F455017
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 497 | 263 | 479 | 370 |
Family's Representative Sequence
| Representative Sequence | 3300006946|Ga0079104_1012100|Ga0079104_10121003 |
| Length | 412 |
| Sequence | MPLPGGQTRRGLSRQTPMTQSTFASQTAAAVATVTGASLLLPASVLAVTPAAGIDQSGMPGIAPLGAGGIAGGKRPLVFGHRGASALRPEHTLAAYAKAIVDGADYVEPDLCSTKDGVLVARHEAYLSETTDVASHKQFASRKTRKTIDGEAHDGWFVDDFTLAELKTLRAVERIPQFRPGSAEYNGMFQVVTFEEIIDFVAAEAAAHGRIIGIVPELKHSTYFASVGLPLEDRFLSIIAAHDYTRRNPVQIQSFEVANLKYLRSKLGGKQGTRANLRLMQLVVGEDVRPMDVAAAGGKLTFAQMCTPAGLRDIAAYADVVAPPTRSIIPLKKDGSLAAPSSLVEDAHQAGLRIEPWTFRPENRFLAADFRNGADTARNEAGSIAEMKRYIATGIDGFFTDDPALGRAALAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 2 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 3 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 4 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 5 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 6 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 7 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 8 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 9 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 10 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 11 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 12 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 13 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 14 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 15 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 16 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 17 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 18 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 19 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 20 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 21 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 22 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 23 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 24 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 25 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 28 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 29 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 75 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 101 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 159 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 160 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 161 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 162 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 163 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 164 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 165 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 166 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 167 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 168 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 171 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 172 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 173 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 174 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 175 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 176 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 177 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 178 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 179 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 180 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 181 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 233 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 234 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 235 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 236 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 237 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 238 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 239 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 240 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 241 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 242 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 243 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 244 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 245 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 246 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 250 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 251 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 253 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 254 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 255 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 256 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 257 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 258 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 259 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 260 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 261 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 262 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 263 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.38 |
| Metatranscriptomes | 0 |
| Isolates | 3.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.86 |
| Nodule | 0.4 |
| Rhizoplane | 1.41 |
| Rhizosphere | 76.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10001696 | 3300001989 | Bacteria | 8374 |
| 2 | JGI24739J22299_10018418 | 3300001989 | Bacteria | 2510 |
| 3 | JGI24739J22299_10021643 | 3300001989 | Bacteria | 2287 |
| 4 | JGI24737J22298_10000864 | 3300001990 | Bacteria | 10811 |
| 5 | JGI24737J22298_10002862 | 3300001990 | Bacteria | 6112 |
| 6 | JGI24735J21928_10001679 | 3300002067 | Bacteria | 7828 |
| 7 | JGI24738J21930_10003391 | 3300002075 | Bacteria | 4028 |
| 8 | JGI24751J29686_10000387 | 3300002459 | Bacteria | 14778 |
| 9 | JGI25158J39367_1000633 | 3300002739 | Bacteria | 6946 |
| 10 | JGI25165J46597_1000188 | 3300003214 | Bacteria | 92329 |
| 11 | JGI25153J46596_10033832 | 3300003215 | Bacteria | 1680 |
| 12 | rootL2_10106073 | 3300003322 | Bacteria | 2609 |
