300046660 Ga0495625_0060507 Ga0495625_0060507_12_1055 339
99 3300046665 Ga0495661_0046638 Ga0495661_0046638_46_1230 339
100 3300046691 Ga0495670_0002420 Ga0495670_0002420_766_1950 339
101 3300049460 Ga0495682_0000800 Ga0495682_0000800_6504_7691 339
102 3300048920 Ga0496117_0007559 Ga0496117_0007559_536_1642 340
103 3300048923 Ga0496120_0046529 Ga0496120_0046529_716_1822 340
104 3300048925 Ga0496122_0017615 Ga0496122_0017615_3968_5074 340
105 3300048926 Ga0496123_0003542 Ga0496123_0003542_5169_6275 340
106 3300044683 Ga0466965_0155838 Ga0466965_0155838_37_1143 341
107 3300046471 Ga0495650_0017461 Ga0495650_0017461_72_1202 341
108 3300048919 Ga0496116_0046608 Ga0496116_0046608_445_1650 341
109 3300005841 Ga0068863_100001275 Ga0068863_10000127516 342
110 3300005844 Ga0068862_100000697 Ga0068862_10000069718 342
111 3300013307 Ga0157372_10633681 Ga0157372_106336811 342
112 3300026088 Ga0207641_10004468 Ga0207641_100044683 342
113 3300028380 Ga0268265_10000616 Ga0268265_1000061615 342
114 3300046471 Ga0495650_0001195 Ga0495650_0001195_18696_19817 342
115 3300046507 Ga0495606_0001656 Ga0495606_0001656_22909_24030 342
116 3300021361 Ga0213872_10001897 Ga0213872_1000189713 343
117 3300025728 Ga0207655_1006948 Ga0207655_10069482 343
118 3300026142 Ga0207698_10109382 Ga0207698_101093822 343
119 3300039447 Ga0436361_0471040 Ga0436361_0471040_3718_4977 343
120 3300046512 Ga0495610_0027246 Ga0495610_0027246_1413_2606 343
121 3300046522 Ga0495643_0066802 Ga0495643_0066802_727_1821 343
122 3300046660 Ga0495625_0010738 Ga0495625_0010738_2433_3626 343
123 3300048905 Ga0496102_0122660 Ga0496102_0122660_285_1379 343
124 3300048906 Ga0496103_0001278 Ga0496103_0001278_9598_10800 343
125 3300048925 Ga0496122_0009790 Ga0496122_0009790_7346_8440 343
126 3300049572 Ga0501036_0085766 Ga0501036_0085766_818_1912 343
127 3300049766 Ga0501269_000195 Ga0501269_000195_3387_4592 343
128 3300053121 Ga0500607_001611 Ga0500607_001611_9069_10175 343
129 3300053730 Ga0500645_003142 Ga0500645_003142_1539_2645 343
130 3300013102 Ga0157371_10083142 Ga0157371_100831422 344
131 3300039447 Ga0436361_1096673 Ga0436361_1096673_182_1405 344
132 3300046507 Ga0495606_0001448 Ga0495606_0001448_17427_18611 344
133 3300005339 Ga0070660_100149194 Ga0070660_1001491942 345
134 3300005458 Ga0070681_10010127 Ga0070681_100101277 345
135 3300005547 Ga0070693_100008581 Ga0070693_1000085816 345
136 3300013307 Ga0157372_10311479 Ga0157372_103114792 345
137 3300015262 Ga0182007_10015196 Ga0182007_100151963 345
138 3300025919 Ga0207657_10121410 Ga0207657_101214104 345
139 3300025919 Ga0207657_10122603 Ga0207657_101226032 345
140 3300025932 Ga0207690_10008359 Ga0207690_100083593 345
141 3300026116 Ga0207674_10029429 Ga0207674_100294297 345
142 3300038443 Ga0395901_0000712 Ga0395901_0000712_33523_34665 345
143 3300046474 Ga0495605_0000003 Ga0495605_0000003_132379_133554 345
144 3300046692 Ga0495671_0035481 Ga0495671_0035481_30_1166 345
145 3300046810 Ga0495660_0000126 Ga0495660_0000126_8678_9916 345
146 3300053118 Ga0500594_0024621 Ga0500594_0024621_378_1484 345
147 3300009551 Ga0105238_10027777 Ga0105238_100277775 346
148 3300021361 Ga0213872_10000975 Ga0213872_1000097513 346
149 3300025254 Ga0209148_1000061 Ga0209148_1000061276 346
150 3300025924 Ga0207694_10048035 Ga0207694_100480352 346
151 3300039447 Ga0436361_0887554 Ga0436361_0887554_11907_13184 346