| 13 | JGI25161J50226_1000390 | 3300003374 | Bacteria | 22180 |
| 14 | Ga0055525_1000028 | 3300003759 | Bacteria | 331683 |
| 15 | Ga0055529_1000407 | 3300003763 | Bacteria | 45450 |
| 16 | Ga0055526_1000366 | 3300003771 | Bacteria | 36475 |
| 17 | Ga0055526_1000591 | 3300003771 | Bacteria | 28506 |
| 18 | Ga0055537_1000062 | 3300003773 | Bacteria | 77862 |
| 19 | Ga0055537_1000451 | 3300003773 | Bacteria | 26082 |
| 20 | Ga0055524_1002341 | 3300003775 | Bacteria | 9852 |
| 21 | Ga0055534_1000019 | 3300003784 | Bacteria | 137920 |
| 22 | Ga0055528_1000048 | 3300003790 | Bacteria | 95179 |
| 23 | Ga0055543_1000450 | 3300004625 | Bacteria | 24809 |
| 24 | Ga0055543_1005027 | 3300004625 | Bacteria | 3452 |
| 25 | Ga0065165_1000111 | 3300005262 | Bacteria | 136009 |
| 26 | Ga0065165_1001392 | 3300005262 | Bacteria | 26467 |
| 27 | Ga0070658_10041598 | 3300005327 | Bacteria | 3708 |
| 28 | Ga0070658_10070822 | 3300005327 | Bacteria | 2855 |
| 29 | Ga0070670_100000003 | 3300005331 | Bacteria | 529510 |
| 30 | Ga0068869_100000848 | 3300005334 | Bacteria | 17540 |
| 31 | Ga0070666_10012477 | 3300005335 | Bacteria | 5361 |
| 32 | Ga0068868_100000154 | 3300005338 | Bacteria | 44616 |
| 33 | Ga0070660_100000544 | 3300005339 | Bacteria | 25288 |
| 34 | Ga0070660_100102891 | 3300005339 | Bacteria | 2264 |
| 35 | Ga0070660_100149194 | 3300005339 | Bacteria | 1879 |
| 36 | Ga0070668_100002381 | 3300005347 | Bacteria | 13811 |
| 37 | Ga0070669_100000084 | 3300005353 | Bacteria | 91046 |
| 38 | Ga0070675_100008581 | 3300005354 | Bacteria | 7934 |
| 39 | Ga0070671_100001022 | 3300005355 | Bacteria | 20561 |
| 40 | Ga0070671_100011487 | 3300005355 | Bacteria | 7121 |
| 41 | Ga0070674_100001435 | 3300005356 | Bacteria | 12682 |
| 42 | Ga0070673_100000023 | 3300005364 | Bacteria | 91936 |
| 43 | Ga0070659_100059344 | 3300005366 | Bacteria | 3021 |
| 44 | Ga0070659_100149929 | 3300005366 | Bacteria | 1902 |
| 45 | Ga0070667_100000886 | 3300005367 | Bacteria | 27667 |
| 46 | Ga0070667_100001390 | 3300005367 | Bacteria | 21662 |
| 47 | Ga0070667_100093295 | 3300005367 | Bacteria | 2592 |
| 48 | Ga0070662_100015094 | 3300005457 | Bacteria | 5168 |
| 49 | Ga0070681_10010127 | 3300005458 | Bacteria | 9293 |
| 50 | Ga0068867_100000007 | 3300005459 | Bacteria | 148726 |
| 51 | Ga0068853_100119408 | 3300005539 | Bacteria | 2350 |
| 52 | Ga0070672_100288368 | 3300005543 | Bacteria | 1389 |
| 53 | Ga0070693_100008581 | 3300005547 | Bacteria | 5047 |
| 54 | Ga0070665_100000388 | 3300005548 | Bacteria | 64921 |
| 55 | Ga0068855_100000029 | 3300005563 | Bacteria | 171278 |
| 56 | Ga0068857_100015770 | 3300005577 | Bacteria | 6612 |
| 57 | Ga0068854_100000027 | 3300005578 | Bacteria | 117836 |
| 58 | Ga0068856_100004098 | 3300005614 | Bacteria | 14566 |
| 59 | Ga0068856_100247632 | 3300005614 | Bacteria | 1797 |
| 60 | Ga0068852_100004278 | 3300005616 | Bacteria | 10072 |
| 61 | Ga0068859_100002121 | 3300005617 | Bacteria | 20201 |
| 62 | Ga0068859_100321934 | 3300005617 | Bacteria | 1640 |
| 63 | Ga0068864_100000005 | 3300005618 | Bacteria | 400840 |
| 64 | Ga0068866_10012667 | 3300005718 | Bacteria | 3680 |
| 65 | Ga0068863_100001275 | 3300005841 | Bacteria | 25115 |
| 66 | Ga0068863_100001578 | 3300005841 | Bacteria | 22542 |
| 67 | Ga0068860_100000013 | 3300005843 | Bacteria | 323055 |
| 68 | Ga0068862_100000697 | 3300005844 | Bacteria | 34312 |
| 69 | Ga0068862_100030628 | 3300005844 | Bacteria | 4535 |
| 70 | Ga0097621_100002061 | 3300006237 | Bacteria | 13748 |
| 71 | Ga0068871_100002074 | 3300006358 | Bacteria | 13555 |
| 72 | Ga0068865_100000010 | 3300006881 | Bacteria | 159548 |
| 73 | Ga0097620_100002121 | 3300006931 | Bacteria | 20201 |
| 74 | Ga0097620_100321933 | 3300006931 | Bacteria | 1640 |
| 75 | Ga0079104_1012100 | 3300006946 | Bacteria | 2734 |
| 76 | Ga0105251_10000574 | 3300009011 | Bacteria | 34289 |
| 77 | Ga0105240_10070818 | 3300009093 | Bacteria | 4313 |
| 78 | Ga0105240_10110430 | 3300009093 | Bacteria | 3328 |
| 79 | Ga0105245_10002089 | 3300009098 | Bacteria | 18117 |
| 80 | Ga0105243_10000950 | 3300009148 | Bacteria | 27049 |
| 81 | Ga0105243_10042667 | 3300009148 | Bacteria | 3552 |
| 82 | Ga0105241_10084693 | 3300009174 | Bacteria | 2489 |
| 83 | Ga0105242_10000210 | 3300009176 | Bacteria | 45627 |
| 84 | Ga0105248_10001468 | 3300009177 | Bacteria | 26237 |
| 85 | Ga0105248_10001700 | 3300009177 | Bacteria | 24495 |
| 86 | Ga0105248_10007301 | 3300009177 | Bacteria | 12126 |
| 87 | Ga0105237_10155826 | 3300009545 | Bacteria | 2281 |
| 88 | Ga0105238_10027777 | 3300009551 | Bacteria | 5766 |
| 89 | Ga0105249_10000417 | 3300009553 | Bacteria | 40603 |
| 90 | Ga0105249_10027062 | 3300009553 | Bacteria | 5173 |
| 91 | Ga0105239_10000980 | 3300010375 | Bacteria | 40069 |
| 92 | Ga0105239_10004123 | 3300010375 | Bacteria | 17464 |
| 93 | Ga0105239_10046782 | 3300010375 | Bacteria | 4741 |
| 94 | Ga0105246_10000472 | 3300011119 | Bacteria | 21681 |
| 95 | Ga0157371_10083142 | 3300013102 | Bacteria | 2267 |
| 96 | Ga0157370_10000203 | 3300013104 | Bacteria | 75249 |
| 97 | Ga0157374_10000830 | 3300013296 | Bacteria | 27049 |
| 98 | Ga0157378_10001477 | 3300013297 | Bacteria | 21228 |
| 99 | Ga0157372_10012786 | 3300013307 | Bacteria | 8944 |
| 100 | Ga0157372_10021148 | 3300013307 | Bacteria | 7027 |
| 101 | Ga0157372_10200471 | 3300013307 | Bacteria | 2311 |
| 102 | Ga0157372_10311479 | 3300013307 | Bacteria | 1832 |
| 103 | Ga0157372_10633681 | 3300013307 | Bacteria | 1245 |
| 104 | Ga0157375_10002120 | 3300013308 | Bacteria | 17145 |
| 105 | Ga0157380_10000041 | 3300014326 | Bacteria | 75943 |
| 106 | Ga0182008_10000357 | 3300014497 | Bacteria | 35568 |
| 107 | Ga0157376_10000047 | 3300014969 | Bacteria | 107974 |
| 108 | Ga0182006_1000002 | 3300015261 | Bacteria | 887990 |
| 109 | Ga0182006_1000021 | 3300015261 | Bacteria | 280808 |
| 110 | Ga0182007_10000162 | 3300015262 | Bacteria | 46148 |
| 111 | Ga0182007_10015196 | 3300015262 | Bacteria | 2879 |
| 112 | Ga0182005_1000020 | 3300015265 | Bacteria | 278671 |