152 3300046528 Ga0495642_0065706 Ga0495642_0065706_99_1286 346
153 3300046660 Ga0495625_0000335 Ga0495625_0000335_5356_6561 346
154 3300047472 Ga0495686_0000407 Ga0495686_0000407_11319_12518 346
155 3300010375 Ga0105239_10046782 Ga0105239_100467823 347
156 3300009093 Ga0105240_10070818 Ga0105240_100708184 348
157 3300014497 Ga0182008_10000357 Ga0182008_1000035723 348
158 3300015261 Ga0182006_1000002 Ga0182006_100000279 348
159 3300015262 Ga0182007_10000162 Ga0182007_1000016230 348
160 3300015265 Ga0182005_1000029 Ga0182005_1000029100 348
161 3300021361 Ga0213872_10008134 Ga0213872_100081342 348
162 3300025913 Ga0207695_10041776 Ga0207695_100417762 348
163 3300032004 Ga0307414_10128848 Ga0307414_101288482 348
164 3300039447 Ga0436361_0089506 Ga0436361_0089506_455_1693 348
165 3300041491 Ga0451833_0691704 Ga0451833_0691704_319_1434 348
166 3300046460 Ga0495638_0011182 Ga0495638_0011182_3051_4172 348
167 3300046506 Ga0495583_0000033 Ga0495583_0000033_167612_168733 348
168 3300046507 Ga0495606_0079839 Ga0495606_0079839_67_1254 348
169 3300046513 Ga0495616_0131214 Ga0495616_0131214_58_1128 348
170 3300046557 Ga0495622_0034780 Ga0495622_0034780_1144_2274 348
171 3300046558 Ga0495633_0007560 Ga0495633_0007560_2278_3408 348
172 3300046616 Ga0495668_0000018 Ga0495668_0000018_116904_118094 348
173 3300046665 Ga0495661_0022896 Ga0495661_0022896_35_1177 348
174 3300046691 Ga0495670_0015948 Ga0495670_0015948_2450_3571 348
175 3300047443 Ga0495687_009416 Ga0495687_009416_4019_5125 348
176 3300048919 Ga0496116_0099483 Ga0496116_0099483_33_1163 348
177 3300048920 Ga0496117_0000001 Ga0496117_0000001_1998312_1999454 348
178 3300048921 Ga0496118_0000008 Ga0496118_0000008_116605_117747 348
179 3300048924 Ga0496121_0009467 Ga0496121_0009467_8194_9324 348
180 3300048924 Ga0496121_0015509 Ga0496121_0015509_5601_6731 348
181 3300048925 Ga0496122_0006027 Ga0496122_0006027_9438_10568 348
182 3300048926 Ga0496123_0018098 Ga0496123_0018098_1375_2505 348
183 3300048927 Ga0496124_0125439 Ga0496124_0125439_18_1139 348
184 3300049460 Ga0495682_0010270 Ga0495682_0010270_679_1800 348
185 3300053103 Ga0500555_000072 Ga0500555_000072_45035_46156 348
186 iso_pu_bacteria 2600255292 2601670763 348
187 iso_pu_bacteria 2857547612 2857552658 348
188 iso_pu_bacteria 2932410948 2932414974 348
189 iso_pu_bacteria 2932416698 2932419660 348
190 3300002739 JGI25158J39367_1000633 JGI25158J39367_10006334 349
191 3300003374 JGI25161J50226_1000390 JGI25161J50226_10003909 349
192 3300003763 Ga0055529_1000407 Ga0055529_10004073 349
193 3300003773 Ga0055537_1000062 Ga0055537_100006256 349
194 3300003773 Ga0055537_1000451 Ga0055537_10004514 349
195 3300003775 Ga0055524_1002341 Ga0055524_10023415 349
196 3300003784 Ga0055534_1000019 Ga0055534_100001939 349
197 3300003790 Ga0055528_1000048 Ga0055528_10000484 349
198 3300004625 Ga0055543_1000450 Ga0055543_100045023 349
199 3300005262 Ga0065165_1001392 Ga0065165_10013928 349
200 3300025208 Ga0209436_100062 Ga0209436_10006241 349
201 3300025250 Ga0209026_1002852 Ga0209026_10028522 349
202 3300025263 Ga0209565_1000017 Ga0209565_1000017316 349
203 3300025272 Ga0209455_1000330 Ga0209455_10003303 349
204 3300025273 Ga0209673_1000007 Ga0209673_1000007113 349
205 3300025284 Ga0209130_1000336 Ga0209130_100033636 349
206 3300025291 Ga0209675_1000009 Ga0209675_1000009405 349