| 113 | Ga0182005_1000029 | 3300015265 | Bacteria | 214132 |
| 114 | Ga0163161_10050708 | 3300017792 | Bacteria | 3004 |
| 115 | Ga0213872_10000975 | 3300021361 | Bacteria | 19998 |
| 116 | Ga0213872_10001897 | 3300021361 | Bacteria | 12851 |
| 117 | Ga0213872_10008134 | 3300021361 | Bacteria | 5089 |
| 118 | Ga0209436_100062 | 3300025208 | Bacteria | 56841 |
| 119 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 120 | Ga0209646_1000087 | 3300025246 | Bacteria | 193273 |
| 121 | Ga0209026_1002441 | 3300025250 | Bacteria | 6982 |
| 122 | Ga0209026_1002852 | 3300025250 | Bacteria | 6102 |
| 123 | Ga0209148_1000061 | 3300025254 | Bacteria | 349575 |
| 124 | Ga0209148_1001013 | 3300025254 | Bacteria | 17719 |
| 125 | Ga0209233_1000120 | 3300025261 | Bacteria | 233311 |
| 126 | Ga0209565_1000017 | 3300025263 | Bacteria | 462438 |
| 127 | Ga0209455_1000330 | 3300025272 | Bacteria | 45609 |
| 128 | Ga0209455_1000692 | 3300025272 | Bacteria | 19864 |
| 129 | Ga0209673_1000007 | 3300025273 | Bacteria | 634477 |
| 130 | Ga0209130_1000139 | 3300025284 | Bacteria | 115951 |
| 131 | Ga0209130_1000336 | 3300025284 | Bacteria | 53924 |
| 132 | Ga0209675_1000009 | 3300025291 | Bacteria | 562872 |
| 133 | Ga0209025_1008705 | 3300025294 | Bacteria | 7242 |
| 134 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 135 | Ga0209564_1000036 | 3300025295 | Bacteria | 423455 |
| 136 | Ga0209564_1000045 | 3300025295 | Bacteria | 376549 |
| 137 | Ga0209758_1000456 | 3300025297 | Bacteria | 68269 |
| 138 | Ga0209256_1000091 | 3300025299 | Bacteria | 210945 |
| 139 | Ga0207655_1006948 | 3300025728 | Bacteria | 7419 |
| 140 | Ga0207655_1009877 | 3300025728 | Bacteria | 5873 |
| 141 | Ga0207713_1002768 | 3300025735 | Bacteria | 12413 |
| 142 | Ga0207642_10007810 | 3300025899 | Bacteria | 3631 |
| 143 | Ga0207647_10005555 | 3300025904 | Bacteria | 9227 |
| 144 | Ga0207647_10040018 | 3300025904 | Bacteria | 2954 |
| 145 | Ga0207647_10150770 | 3300025904 | Bacteria | 1359 |
| 146 | Ga0207705_10000316 | 3300025909 | Bacteria | 44059 |
| 147 | Ga0207705_10000963 | 3300025909 | Bacteria | 23546 |
| 148 | Ga0207705_10009514 | 3300025909 | Bacteria | 7072 |
| 149 | Ga0207654_10091068 | 3300025911 | Bacteria | 1859 |
| 150 | Ga0207695_10041776 | 3300025913 | Bacteria | 4905 |
| 151 | Ga0207695_10132278 | 3300025913 | Bacteria | 2451 |
| 152 | Ga0207671_10001304 | 3300025914 | Bacteria | 29270 |
| 153 | Ga0207671_10103565 | 3300025914 | Bacteria | 2158 |
| 154 | Ga0207657_10003918 | 3300025919 | Bacteria | 15794 |
| 155 | Ga0207657_10121410 | 3300025919 | Bacteria | 2150 |
| 156 | Ga0207657_10122603 | 3300025919 | Bacteria | 2138 |
| 157 | Ga0207681_10000005 | 3300025923 | Bacteria | 555724 |
| 158 | Ga0207694_10045106 | 3300025924 | Bacteria | 3405 |
| 159 | Ga0207694_10048035 | 3300025924 | Bacteria | 3302 |
| 160 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 161 | Ga0207659_10024690 | 3300025926 | Bacteria | 4031 |
| 162 | Ga0207644_10001031 | 3300025931 | Bacteria | 17843 |
| 163 | Ga0207644_10159172 | 3300025931 | Bacteria | 1754 |
| 164 | Ga0207690_10008359 | 3300025932 | Bacteria | 6144 |
| 165 | Ga0207706_10004690 | 3300025933 | Bacteria | 12810 |
| 166 | Ga0207706_10031591 | 3300025933 | Bacteria | 4717 |
| 167 | Ga0207706_10111154 | 3300025933 | Bacteria | 2410 |
| 168 | Ga0207686_10033791 | 3300025934 | Bacteria | 3055 |
| 169 | Ga0207709_10000050 | 3300025935 | Bacteria | 234391 |
| 170 | Ga0207709_10046973 | 3300025935 | Bacteria | 2623 |
| 171 | Ga0207669_10041392 | 3300025937 | Bacteria | 2681 |
| 172 | Ga0207704_10000020 | 3300025938 | Bacteria | 148847 |
| 173 | Ga0207711_10001028 | 3300025941 | Bacteria | 26716 |
| 174 | Ga0207711_10002707 | 3300025941 | Bacteria | 15647 |
| 175 | Ga0207711_10005807 | 3300025941 | Bacteria | 10429 |
| 176 | Ga0207689_10001541 | 3300025942 | Bacteria | 21894 |
| 177 | Ga0207667_10000035 | 3300025949 | Bacteria | 301056 |
| 178 | Ga0207651_10000005 | 3300025960 | Bacteria | 246132 |
| 179 | Ga0207712_10000308 | 3300025961 | Bacteria | 44940 |
| 180 | Ga0207668_10000772 | 3300025972 | Bacteria | 19601 |
| 181 | Ga0207640_10000145 | 3300025981 | Bacteria | 51603 |
| 182 | Ga0207640_10015331 | 3300025981 | Bacteria | 4434 |
| 183 | Ga0207658_10000067 | 3300025986 | Bacteria | 116584 |
| 184 | Ga0207658_10003849 | 3300025986 | Bacteria | 10572 |
| 185 | Ga0207658_10010932 | 3300025986 | Bacteria | 6179 |
| 186 | Ga0207677_10000373 | 3300026023 | Bacteria | 31103 |
| 187 | Ga0207703_10179181 | 3300026035 | Bacteria | 1869 |
| 188 | Ga0207639_10007809 | 3300026041 | Bacteria | 7304 |
| 189 | Ga0207702_10012620 | 3300026078 | Bacteria | 7034 |
| 190 | Ga0207641_10004468 | 3300026088 | Bacteria | 12112 |
| 191 | Ga0207641_10004653 | 3300026088 | Bacteria | 11842 |
| 192 | Ga0207648_10000017 | 3300026089 | Bacteria | 148699 |
| 193 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 194 | Ga0207674_10029429 | 3300026116 | Bacteria | 5782 |
| 195 | Ga0207683_10029414 | 3300026121 | Bacteria | 4757 |
| 196 | Ga0207698_10000712 | 3300026142 | Bacteria | 19239 |
| 197 | Ga0207698_10091126 | 3300026142 | Bacteria | 2495 |
| 198 | Ga0207698_10109382 | 3300026142 | Bacteria | 2312 |
| 199 | Ga0209281_1011866 | 3300027111 | Bacteria | 1936 |
| 200 | Ga0268266_10001970 | 3300028379 | Bacteria | 23039 |
| 201 | Ga0268265_10000616 | 3300028380 | Bacteria | 35508 |
| 202 | Ga0268264_10000039 | 3300028381 | Bacteria | 376641 |
| 203 | Ga0268264_10000913 | 3300028381 | Bacteria | 30954 |
| 204 | Ga0268264_10020157 | 3300028381 | Bacteria | 5449 |
| 205 | Ga0307515_10136714 | 3300028794 | Bacteria | 2659 |
| 206 | Ga0307513_10046357 | 3300031456 | Bacteria | 4740 |
| 207 | Ga0307509_10000022 | 3300031507 | Bacteria | 247822 |
| 208 | Ga0307414_10128848 | 3300032004 | Bacteria | 1960 |
| 209 | Ga0395899_0002116 | 3300037312 | Bacteria | 16321 |
| 210 | Ga0395900_0000322 | 3300037418 | Bacteria | 70864 |
| 211 | Ga0395900_0108389 | 3300037418 | Bacteria | 2853 |