207 3300025295 Ga0209564_1000036 Ga0209564_1000036113 349
208 3300025299 Ga0209256_1000091 Ga0209256_1000091113 349
209 3300037471 Ga0395905_0118935 Ga0395905_0118935_571_1695 349
210 3300046491 Ga0495584_0004303 Ga0495584_0004303_6570_7661 349
211 3300046492 Ga0495585_0001792 Ga0495585_0001792_3244_4350 349
212 3300046507 Ga0495606_0008588 Ga0495606_0008588_5430_6539 349
213 3300046518 Ga0495631_0000750 Ga0495631_0000750_14303_15409 349
214 3300046524 Ga0495648_0052523 Ga0495648_0052523_14_1237 349
215 3300046558 Ga0495633_0001445 Ga0495633_0001445_5653_6759 349
216 3300046665 Ga0495661_0000324 Ga0495661_0000324_39627_40733 349
217 3300046691 Ga0495670_0000931 Ga0495670_0000931_10291_11397 349
218 3300047320 Ga0495672_0000032 Ga0495672_0000032_36174_37388 349
219 3300047321 Ga0495676_0043551 Ga0495676_0043551_489_1598 349
220 3300047445 Ga0495677_0000185 Ga0495677_0000185_10330_11436 349
221 3300047470 Ga0495681_0000323 Ga0495681_0000323_11426_12532 349
222 3300047472 Ga0495686_0001900 Ga0495686_0001900_12840_13922 349
223 3300049459 Ga0495678_043885 Ga0495678_043885_486_1700 349
224 3300053087 Ga0500643_001312 Ga0500643_001312_7806_8900 349
225 3300004625 Ga0055543_1005027 Ga0055543_10050274 350
226 3300005262 Ga0065165_1000111 Ga0065165_100011196 350
227 3300025284 Ga0209130_1000139 Ga0209130_100013929 350
228 3300028794 Ga0307515_10136714 Ga0307515_101367143 350
229 3300048928 Ga0496125_0039508 Ga0496125_0039508_1479_2570 350
230 3300003215 JGI25153J46596_10033832 JGI25153J46596_100338322 351
231 3300003771 Ga0055526_1000366 Ga0055526_100036626 351
232 3300003771 Ga0055526_1000591 Ga0055526_100059116 351
233 3300005347 Ga0070668_100002381 Ga0070668_1000023813 351
234 3300005355 Ga0070671_100001022 Ga0070671_10000102210 351
235 3300005367 Ga0070667_100093295 Ga0070667_1000932952 351
236 3300005539 Ga0068853_100119408 Ga0068853_1001194082 351
237 3300005548 Ga0070665_100000388 Ga0070665_1000003883 351
238 3300005578 Ga0068854_100000027 Ga0068854_1000000278 351
239 3300005844 Ga0068862_100030628 Ga0068862_1000306282 351
240 3300006237 Ga0097621_100002061 Ga0097621_1000020613 351
241 3300006358 Ga0068871_100002074 Ga0068871_1000020743 351
242 3300009011 Ga0105251_10000574 Ga0105251_100005744 351
243 3300009174 Ga0105241_10084693 Ga0105241_100846932 351
244 3300009177 Ga0105248_10007301 Ga0105248_1000730110 351
245 3300010375 Ga0105239_10004123 Ga0105239_100041236 351
246 3300013307 Ga0157372_10200471 Ga0157372_102004712 351
247 3300025294 Ga0209025_1008705 Ga0209025_10087052 351
248 3300025295 Ga0209564_1000009 Ga0209564_1000009773 351
249 3300025295 Ga0209564_1000045 Ga0209564_1000045186 351
250 3300025297 Ga0209758_1000456 Ga0209758_100045663 351
251 3300025728 Ga0207655_1009877 Ga0207655_10098772 351
252 3300025735 Ga0207713_1002768 Ga0207713_10027687 351
253 3300025911 Ga0207654_10091068 Ga0207654_100910682 351
254 3300025924 Ga0207694_10045106 Ga0207694_100451061 351
255 3300025931 Ga0207644_10001031 Ga0207644_100010312 351
256 3300025941 Ga0207711_10002707 Ga0207711_100027073 351
257 3300025972 Ga0207668_10000772 Ga0207668_1000077212 351
258 3300025981 Ga0207640_10000145 Ga0207640_1000014534 351
259 3300025986 Ga0207658_10010932 Ga0207658_100109322 351
260 3300026035 Ga0207703_10179181 Ga0207703_101791811 351
261 3300026041 Ga0207639_10007809 Ga0207639_100078097 351
262 3300026088 Ga0207641_10004653 Ga0207641_100046534 351
263 3300028379 Ga0268266_10001970 Ga0268266_1000197015 351
264 3300028381 Ga0268264_10020157 Ga0268264_100201572 351
265 3300046471 Ga0495650_0000131 Ga0495650_0000131_74541_75746 351
266 3300046471 Ga0495650_0000189 Ga0495650_0000189_75474_76679 351
267 3300046491 Ga0495584_0004746 Ga0495584_0004746_2899_4038 351
268 3300046500 Ga0495596_0012606 Ga0495596_0012606_670_1809 351
269 3300046501 Ga0495607_0004417 Ga0495607_0004417_6134_7273 351
270 3300046501 Ga0495607_0005378 Ga0495607_0005378_2654_3859 351
271 3300046513 Ga0495616_0017476 Ga0495616_0017476_776_1915 351
272 3300046518 Ga0495631_0001299 Ga0495631_0001299_1236_2375 351
273 3300046528 Ga0495642_0007637 Ga0495642_0007637_2093_3232 351
274 3300046538 Ga0495609_0010890 Ga0495609_0010890_2947_4092 351
275 3300046538 Ga0495609_0042192 Ga0495609_0042192_133_1272 351
276 3300046558 Ga0495633_0007281 Ga0495633_0007281_37_1242 351
277 3300046615 Ga0495656_0008629 Ga0495656_0008629_370_1509 351
278 3300046616 Ga0495668_0043248 Ga0495668_0043248_1054_2199 351
279 3300046674 Ga0495588_0067834 Ga0495588_0067834_263_1405 351
280 3300046684 Ga0495669_0037689 Ga0495669_0037689_522_1661 351
281 3300046794 Ga0495589_0024804 Ga0495589_0024804_816_1955 351
282 3300047320 Ga0495672_0123895 Ga0495672_0123895_29_1168 351
283 3300048091 Ga0495626_0063968 Ga0495626_0063968_43_1182 351
284 3300048906 Ga0496103_0002431 Ga0496103_0002431_244_1359 351
285 3300048919 Ga0496116_0009789 Ga0496116_0009789_6420_7535 351
286 3300048920 Ga0496117_0037156 Ga0496117_0037156_762_1877 351
287 3300048924 Ga0496121_0005483 Ga0496121_0005483_13840_14955 351
288 3300048928 Ga0496125_0018792 Ga0496125_0018792_3874_4989 351
289 3300049459 Ga0495678_009262 Ga0495678_009262_2635_3774 351
290 3300053153 Ga0500616_0003309 Ga0500616_0003309_4880_5992 351
291 iso_pu_bacteria 2857564685 2857565324 351
292 iso_pu_bacteria 2919476304 2919481131 351
293 3300006946 Ga0079104_1012100 Ga0079104_10121003 352
294 3300009553 Ga0105249_10000417 Ga0105249_1000041722 352
295 3300015261 Ga0182006_1000021 Ga0182006_100002159 352
296 3300015265 Ga0182005_1000020 Ga0182005_1000020111 352
297 3300025246 Ga0209646_1000087 Ga0209646_1000087164 352
298 3300025961 Ga0207712_10000308 Ga0207712_1000030812 352
299 3300027111 Ga0209281_1011866 Ga0209281_10118662 352
300 3300046452 Ga0495617_000006 Ga0495617_000006_135803_137005 352
301 3300046463 Ga0495653_0000011 Ga0495653_0000011_13911_15113 352
302 3300046471 Ga0495650_0000015 Ga0495650_0000015_247132_248268 352
303 3300046471 Ga0495650_0000339 Ga0495650_0000339_43422_44624 352
304 3300046492 Ga0495585_0001983 Ga0495585_0001983_2320_3522 352
305 3300046507 Ga0495606_0000304 Ga0495606_0000304_9212_10420 352
306 3300046507 Ga0495606_0001581 Ga0495606_0001581_12650_13852 352
307 3300046512 Ga0495610_0000004 Ga0495610_0000004_92906_94108 352
308 3300046512 Ga0495610_0000669 Ga0495610_0000669_19_1227 352
309 3300046522 Ga0495643_0000902 Ga0495643_0000902_17053_18225 352
310 3300046524 Ga0495648_0008685 Ga0495648_0008685_2076_3278 352
311 3300046524 Ga0495648_0022146 Ga0495648_0022146_1735_2937 352
312 3300046542 Ga0495597_0000119 Ga0495597_0000119_55497_56669 352
313 3300046558 Ga0495633_0000617 Ga0495633_0000617_1993_3180 352
314 3300046558 Ga0495633_0016536 Ga0495633_0016536_1291_2493 352