| 212 | Ga0395905_0082091 | 3300037471 | Bacteria | 3020 |
| 213 | Ga0395905_0118935 | 3300037471 | Bacteria | 2483 |
| 214 | Ga0395901_0000332 | 3300038443 | Bacteria | 57814 |
| 215 | Ga0395901_0000712 | 3300038443 | Bacteria | 38055 |
| 216 | Ga0395901_0559257 | 3300038443 | Bacteria | 1158 |
| 217 | Ga0237819_02012 | 3300038705 | Bacteria | 4528 |
| 218 | Ga0436361_0089506 | 3300039447 | Bacteria | 38272 |
| 219 | Ga0436361_0471040 | 3300039447 | Bacteria | 15880 |
| 220 | Ga0436361_0887554 | 3300039447 | Bacteria | 20445 |
| 221 | Ga0436361_1096673 | 3300039447 | Bacteria | 2304 |
| 222 | Ga0451806_567525 | 3300041462 | Bacteria | 4260 |
| 223 | Ga0451807_2303118 | 3300041486 | Bacteria | 3580 |
| 224 | Ga0451833_0691704 | 3300041491 | Bacteria | 1744 |
| 225 | Ga0439448_0000332 | 3300042005 | Bacteria | 10506 |
| 226 | Ga0439448_0003494 | 3300042005 | Bacteria | 4352 |
| 227 | Ga0439455_0000252 | 3300042012 | Bacteria | 6482 |
| 228 | Ga0439455_0000304 | 3300042012 | Bacteria | 6168 |
| 229 | Ga0439458_0000255 | 3300042157 | Bacteria | 12956 |
| 230 | Ga0439458_0000305 | 3300042157 | Bacteria | 12201 |
| 231 | Ga0466972_0002161 | 3300044658 | Bacteria | 9648 |
| 232 | Ga0466965_0029309 | 3300044683 | Bacteria | 2678 |
| 233 | Ga0466965_0155838 | 3300044683 | Bacteria | 1196 |
| 234 | Ga0466968_0072018 | 3300044735 | Bacteria | 1506 |
| 235 | Ga0466970_0027698 | 3300044765 | Bacteria | 2974 |
| 236 | Ga0466960_0012052 | 3300044901 | Bacteria | 3639 |
| 237 | Ga0466959_0224286 | 3300045049 | Bacteria | 1302 |
| 238 | Ga0466958_0030310 | 3300045836 | Bacteria | 3212 |
| 239 | Ga0466958_0191697 | 3300045836 | Bacteria | 1299 |
| 240 | Ga0495617_000006 | 3300046452 | Bacteria | 398279 |
| 241 | Ga0495617_002143 | 3300046452 | Bacteria | 8114 |
| 242 | Ga0495617_003370 | 3300046452 | Bacteria | 6022 |
| 243 | Ga0495617_013183 | 3300046452 | Bacteria | 2815 |
| 244 | Ga0495627_000005 | 3300046453 | Bacteria | 630805 |
| 245 | Ga0495590_0000003 | 3300046457 | Bacteria | 478593 |
| 246 | Ga0495638_0000198 | 3300046460 | Bacteria | 86199 |
| 247 | Ga0495638_0011182 | 3300046460 | Bacteria | 6198 |
| 248 | Ga0495653_0000011 | 3300046463 | Bacteria | 272314 |
| 249 | Ga0495650_0000015 | 3300046471 | Bacteria | 557595 |
| 250 | Ga0495650_0000131 | 3300046471 | Bacteria | 174698 |
| 251 | Ga0495650_0000189 | 3300046471 | Bacteria | 133931 |
| 252 | Ga0495650_0000339 | 3300046471 | Bacteria | 83278 |
| 253 | Ga0495650_0001195 | 3300046471 | Bacteria | 27437 |
| 254 | Ga0495650_0017461 | 3300046471 | Bacteria | 3597 |
| 255 | Ga0495605_0000003 | 3300046474 | Bacteria | 491502 |
| 256 | Ga0495639_0019942 | 3300046475 | Bacteria | 2927 |
| 257 | Ga0495584_0001074 | 3300046491 | Bacteria | 16979 |
| 258 | Ga0495584_0004303 | 3300046491 | Bacteria | 7675 |
| 259 | Ga0495584_0004746 | 3300046491 | Bacteria | 7276 |
| 260 | Ga0495585_0001792 | 3300046492 | Bacteria | 16324 |
| 261 | Ga0495585_0001983 | 3300046492 | Bacteria | 15214 |
| 262 | Ga0495585_0004903 | 3300046492 | Bacteria | 8574 |
| 263 | Ga0495596_0000359 | 3300046500 | Bacteria | 29317 |
| 264 | Ga0495596_0012606 | 3300046500 | Bacteria | 3612 |
| 265 | Ga0495607_0004417 | 3300046501 | Bacteria | 10356 |
| 266 | Ga0495607_0005378 | 3300046501 | Bacteria | 9187 |
| 267 | Ga0495607_0005421 | 3300046501 | Bacteria | 9135 |
| 268 | Ga0495607_0006440 | 3300046501 | Bacteria | 8264 |
| 269 | Ga0495607_0021458 | 3300046501 | Bacteria | 4063 |
| 270 | Ga0495583_0000033 | 3300046506 | Bacteria | 246882 |
| 271 | Ga0495583_0000060 | 3300046506 | Bacteria | 199091 |
| 272 | Ga0495583_0000165 | 3300046506 | Bacteria | 111940 |
| 273 | Ga0495583_0000265 | 3300046506 | Bacteria | 86085 |
| 274 | Ga0495583_0053552 | 3300046506 | Bacteria | 1831 |
| 275 | Ga0495606_0000068 | 3300046507 | Bacteria | 179653 |
| 276 | Ga0495606_0000304 | 3300046507 | Bacteria | 84652 |
| 277 | Ga0495606_0001448 | 3300046507 | Bacteria | 31815 |
| 278 | Ga0495606_0001581 | 3300046507 | Bacteria | 29777 |
| 279 | Ga0495606_0001638 | 3300046507 | Bacteria | 29168 |
| 280 | Ga0495606_0001656 | 3300046507 | Bacteria | 28966 |
| 281 | Ga0495606_0008588 | 3300046507 | Bacteria | 8841 |
| 282 | Ga0495606_0011131 | 3300046507 | Bacteria | 7373 |
| 283 | Ga0495606_0079839 | 3300046507 | Bacteria | 2037 |
| 284 | Ga0495606_0117352 | 3300046507 | Bacteria | 1597 |
| 285 | Ga0495606_0162843 | 3300046507 | Bacteria | 1300 |
| 286 | Ga0495610_0000004 | 3300046512 | Bacteria | 1006135 |
| 287 | Ga0495610_0000669 | 3300046512 | Bacteria | 33348 |
| 288 | Ga0495610_0027246 | 3300046512 | Bacteria | 3039 |
| 289 | Ga0495616_0001483 | 3300046513 | Bacteria | 16267 |
| 290 | Ga0495616_0008581 | 3300046513 | Bacteria | 6037 |
| 291 | Ga0495616_0017476 | 3300046513 | Bacteria | 3956 |
| 292 | Ga0495616_0089918 | 3300046513 | Bacteria | 1455 |
| 293 | Ga0495616_0131214 | 3300046513 | Bacteria | 1148 |
| 294 | Ga0495631_0000750 | 3300046518 | Bacteria | 20777 |
| 295 | Ga0495631_0001299 | 3300046518 | Bacteria | 15314 |
| 296 | Ga0495632_0003011 | 3300046519 | Bacteria | 12299 |
| 297 | Ga0495632_0082001 | 3300046519 | Bacteria | 1537 |
| 298 | Ga0495637_0000747 | 3300046520 | Bacteria | 21946 |
| 299 | Ga0495643_0000106 | 3300046522 | Bacteria | 138657 |
| 300 | Ga0495643_0000902 | 3300046522 | Bacteria | 31450 |
| 301 | Ga0495643_0032393 | 3300046522 | Bacteria | 2902 |
| 302 | Ga0495643_0066802 | 3300046522 | Bacteria | 1896 |
| 303 | Ga0495644_0000624 | 3300046523 | Bacteria | 14822 |
| 304 | Ga0495644_0000854 | 3300046523 | Bacteria | 12569 |
| 305 | Ga0495648_0000087 | 3300046524 | Bacteria | 116394 |
| 306 | Ga0495648_0000456 | 3300046524 | Bacteria | 44289 |
| 307 | Ga0495648_0008685 | 3300046524 | Bacteria | 7964 |
| 308 | Ga0495648_0022146 | 3300046524 | Bacteria | 4383 |
| 309 | Ga0495648_0052523 | 3300046524 | Bacteria | 2475 |
| 310 | Ga0495642_0000767 | 3300046528 | Bacteria | 15723 |
| 311 | Ga0495642_0007637 | 3300046528 | Bacteria | 4146 |
| 312 | Ga0495642_0065706 | 3300046528 | Bacteria | 1511 |