315 3300046616 Ga0495668_0000104 Ga0495668_0000104_67544_68752 352
316 3300046616 Ga0495668_0001909 Ga0495668_0001909_8094_9296 352
317 3300046692 Ga0495671_0000001 Ga0495671_0000001_743950_745152 352
318 3300046810 Ga0495660_0008367 Ga0495660_0008367_1383_2585 352
319 3300047323 Ga0495683_0004190 Ga0495683_0004190_437_1639 352
320 3300047323 Ga0495683_0036403 Ga0495683_0036403_280_1413 352
321 3300047443 Ga0495687_001010 Ga0495687_001010_12608_13780 352
322 3300047443 Ga0495687_002259 Ga0495687_002259_179_1351 352
323 3300047469 Ga0495673_0000006 Ga0495673_0000006_384357_385550 352
324 3300047469 Ga0495673_0000141 Ga0495673_0000141_14273_15475 352
325 3300047472 Ga0495686_0009599 Ga0495686_0009599_161_1369 352
326 3300048924 Ga0496121_0053674 Ga0496121_0053674_1852_3054 352
327 3300048925 Ga0496122_0090148 Ga0496122_0090148_53_1255 352
328 3300048926 Ga0496123_0002569 Ga0496123_0002569_8127_9329 352
329 3300048929 Ga0496126_0003811 Ga0496126_0003811_7264_8457 352
330 3300049459 Ga0495678_000016 Ga0495678_000016_210944_212173 352
331 3300053145 Ga0500586_001585 Ga0500586_001585_2876_4078 352
332 iso_pu_bacteria 2643221645 2644254049 352
333 iso_pu_bacteria 2738541297 2738824918 352
334 iso_pu_bacteria 2738541357 2739148715 352
335 iso_pu_bacteria 2738543003 2739190634 352
336 iso_pu_bacteria 2738543026 2739317111 352
337 iso_pu_bacteria 2738543029 2739335352 352
338 iso_pu_bacteria 2821131069 2821133531 352
339 iso_pu_bacteria 2857553236 2857553659 352
340 iso_pu_bacteria 2904424332 2904426632 352
341 3300046452 Ga0495617_002143 Ga0495617_002143_5083_6273 353
342 3300046453 Ga0495627_000005 Ga0495627_000005_236269_237489 353
343 3300046457 Ga0495590_0000003 Ga0495590_0000003_195226_196401 353
344 3300046460 Ga0495638_0000198 Ga0495638_0000198_70225_71400 353
345 3300046475 Ga0495639_0019942 Ga0495639_0019942_34_1209 353
346 3300046501 Ga0495607_0005421 Ga0495607_0005421_5788_6963 353
347 3300046506 Ga0495583_0000265 Ga0495583_0000265_14767_15942 353
348 3300046507 Ga0495606_0000068 Ga0495606_0000068_31580_32740 353
349 3300046507 Ga0495606_0001638 Ga0495606_0001638_13890_15104 353
350 3300046507 Ga0495606_0117352 Ga0495606_0117352_317_1513 353
351 3300046522 Ga0495643_0000106 Ga0495643_0000106_68958_70142 353
352 3300046522 Ga0495643_0032393 Ga0495643_0032393_110_1342 353
353 3300046524 Ga0495648_0000087 Ga0495648_0000087_11719_12894 353
354 3300046528 Ga0495642_0000767 Ga0495642_0000767_8221_9396 353
355 3300046538 Ga0495609_0002236 Ga0495609_0002236_7073_8278 353
356 3300046538 Ga0495609_0021580 Ga0495609_0021580_1296_2480 353
357 3300046542 Ga0495597_0000273 Ga0495597_0000273_19408_20589 353
358 3300046557 Ga0495622_0000498 Ga0495622_0000498_12147_13322 353
359 3300046558 Ga0495633_0001486 Ga0495633_0001486_14968_16143 353
360 3300046616 Ga0495668_0001257 Ga0495668_0001257_5455_6630 353
361 3300046660 Ga0495625_0000038 Ga0495625_0000038_115749_116924 353
362 3300046660 Ga0495625_0043220 Ga0495625_0043220_2011_3207 353
363 3300046810 Ga0495660_0011189 Ga0495660_0011189_526_1701 353
364 3300046810 Ga0495660_0066474 Ga0495660_0066474_118_1350 353
365 3300047320 Ga0495672_0000141 Ga0495672_0000141_76_1260 353
366 3300047469 Ga0495673_0000024 Ga0495673_0000024_2587_3777 353
367 3300047470 Ga0495681_0000900 Ga0495681_0000900_13479_14711 353