| 313 | Ga0495654_0000035 | 3300046530 | Bacteria | 192768 |
| 314 | Ga0495609_0000293 | 3300046538 | Bacteria | 46162 |
| 315 | Ga0495609_0000996 | 3300046538 | Bacteria | 20156 |
| 316 | Ga0495609_0002236 | 3300046538 | Bacteria | 12103 |
| 317 | Ga0495609_0010890 | 3300046538 | Bacteria | 4344 |
| 318 | Ga0495609_0014079 | 3300046538 | Bacteria | 3765 |
| 319 | Ga0495609_0021580 | 3300046538 | Bacteria | 2971 |
| 320 | Ga0495609_0042192 | 3300046538 | Bacteria | 2049 |
| 321 | Ga0495597_0000119 | 3300046542 | Bacteria | 71150 |
| 322 | Ga0495597_0000273 | 3300046542 | Bacteria | 46966 |
| 323 | Ga0495622_0000004 | 3300046557 | Bacteria | 258984 |
| 324 | Ga0495622_0000498 | 3300046557 | Bacteria | 24660 |
| 325 | Ga0495622_0008114 | 3300046557 | Bacteria | 4866 |
| 326 | Ga0495622_0034780 | 3300046557 | Bacteria | 2350 |
| 327 | Ga0495633_0000617 | 3300046558 | Bacteria | 33789 |
| 328 | Ga0495633_0001445 | 3300046558 | Bacteria | 18469 |
| 329 | Ga0495633_0001486 | 3300046558 | Bacteria | 18179 |
| 330 | Ga0495633_0005153 | 3300046558 | Bacteria | 8095 |
| 331 | Ga0495633_0007281 | 3300046558 | Bacteria | 6397 |
| 332 | Ga0495633_0007560 | 3300046558 | Bacteria | 6235 |
| 333 | Ga0495633_0012880 | 3300046558 | Bacteria | 4427 |
| 334 | Ga0495633_0016536 | 3300046558 | Bacteria | 3801 |
| 335 | Ga0495656_0001555 | 3300046615 | Bacteria | 7501 |
| 336 | Ga0495656_0008629 | 3300046615 | Bacteria | 3645 |
| 337 | Ga0495656_0058264 | 3300046615 | Bacteria | 1675 |
| 338 | Ga0495668_0000018 | 3300046616 | Bacteria | 417480 |
| 339 | Ga0495668_0000104 | 3300046616 | Bacteria | 134968 |
| 340 | Ga0495668_0001257 | 3300046616 | Bacteria | 25275 |
| 341 | Ga0495668_0001909 | 3300046616 | Bacteria | 18614 |
| 342 | Ga0495668_0043248 | 3300046616 | Bacteria | 2506 |
| 343 | Ga0495611_0000992 | 3300046648 | Bacteria | 15071 |
| 344 | Ga0495611_0001776 | 3300046648 | Bacteria | 10398 |
| 345 | Ga0495625_0000038 | 3300046660 | Bacteria | 211808 |
| 346 | Ga0495625_0000335 | 3300046660 | Bacteria | 71730 |
| 347 | Ga0495625_0010738 | 3300046660 | Bacteria | 7538 |
| 348 | Ga0495625_0043220 | 3300046660 | Bacteria | 3269 |
| 349 | Ga0495625_0060507 | 3300046660 | Bacteria | 2683 |
| 350 | Ga0495625_0097716 | 3300046660 | Bacteria | 2020 |
| 351 | Ga0495625_0134330 | 3300046660 | Bacteria | 1673 |
| 352 | Ga0495625_0151662 | 3300046660 | Bacteria | 1557 |
| 353 | Ga0495659_0000397 | 3300046664 | Bacteria | 16662 |
| 354 | Ga0495661_0000324 | 3300046665 | Bacteria | 52421 |
| 355 | Ga0495661_0022896 | 3300046665 | Bacteria | 4060 |
| 356 | Ga0495661_0046638 | 3300046665 | Bacteria | 2644 |
| 357 | Ga0495661_0061247 | 3300046665 | Bacteria | 2234 |
| 358 | Ga0495588_0000172 | 3300046674 | Bacteria | 81934 |
| 359 | Ga0495588_0067834 | 3300046674 | Bacteria | 1852 |
| 360 | Ga0495669_0001330 | 3300046684 | Bacteria | 10221 |
| 361 | Ga0495669_0037689 | 3300046684 | Bacteria | 2140 |
| 362 | Ga0495670_0000931 | 3300046691 | Bacteria | 14148 |
| 363 | Ga0495670_0002420 | 3300046691 | Bacteria | 9211 |
| 364 | Ga0495670_0015948 | 3300046691 | Bacteria | 3693 |
| 365 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 366 | Ga0495671_0006624 | 3300046692 | Bacteria | 6678 |
| 367 | Ga0495671_0014070 | 3300046692 | Bacteria | 4313 |
| 368 | Ga0495671_0035481 | 3300046692 | Bacteria | 2532 |
| 369 | Ga0495589_0024804 | 3300046794 | Bacteria | 3046 |
| 370 | Ga0495660_0000126 | 3300046810 | Bacteria | 84046 |
| 371 | Ga0495660_0001205 | 3300046810 | Bacteria | 18096 |
| 372 | Ga0495660_0008367 | 3300046810 | Bacteria | 6052 |
| 373 | Ga0495660_0011189 | 3300046810 | Bacteria | 5208 |
| 374 | Ga0495660_0066474 | 3300046810 | Bacteria | 1922 |
| 375 | Ga0495636_0000323 | 3300047318 | Bacteria | 18272 |
| 376 | Ga0495672_0000032 | 3300047320 | Bacteria | 295356 |
| 377 | Ga0495672_0000141 | 3300047320 | Bacteria | 106630 |
| 378 | Ga0495672_0006210 | 3300047320 | Bacteria | 9319 |
| 379 | Ga0495672_0123895 | 3300047320 | Bacteria | 1369 |
| 380 | Ga0495676_0043551 | 3300047321 | Bacteria | 3671 |
| 381 | Ga0495676_0051098 | 3300047321 | Bacteria | 3310 |
| 382 | Ga0495683_0004190 | 3300047323 | Bacteria | 8240 |
| 383 | Ga0495683_0005815 | 3300047323 | Bacteria | 6788 |
| 384 | Ga0495683_0036403 | 3300047323 | Bacteria | 2498 |
| 385 | Ga0495687_000173 | 3300047443 | Bacteria | 95361 |
| 386 | Ga0495687_001010 | 3300047443 | Bacteria | 28108 |
| 387 | Ga0495687_002259 | 3300047443 | Bacteria | 15808 |
| 388 | Ga0495687_009416 | 3300047443 | Bacteria | 5462 |
| 389 | Ga0495687_017487 | 3300047443 | Bacteria | 3575 |
| 390 | Ga0495677_0000185 | 3300047445 | Bacteria | 28982 |
| 391 | Ga0495677_0001794 | 3300047445 | Bacteria | 8593 |
| 392 | Ga0495677_0020491 | 3300047445 | Bacteria | 2397 |
| 393 | Ga0495685_000027 | 3300047447 | Bacteria | 62875 |
| 394 | Ga0495673_0000006 | 3300047469 | Bacteria | 908691 |
| 395 | Ga0495673_0000024 | 3300047469 | Bacteria | 521349 |
| 396 | Ga0495673_0000141 | 3300047469 | Bacteria | 128600 |
| 397 | Ga0495673_0025814 | 3300047469 | Bacteria | 2816 |
| 398 | Ga0495673_0039632 | 3300047469 | Bacteria | 2136 |
| 399 | Ga0495681_0000323 | 3300047470 | Bacteria | 38034 |
| 400 | Ga0495681_0000900 | 3300047470 | Bacteria | 22976 |
| 401 | Ga0495681_0005585 | 3300047470 | Bacteria | 8395 |
| 402 | Ga0495686_0000147 | 3300047472 | Bacteria | 139008 |
| 403 | Ga0495686_0000225 | 3300047472 | Bacteria | 104121 |
| 404 | Ga0495686_0000407 | 3300047472 | Bacteria | 68110 |
| 405 | Ga0495686_0000844 | 3300047472 | Bacteria | 39354 |
| 406 | Ga0495686_0001226 | 3300047472 | Bacteria | 29331 |
| 407 | Ga0495686_0001900 | 3300047472 | Bacteria | 20870 |
| 408 | Ga0495686_0009599 | 3300047472 | Bacteria | 6953 |
| 409 | Ga0495686_0012927 | 3300047472 | Bacteria | 5821 |
| 410 | Ga0495686_0038895 | 3300047472 | Bacteria | 3041 |
| 411 | Ga0495686_0047544 | 3300047472 | Bacteria | 2708 |
| 412 | Ga0495626_0063968 | 3300048091 | Bacteria | 1667 |
| 413 | Ga0496102_0122660 | 3300048905 | Bacteria | 2428 |
| 414 | Ga0496103_0001278 | 3300048906 | Bacteria | 17158 |
| 415 | Ga0496103_0002431 | 3300048906 | Bacteria | 11721 |
| 416 | Ga0496113_0022033 | 3300048916 | Bacteria | 4500 |
| 417 | Ga0496116_0009789 | 3300048919 | Bacteria | 8128 |
| 418 | Ga0496116_0046608 | 3300048919 | Bacteria | 2925 |
| 419 | Ga0496116_0081891 | 3300048919 | Bacteria | 1999 |
| 420 | Ga0496116_0099483 | 3300048919 | Bacteria | 1741 |
| 421 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 422 | Ga0496117_0007559 | 3300048920 | Bacteria | 10584 |
| 423 | Ga0496117_0014903 | 3300048920 | Bacteria | 6666 |
| 424 | Ga0496117_0037156 | 3300048920 | Bacteria | 3632 |
| 425 | Ga0496117_0100800 | 3300048920 | Bacteria | 1828 |
| 426 | Ga0496118_0000008 | 3300048921 | Bacteria | 644537 |
| 427 | Ga0496118_0031397 | 3300048921 | Bacteria | 4404 |
| 428 | Ga0496119_0061244 | 3300048922 | Bacteria | 2249 |
| 429 | Ga0496120_0046529 | 3300048923 | Bacteria | 2507 |
| 430 | Ga0496120_0071956 | 3300048923 | Bacteria | 1896 |
| 431 | Ga0496121_0003499 | 3300048924 | Bacteria | 22330 |
| 432 | Ga0496121_0005228 | 3300048924 | Bacteria | 16801 |
| 433 | Ga0496121_0005483 | 3300048924 | Bacteria | 16244 |
| 434 | Ga0496121_0009467 | 3300048924 | Bacteria | 11193 |
| 435 | Ga0496121_0015509 | 3300048924 | Bacteria | 7976 |
| 436 | Ga0496121_0053674 | 3300048924 | Bacteria | 3375 |
| 437 | Ga0496121_0056640 | 3300048924 | Bacteria | 3254 |
| 438 | Ga0496122_0006027 | 3300048925 | Bacteria | 14139 |
| 439 | Ga0496122_0006290 | 3300048925 | Bacteria | 13694 |
| 440 | Ga0496122_0009790 | 3300048925 | Bacteria | 10009 |
| 441 | Ga0496122_0017615 | 3300048925 | Bacteria | 6664 |
| 442 | Ga0496122_0090148 | 3300048925 | Bacteria | 2093 |
| 443 | Ga0496122_0161094 | 3300048925 | Bacteria | 1368 |
| 444 | Ga0496123_0002569 | 3300048926 | Bacteria | 22100 |
| 445 | Ga0496123_0003542 | 3300048926 | Bacteria | 17370 |
| 446 | Ga0496123_0018098 | 3300048926 | Bacteria | 5629 |
| 447 | Ga0496124_0125439 | 3300048927 | Bacteria | 2046 |
| 448 | Ga0496125_0012910 | 3300048928 | Bacteria | 8247 |
| 449 | Ga0496125_0018792 | 3300048928 | Bacteria | 6547 |
| 450 | Ga0496125_0039508 | 3300048928 | Bacteria | 4061 |
| 451 | Ga0496125_0089219 | 3300048928 | Bacteria | 2320 |
| 452 | Ga0496126_0003811 | 3300048929 | Bacteria | 18697 |
| 453 | Ga0496126_0050681 | 3300048929 | Bacteria | 3782 |
| 454 | Ga0495678_000016 | 3300049459 | Bacteria | 303426 |
| 455 | Ga0495678_000101 | 3300049459 | Bacteria | 104596 |
| 456 | Ga0495678_004137 | 3300049459 | Bacteria | 8577 |
| 457 | Ga0495678_009262 | 3300049459 | Bacteria | 4889 |
| 458 | Ga0495678_043885 | 3300049459 | Bacteria | 1773 |
| 459 | Ga0495682_0000388 | 3300049460 | Bacteria | 31810 |
| 460 | Ga0495682_0000800 | 3300049460 | Bacteria | 19901 |
| 461 | Ga0495682_0010270 | 3300049460 | Bacteria | 3632 |
| 462 | Ga0501036_0085766 | 3300049572 | Bacteria | 2662 |
| 463 | Ga0501249_000185 | 3300049679 | Bacteria | 19045 |
| 464 | Ga0501269_000195 | 3300049766 | Bacteria | 18239 |
| 465 | Ga0501044_0010579 | 3300049823 | Bacteria | 10009 |
| 466 | Ga0500643_001312 | 3300053087 | Bacteria | 14605 |
| 467 | Ga0500566_0143230 | 3300053094 | Bacteria | 1266 |
| 468 | Ga0500641_0013166 | 3300053096 | Bacteria | 3036 |
| 469 | Ga0500555_000072 | 3300053103 | Bacteria | 49690 |
| 470 | Ga0500594_0024621 | 3300053118 | Bacteria | 1535 |
| 471 | Ga0500594_0039531 | 3300053118 | Bacteria | 1283 |
| 472 | Ga0500607_001611 | 3300053121 | Bacteria | 19933 |
| 473 | Ga0500608_093429 | 3300053122 | Bacteria | 1402 |
| 474 | Ga0500618_000816 | 3300053125 | Bacteria | 17142 |
| 475 | Ga0500586_000584 | 3300053145 | Bacteria | 7421 |
| 476 | Ga0500586_001585 | 3300053145 | Bacteria | 4855 |
| 477 | Ga0500616_0003309 | 3300053153 | Bacteria | 12426 |
| 478 | Ga0500624_000053 | 3300053157 | Bacteria | 74086 |
| 479 | Ga0500645_003142 | 3300053730 | Bacteria | 6871 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048920 | Ga0496117_0100800 | Ga0496117_0100800_18_914 | 298 |
| 2 | 3300038443 | Ga0395901_0000332 | Ga0395901_0000332_21114_22037 | 303 |
| 3 | 3300048925 | Ga0496122_0161094 | Ga0496122_0161094_26_949 | 307 |
| 4 | 3300046519 | Ga0495632_0003011 | Ga0495632_0003011_10946_12073 | 311 |
| 5 | 3300046665 | Ga0495661_0061247 | Ga0495661_0061247_867_1994 | 311 |
| 6 | 3300028381 | Ga0268264_10000913 | Ga0268264_1000091315 | 314 |
| 7 | 3300038443 | Ga0395901_0559257 | Ga0395901_0559257_98_1102 | 314 |
| 8 | 3300046452 | Ga0495617_013183 | Ga0495617_013183_166_1350 | 316 |
| 9 | 3300037418 | Ga0395900_0108389 | Ga0395900_0108389_1005_2129 | 323 |
| 10 | 3300037471 | Ga0395905_0082091 | Ga0395905_0082091_638_1762 | 323 |
| 11 | 3300037418 | Ga0395900_0000322 | Ga0395900_0000322_34616_35677 | 324 |
| 12 | 3300045836 | Ga0466958_0030310 | Ga0466958_0030310_917_2041 | 324 |
| 13 | 3300046506 | Ga0495583_0000060 | Ga0495583_0000060_75775_76785 | 325 |
| 14 | 3300046674 | Ga0495588_0000172 | Ga0495588_0000172_37465_38571 | 325 |
| 15 | 3300045836 | Ga0466958_0191697 | Ga0466958_0191697_19_1125 | 326 |
| 16 | 3300047472 | Ga0495686_0001226 | Ga0495686_0001226_13704_14849 | 326 |
| 17 | 3300046506 | Ga0495583_0053552 | Ga0495583_0053552_610_1752 | 327 |
| 18 | 3300046507 | Ga0495606_0011131 | Ga0495606_0011131_2740_3882 | 327 |
| 19 | 3300046558 | Ga0495633_0012880 | Ga0495633_0012880_53_1195 | 327 |
| 20 | 3300046501 | Ga0495607_0006440 | Ga0495607_0006440_7039_8226 | 328 |
| 21 | 3300046615 | Ga0495656_0058264 | Ga0495656_0058264_463_1650 | 328 |
| 22 | 3300047320 | Ga0495672_0006210 | Ga0495672_0006210_210_1397 | 328 |
| 23 | 3300003759 | Ga0055525_1000028 | Ga0055525_1000028274 | 329 |
| 24 | 3300025230 | Ga0209563_100011 | Ga0209563_10001135 | 329 |
| 25 | 3300038705 | Ga0237819_02012 | Ga0237819_02012_754_1791 | 330 |
| 26 | 3300047469 | Ga0495673_0039632 | Ga0495673_0039632_732_1838 | 330 |
| 27 | 3300048929 | Ga0496126_0050681 | Ga0496126_0050681_32_1024 | 330 |
| 28 | iso_pu_bacteria | 2885080285 | 2885086445 | 331 |