368 3300047472 Ga0495686_0000225 Ga0495686_0000225_9010_10176 353
369 3300047472 Ga0495686_0047544 Ga0495686_0047544_1490_2677 353
370 3300048919 Ga0496116_0081891 Ga0496116_0081891_592_1812 353
371 3300049459 Ga0495678_000101 Ga0495678_000101_103336_104520 353
372 3300049823 Ga0501044_0010579 Ga0501044_0010579_6662_7780 353
373 3300053094 Ga0500566_0143230 Ga0500566_0143230_39_1154 353
374 3300053122 Ga0500608_093429 Ga0500608_093429_272_1387 353
375 3300053145 Ga0500586_000584 Ga0500586_000584_6130_7332 353
376 iso_pu_bacteria 2842711865 2842716861 353
377 iso_pu_bacteria 2857558681 2857561262 353
378 3300005339 Ga0070660_100000544 Ga0070660_1000005445 354
379 3300005367 Ga0070667_100001390 Ga0070667_10000139018 354
380 3300005617 Ga0068859_100321934 Ga0068859_1003219341 354
381 3300005841 Ga0068863_100001578 Ga0068863_10000157821 354
382 3300005843 Ga0068860_100000013 Ga0068860_10000001316 354
383 3300006931 Ga0097620_100321933 Ga0097620_1003219331 354
384 3300025919 Ga0207657_10003918 Ga0207657_100039183 354
385 3300025986 Ga0207658_10000067 Ga0207658_10000067101 354
386 3300028381 Ga0268264_10000039 Ga0268264_1000003920 354
387 3300044658 Ga0466972_0002161 Ga0466972_0002161_8503_9606 354
388 3300044683 Ga0466965_0029309 Ga0466965_0029309_16_1119 354
389 3300044735 Ga0466968_0072018 Ga0466968_0072018_13_1116 354
390 3300044765 Ga0466970_0027698 Ga0466970_0027698_339_1442 354
391 3300044901 Ga0466960_0012052 Ga0466960_0012052_1890_2993 354
392 3300045049 Ga0466959_0224286 Ga0466959_0224286_133_1236 354
393 3300046557 Ga0495622_0008114 Ga0495622_0008114_1733_2833 354
394 3300046558 Ga0495633_0005153 Ga0495633_0005153_2737_3849 354
395 3300046692 Ga0495671_0006624 Ga0495671_0006624_520_1620 354
396 3300049679 Ga0501249_000185 Ga0501249_000185_5947_7047 354
397 3300053118 Ga0500594_0039531 Ga0500594_0039531_95_1195 354
398 3300053157 Ga0500624_000053 Ga0500624_000053_65170_66282 354
399 3300001989 JGI24739J22299_10001696 JGI24739J22299_100016964 355
400 3300001989 JGI24739J22299_10018418 JGI24739J22299_100184182 355
401 3300001989 JGI24739J22299_10021643 JGI24739J22299_100216433 355
402 3300001990 JGI24737J22298_10000864 JGI24737J22298_100008646 355
403 3300001990 JGI24737J22298_10002862 JGI24737J22298_100028622 355
404 3300002067 JGI24735J21928_10001679 JGI24735J21928_100016795 355
405 3300002075 JGI24738J21930_10003391 JGI24738J21930_100033912 355
406 3300003214 JGI25165J46597_1000188 JGI25165J46597_100018842 355
407 3300005327 Ga0070658_10041598 Ga0070658_100415981 355
408 3300005327 Ga0070658_10070822 Ga0070658_100708223 355
409 3300005334 Ga0068869_100000848 Ga0068869_1000008488 355
410 3300005335 Ga0070666_10012477 Ga0070666_100124773 355
411 3300005338 Ga0068868_100000154 Ga0068868_10000015425 355
412 3300005339 Ga0070660_100102891 Ga0070660_1001028912 355
413 3300005354 Ga0070675_100008581 Ga0070675_1000085813 355
414 3300005355 Ga0070671_100011487 Ga0070671_1000114873 355
415 3300005356 Ga0070674_100001435 Ga0070674_10000143510 355
416 3300005364 Ga0070673_100000023 Ga0070673_10000002387 355
417 3300005366 Ga0070659_100059344 Ga0070659_1000593442 355
418 3300005366 Ga0070659_100149929 Ga0070659_1001499291 355
419 3300005457 Ga0070662_100015094 Ga0070662_1000150945 355
420 3300005459 Ga0068867_100000007 Ga0068867_10000000719 355
421 3300005543 Ga0070672_100288368 Ga0070672_1002883682 355