| 29 | 3300048916 | Ga0496113_0022033 | Ga0496113_0022033_1670_2815 | 333 |
| 30 | 3300048925 | Ga0496122_0006290 | Ga0496122_0006290_9885_11030 | 333 |
| 31 | 3300048928 | Ga0496125_0089219 | Ga0496125_0089219_362_1507 | 333 |
| 32 | 3300046492 | Ga0495585_0004903 | Ga0495585_0004903_752_1927 | 335 |
| 33 | 3300046501 | Ga0495607_0021458 | Ga0495607_0021458_2404_3582 | 335 |
| 34 | 3300046506 | Ga0495583_0000165 | Ga0495583_0000165_63100_64278 | 335 |
| 35 | 3300046513 | Ga0495616_0089918 | Ga0495616_0089918_166_1344 | 335 |
| 36 | 3300046519 | Ga0495632_0082001 | Ga0495632_0082001_56_1177 | 335 |
| 37 | 3300046523 | Ga0495644_0000624 | Ga0495644_0000624_9514_10692 | 335 |
| 38 | 3300046523 | Ga0495644_0000854 | Ga0495644_0000854_7365_8543 | 335 |
| 39 | 3300046524 | Ga0495648_0000456 | Ga0495648_0000456_6716_7894 | 335 |
| 40 | 3300046538 | Ga0495609_0000996 | Ga0495609_0000996_1541_2719 | 335 |
| 41 | 3300046615 | Ga0495656_0001555 | Ga0495656_0001555_112_1287 | 335 |
| 42 | 3300046648 | Ga0495611_0000992 | Ga0495611_0000992_7225_8403 | 335 |
| 43 | 3300046648 | Ga0495611_0001776 | Ga0495611_0001776_749_1927 | 335 |
| 44 | 3300046660 | Ga0495625_0134330 | Ga0495625_0134330_329_1507 | 335 |
| 45 | 3300046660 | Ga0495625_0151662 | Ga0495625_0151662_167_1342 | 335 |
| 46 | 3300046664 | Ga0495659_0000397 | Ga0495659_0000397_8860_10038 | 335 |
| 47 | 3300046692 | Ga0495671_0014070 | Ga0495671_0014070_2387_3565 | 335 |
| 48 | 3300047318 | Ga0495636_0000323 | Ga0495636_0000323_7784_8962 | 335 |
| 49 | 3300047323 | Ga0495683_0005815 | Ga0495683_0005815_218_1393 | 335 |
| 50 | 3300047443 | Ga0495687_000173 | Ga0495687_000173_19071_20249 | 335 |
| 51 | 3300047445 | Ga0495677_0001794 | Ga0495677_0001794_515_1693 | 335 |
| 52 | 3300047447 | Ga0495685_000027 | Ga0495685_000027_30848_32026 | 335 |
| 53 | 3300047469 | Ga0495673_0025814 | Ga0495673_0025814_216_1391 | 335 |
| 54 | 3300047472 | Ga0495686_0000147 | Ga0495686_0000147_79740_80861 | 335 |
| 55 | 3300047472 | Ga0495686_0038895 | Ga0495686_0038895_1368_2546 | 335 |
| 56 | 3300049459 | Ga0495678_004137 | Ga0495678_004137_6950_8128 | 335 |
| 57 | 3300049460 | Ga0495682_0000388 | Ga0495682_0000388_12651_13829 | 335 |
| 58 | 3300053096 | Ga0500641_0013166 | Ga0500641_0013166_837_1949 | 335 |
| 59 | 3300053125 | Ga0500618_000816 | Ga0500618_000816_15948_17072 | 335 |
| 60 | 3300003322 | rootL2_10106073 | rootL2_101060731 | 336 |
| 61 | 3300046513 | Ga0495616_0008581 | Ga0495616_0008581_3259_4434 | 336 |
| 62 | 3300046538 | Ga0495609_0000293 | Ga0495609_0000293_12450_13625 | 336 |
| 63 | 3300046660 | Ga0495625_0097716 | Ga0495625_0097716_335_1510 | 336 |
| 64 | 3300047321 | Ga0495676_0051098 | Ga0495676_0051098_1003_2139 | 336 |
| 65 | 3300009177 | Ga0105248_10001468 | Ga0105248_100014683 | 337 |
| 66 | 3300025941 | Ga0207711_10001028 | Ga0207711_1000102810 | 337 |
| 67 | 3300031507 | Ga0307509_10000022 | Ga0307509_10000022218 | 337 |
| 68 | 3300046557 | Ga0495622_0000004 | Ga0495622_0000004_112150_113289 | 337 |
| 69 | 3300046684 | Ga0495669_0001330 | Ga0495669_0001330_6790_7965 | 337 |
| 70 | 3300046810 | Ga0495660_0001205 | Ga0495660_0001205_4239_5399 | 337 |
| 71 | 3300047443 | Ga0495687_017487 | Ga0495687_017487_934_2109 | 337 |
| 72 | 3300047445 | Ga0495677_0020491 | Ga0495677_0020491_1190_2365 | 337 |
| 73 | 3300047470 | Ga0495681_0005585 | Ga0495681_0005585_4984_6159 | 337 |
| 74 | 3300047472 | Ga0495686_0012927 | Ga0495686_0012927_1396_2556 | 337 |
| 75 | 3300002459 | JGI24751J29686_10000387 | JGI24751J29686_1000038710 | 338 |
| 76 | 3300005331 | Ga0070670_100000003 | Ga0070670_100000003237 | 338 |
| 77 | 3300005353 | Ga0070669_100000084 | Ga0070669_10000008423 | 338 |
| 78 | 3300005367 | Ga0070667_100000886 | Ga0070667_1000008864 | 338 |
| 79 | 3300005617 | Ga0068859_100002121 | Ga0068859_1000021219 | 338 |
| 80 | 3300005618 | Ga0068864_100000005 | Ga0068864_100000005102 | 338 |
| 81 | 3300006931 | Ga0097620_100002121 | Ga0097620_1000021219 | 338 |
| 82 | 3300009177 | Ga0105248_10001700 | Ga0105248_1000170017 | 338 |
| 83 | 3300009553 | Ga0105249_10027062 | Ga0105249_100270624 | 338 |
| 84 | 3300014326 | Ga0157380_10000041 | Ga0157380_1000004134 | 338 |
| 85 | 3300025923 | Ga0207681_10000005 | Ga0207681_10000005495 | 338 |
| 86 | 3300025925 | Ga0207650_10000004 | Ga0207650_10000004234 | 338 |
| 87 | 3300025941 | Ga0207711_10005807 | Ga0207711_100058073 | 338 |
| 88 | 3300025986 | Ga0207658_10003849 | Ga0207658_1000384910 | 338 |
| 89 | 3300026095 | Ga0207676_10000006 | Ga0207676_10000006477 | 338 |
| 90 | 3300046500 | Ga0495596_0000359 | Ga0495596_0000359_24540_25685 | 338 |
| 91 | 3300031456 | Ga0307513_10046357 | Ga0307513_100463572 | 339 |
| 92 | 3300046452 | Ga0495617_003370 | Ga0495617_003370_2457_3644 | 339 |
| 93 | 3300046491 | Ga0495584_0001074 | Ga0495584_0001074_8059_9243 | 339 |
| 94 | 3300046513 | Ga0495616_0001483 | Ga0495616_0001483_7000_8184 | 339 |
| 95 | 3300046520 | Ga0495637_0000747 | Ga0495637_0000747_7031_8212 | 339 |
| 96 | 3300046530 | Ga0495654_0000035 | Ga0495654_0000035_85567_86748 | 339 |
| 97 | 3300046538 | Ga0495609_0014079 | Ga0495609_0014079_1541_2728 | 339 |
| 98 | 3300046660 | Ga0495625_0060507 | Ga0495625_0060507_12_1055 | 339 |
| 99 | 3300046665 | Ga0495661_0046638 | Ga0495661_0046638_46_1230 | 339 |
| 100 | 3300046691 | Ga0495670_0002420 | Ga0495670_0002420_766_1950 | 339 |
| 101 | 3300049460 | Ga0495682_0000800 | Ga0495682_0000800_6504_7691 | 339 |
| 102 | 3300048920 | Ga0496117_0007559 | Ga0496117_0007559_536_1642 | 340 |
| 103 | 3300048923 | Ga0496120_0046529 | Ga0496120_0046529_716_1822 | 340 |
| 104 | 3300048925 | Ga0496122_0017615 | Ga0496122_0017615_3968_5074 | 340 |
| 105 | 3300048926 | Ga0496123_0003542 | Ga0496123_0003542_5169_6275 | 340 |
| 106 | 3300044683 | Ga0466965_0155838 | Ga0466965_0155838_37_1143 | 341 |
| 107 | 3300046471 | Ga0495650_0017461 | Ga0495650_0017461_72_1202 | 341 |
| 108 | 3300048919 | Ga0496116_0046608 | Ga0496116_0046608_445_1650 | 341 |
| 109 | 3300005841 | Ga0068863_100001275 | Ga0068863_10000127516 | 342 |