422 3300005563 Ga0068855_100000029 Ga0068855_10000002942 355
423 3300005577 Ga0068857_100015770 Ga0068857_1000157704 355
424 3300005614 Ga0068856_100004098 Ga0068856_1000040984 355
425 3300005614 Ga0068856_100247632 Ga0068856_1002476322 355
426 3300005616 Ga0068852_100004278 Ga0068852_1000042782 355
427 3300005718 Ga0068866_10012667 Ga0068866_100126672 355
428 3300006881 Ga0068865_100000010 Ga0068865_100000010161 355
429 3300009093 Ga0105240_10110430 Ga0105240_101104302 355
430 3300009098 Ga0105245_10002089 Ga0105245_100020895 355
431 3300009148 Ga0105243_10000950 Ga0105243_1000095019 355
432 3300009148 Ga0105243_10042667 Ga0105243_100426672 355
433 3300009176 Ga0105242_10000210 Ga0105242_1000021019 355
434 3300009545 Ga0105237_10155826 Ga0105237_101558262 355
435 3300010375 Ga0105239_10000980 Ga0105239_1000098027 355
436 3300011119 Ga0105246_10000472 Ga0105246_1000047215 355
437 3300013104 Ga0157370_10000203 Ga0157370_1000020358 355
438 3300013296 Ga0157374_10000830 Ga0157374_1000083019 355
439 3300013297 Ga0157378_10001477 Ga0157378_1000147712 355
440 3300013307 Ga0157372_10012786 Ga0157372_1001278612 355
441 3300013307 Ga0157372_10021148 Ga0157372_100211483 355
442 3300013308 Ga0157375_10002120 Ga0157375_100021208 355
443 3300014969 Ga0157376_10000047 Ga0157376_1000004719 355
444 3300017792 Ga0163161_10050708 Ga0163161_100507082 355
445 3300025250 Ga0209026_1002441 Ga0209026_10024413 355
446 3300025254 Ga0209148_1001013 Ga0209148_10010137 355
447 3300025261 Ga0209233_1000120 Ga0209233_1000120183 355
448 3300025272 Ga0209455_1000692 Ga0209455_100069211 355
449 3300025899 Ga0207642_10007810 Ga0207642_100078102 355
450 3300025904 Ga0207647_10005555 Ga0207647_100055554 355
451 3300025904 Ga0207647_10040018 Ga0207647_100400182 355
452 3300025904 Ga0207647_10150770 Ga0207647_101507701 355
453 3300025909 Ga0207705_10000316 Ga0207705_100003167 355
454 3300025909 Ga0207705_10000963 Ga0207705_1000096313 355
455 3300025909 Ga0207705_10009514 Ga0207705_100095142 355
456 3300025913 Ga0207695_10132278 Ga0207695_101322782 355
457 3300025914 Ga0207671_10001304 Ga0207671_100013048 355
458 3300025914 Ga0207671_10103565 Ga0207671_101035652 355
459 3300025926 Ga0207659_10024690 Ga0207659_100246903 355
460 3300025931 Ga0207644_10159172 Ga0207644_101591722 355
461 3300025933 Ga0207706_10004690 Ga0207706_100046902 355
462 3300025933 Ga0207706_10031591 Ga0207706_100315912 355
463 3300025933 Ga0207706_10111154 Ga0207706_101111541 355
464 3300025934 Ga0207686_10033791 Ga0207686_100337913 355
465 3300025935 Ga0207709_10000050 Ga0207709_10000050232 355
466 3300025935 Ga0207709_10046973 Ga0207709_100469732 355
467 3300025937 Ga0207669_10041392 Ga0207669_100413922 355
468 3300025938 Ga0207704_10000020 Ga0207704_10000020142 355
469 3300025942 Ga0207689_10001541 Ga0207689_100015415 355
470 3300025949 Ga0207667_10000035 Ga0207667_10000035181 355
471 3300025960 Ga0207651_10000005 Ga0207651_1000000519 355
472 3300025981 Ga0207640_10015331 Ga0207640_100153314 355
473 3300026023 Ga0207677_10000373 Ga0207677_100003739 355
474 3300026078 Ga0207702_10012620 Ga0207702_100126205 355
475 3300026089 Ga0207648_10000017 Ga0207648_10000017142 355
476 3300026121 Ga0207683_10029414 Ga0207683_100294144 355
477 3300026142 Ga0207698_10000712 Ga0207698_100007127 355
478 3300026142 Ga0207698_10091126 Ga0207698_100911262 355
479 3300037312 Ga0395899_0002116 Ga0395899_0002116_10988_12094 355
480 3300041462 Ga0451806_567525 Ga0451806_567525_2364_3470 355
481 3300041486 Ga0451807_2303118 Ga0451807_2303118_347_1453 355
482 3300042005 Ga0439448_0000332 Ga0439448_0000332_8872_9942 355
483 3300042005 Ga0439448_0003494 Ga0439448_0003494_2970_4076 355
484 3300042012 Ga0439455_0000252 Ga0439455_0000252_428_1534 355
485 3300042012 Ga0439455_0000304 Ga0439455_0000304_3290_4360 355
486 3300042157 Ga0439458_0000255 Ga0439458_0000255_8322_9392 355
487 3300042157 Ga0439458_0000305 Ga0439458_0000305_6301_7407 355
488 3300046507 Ga0495606_0162843 Ga0495606_0162843_109_1215 355
489 3300047472 Ga0495686_0000844 Ga0495686_0000844_26638_27726 355
490 3300048920 Ga0496117_0014903 Ga0496117_0014903_210_1337 355
491 3300048921 Ga0496118_0031397 Ga0496118_0031397_2091_3239 355
492 3300048922 Ga0496119_0061244 Ga0496119_0061244_528_1634 355
493 3300048923 Ga0496120_0071956 Ga0496120_0071956_777_1883 355
494 3300048924 Ga0496121_0003499 Ga0496121_0003499_6567_7697 355
495 3300048924 Ga0496121_0005228 Ga0496121_0005228_58_1188 355
496 3300048924 Ga0496121_0056640 Ga0496121_0056640_1864_2970 355
497 3300048928 Ga0496125_0012910 Ga0496125_0012910_3855_4961 355

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03009

GDPD

Glycerophosphoryl diester phosphodiesterase family

81

405

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pz0-assembly1.cif.gz_A crystal structure of glycerophosphodiester phosphodiesterase (gdpd) from t. tengcongensis 0.8569 20 350
5t91-assembly1.cif.gz_A crystal structure of b. subtilis 168 glpq in complex with bicine 0.8511 19 353
2pz0-assembly1.cif.gz_A crystal structure of glycerophosphodiester phosphodiesterase (gdpd) from t. tengcongensis 0.8502 20 350
3qvq-assembly1.cif.gz_D the structure of an oleispira antarctica phosphodiesterase olei02445 in complex with the product sn-glycerol-3-phosphate 0.8466 20 351
5t9c-assembly1.cif.gz_E crystal structure of b. subtilis 168 glpq in complex with glycerol-3-phosphate (1 hour soak) 0.8374 15 353
ID Description Score Start End Superfamily
af_Q9FJ62_365_668_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8898 22 349 3.20.20.190
af_Q9SD81_43_361_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.887 24 345 3.20.20.190
af_Q9FJ62_365_668_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8814 22 349 3.20.20.190
af_Q9FGT9_39_339_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8771 19 349 3.20.20.190
af_I1KYF2_42_344_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8741 20 348 3.20.20.190
ID Description Score Start End GO Terms
AF-A0A2N7RM14-F1-model_v4 glycerophosphodiester phosphodiesterase (EC 3.1.4.46) 0.9943 53 350 GO:0006071
GO:0006629
GO:0008889
GO:0042597
AF-A0A4Q4CT74-F1-model_v4 glycerophosphodiester phosphodiesterase (EC 3.1.4.46) 0.991 21 167 GO:0006071
GO:0006629
GO:0008889
GO:0042597
AF-A0A534A915-F1-model_v4 glycerophosphodiester phosphodiesterase (EC 3.1.4.46) 0.9884 16 350 GO:0006071
GO:0006629
GO:0008889
GO:0042597
AF-A0A7Z0JEC4-F1-model_v4 deleted 0.9884 24 352
AF-U2GZQ8-F1-model_v4 glycerophosphodiester phosphodiesterase (EC 3.1.4.46) 0.9883 24 352 GO:0006071
GO:0006629
GO:0008889
GO:0042597

Feature Viewer

pLDDT pTM Quality
93.85 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map