| 110 | 3300005844 | Ga0068862_100000697 | Ga0068862_10000069718 | 342 |
| 111 | 3300013307 | Ga0157372_10633681 | Ga0157372_106336811 | 342 |
| 112 | 3300026088 | Ga0207641_10004468 | Ga0207641_100044683 | 342 |
| 113 | 3300028380 | Ga0268265_10000616 | Ga0268265_1000061615 | 342 |
| 114 | 3300046471 | Ga0495650_0001195 | Ga0495650_0001195_18696_19817 | 342 |
| 115 | 3300046507 | Ga0495606_0001656 | Ga0495606_0001656_22909_24030 | 342 |
| 116 | 3300021361 | Ga0213872_10001897 | Ga0213872_1000189713 | 343 |
| 117 | 3300025728 | Ga0207655_1006948 | Ga0207655_10069482 | 343 |
| 118 | 3300026142 | Ga0207698_10109382 | Ga0207698_101093822 | 343 |
| 119 | 3300039447 | Ga0436361_0471040 | Ga0436361_0471040_3718_4977 | 343 |
| 120 | 3300046512 | Ga0495610_0027246 | Ga0495610_0027246_1413_2606 | 343 |
| 121 | 3300046522 | Ga0495643_0066802 | Ga0495643_0066802_727_1821 | 343 |
| 122 | 3300046660 | Ga0495625_0010738 | Ga0495625_0010738_2433_3626 | 343 |
| 123 | 3300048905 | Ga0496102_0122660 | Ga0496102_0122660_285_1379 | 343 |
| 124 | 3300048906 | Ga0496103_0001278 | Ga0496103_0001278_9598_10800 | 343 |
| 125 | 3300048925 | Ga0496122_0009790 | Ga0496122_0009790_7346_8440 | 343 |
| 126 | 3300049572 | Ga0501036_0085766 | Ga0501036_0085766_818_1912 | 343 |
| 127 | 3300049766 | Ga0501269_000195 | Ga0501269_000195_3387_4592 | 343 |
| 128 | 3300053121 | Ga0500607_001611 | Ga0500607_001611_9069_10175 | 343 |
| 129 | 3300053730 | Ga0500645_003142 | Ga0500645_003142_1539_2645 | 343 |
| 130 | 3300013102 | Ga0157371_10083142 | Ga0157371_100831422 | 344 |
| 131 | 3300039447 | Ga0436361_1096673 | Ga0436361_1096673_182_1405 | 344 |
| 132 | 3300046507 | Ga0495606_0001448 | Ga0495606_0001448_17427_18611 | 344 |
| 133 | 3300005339 | Ga0070660_100149194 | Ga0070660_1001491942 | 345 |
| 134 | 3300005458 | Ga0070681_10010127 | Ga0070681_100101277 | 345 |
| 135 | 3300005547 | Ga0070693_100008581 | Ga0070693_1000085816 | 345 |
| 136 | 3300013307 | Ga0157372_10311479 | Ga0157372_103114792 | 345 |
| 137 | 3300015262 | Ga0182007_10015196 | Ga0182007_100151963 | 345 |
| 138 | 3300025919 | Ga0207657_10121410 | Ga0207657_101214104 | 345 |
| 139 | 3300025919 | Ga0207657_10122603 | Ga0207657_101226032 | 345 |
| 140 | 3300025932 | Ga0207690_10008359 | Ga0207690_100083593 | 345 |
| 141 | 3300026116 | Ga0207674_10029429 | Ga0207674_100294297 | 345 |
| 142 | 3300038443 | Ga0395901_0000712 | Ga0395901_0000712_33523_34665 | 345 |
| 143 | 3300046474 | Ga0495605_0000003 | Ga0495605_0000003_132379_133554 | 345 |
| 144 | 3300046692 | Ga0495671_0035481 | Ga0495671_0035481_30_1166 | 345 |
| 145 | 3300046810 | Ga0495660_0000126 | Ga0495660_0000126_8678_9916 | 345 |
| 146 | 3300053118 | Ga0500594_0024621 | Ga0500594_0024621_378_1484 | 345 |
| 147 | 3300009551 | Ga0105238_10027777 | Ga0105238_100277775 | 346 |
| 148 | 3300021361 | Ga0213872_10000975 | Ga0213872_1000097513 | 346 |
| 149 | 3300025254 | Ga0209148_1000061 | Ga0209148_1000061276 | 346 |
| 150 | 3300025924 | Ga0207694_10048035 | Ga0207694_100480352 | 346 |
| 151 | 3300039447 | Ga0436361_0887554 | Ga0436361_0887554_11907_13184 | 346 |
| 152 | 3300046528 | Ga0495642_0065706 | Ga0495642_0065706_99_1286 | 346 |
| 153 | 3300046660 | Ga0495625_0000335 | Ga0495625_0000335_5356_6561 | 346 |
| 154 | 3300047472 | Ga0495686_0000407 | Ga0495686_0000407_11319_12518 | 346 |
| 155 | 3300010375 | Ga0105239_10046782 | Ga0105239_100467823 | 347 |
| 156 | 3300009093 | Ga0105240_10070818 | Ga0105240_100708184 | 348 |
| 157 | 3300014497 | Ga0182008_10000357 | Ga0182008_1000035723 | 348 |
| 158 | 3300015261 | Ga0182006_1000002 | Ga0182006_100000279 | 348 |
| 159 | 3300015262 | Ga0182007_10000162 | Ga0182007_1000016230 | 348 |
| 160 | 3300015265 | Ga0182005_1000029 | Ga0182005_1000029100 | 348 |
| 161 | 3300021361 | Ga0213872_10008134 | Ga0213872_100081342 | 348 |
| 162 | 3300025913 | Ga0207695_10041776 | Ga0207695_100417762 | 348 |
| 163 | 3300032004 | Ga0307414_10128848 | Ga0307414_101288482 | 348 |
| 164 | 3300039447 | Ga0436361_0089506 | Ga0436361_0089506_455_1693 | 348 |
| 165 | 3300041491 | Ga0451833_0691704 | Ga0451833_0691704_319_1434 | 348 |
| 166 | 3300046460 | Ga0495638_0011182 | Ga0495638_0011182_3051_4172 | 348 |
| 167 | 3300046506 | Ga0495583_0000033 | Ga0495583_0000033_167612_168733 | 348 |
| 168 | 3300046507 | Ga0495606_0079839 | Ga0495606_0079839_67_1254 | 348 |
| 169 | 3300046513 | Ga0495616_0131214 | Ga0495616_0131214_58_1128 | 348 |
| 170 | 3300046557 | Ga0495622_0034780 | Ga0495622_0034780_1144_2274 | 348 |
| 171 | 3300046558 | Ga0495633_0007560 | Ga0495633_0007560_2278_3408 | 348 |
| 172 | 3300046616 | Ga0495668_0000018 | Ga0495668_0000018_116904_118094 | 348 |
| 173 | 3300046665 | Ga0495661_0022896 | Ga0495661_0022896_35_1177 | 348 |
| 174 | 3300046691 | Ga0495670_0015948 | Ga0495670_0015948_2450_3571 | 348 |
| 175 | 3300047443 | Ga0495687_009416 | Ga0495687_009416_4019_5125 | 348 |
| 176 | 3300048919 | Ga0496116_0099483 | Ga0496116_0099483_33_1163 | 348 |
| 177 | 3300048920 | Ga0496117_0000001 | Ga0496117_0000001_1998312_1999454 | 348 |
| 178 | 3300048921 | Ga0496118_0000008 | Ga0496118_0000008_116605_117747 | 348 |
| 179 | 3300048924 | Ga0496121_0009467 | Ga0496121_0009467_8194_9324 | 348 |
| 180 | 3300048924 | Ga0496121_0015509 | Ga0496121_0015509_5601_6731 | 348 |
| 181 | 3300048925 | Ga0496122_0006027 | Ga0496122_0006027_9438_10568 | 348 |
| 182 | 3300048926 | Ga0496123_0018098 | Ga0496123_0018098_1375_2505 | 348 |
| 183 | 3300048927 | Ga0496124_0125439 | Ga0496124_0125439_18_1139 | 348 |
| 184 | 3300049460 | Ga0495682_0010270 | Ga0495682_0010270_679_1800 | 348 |
| 185 | 3300053103 | Ga0500555_000072 | Ga0500555_000072_45035_46156 | 348 |
| 186 | iso_pu_bacteria | 2600255292 | 2601670763 | 348 |
| 187 | iso_pu_bacteria | 2857547612 | 2857552658 | 348 |
| 188 | iso_pu_bacteria | 2932410948 | 2932414974 | 348 |
| 189 | iso_pu_bacteria | 2932416698 | 2932419660 | 348 |
| 190 | 3300002739 | JGI25158J39367_1000633 | JGI25158J39367_10006334 | 349 |
| 191 | 3300003374 | JGI25161J50226_1000390 | JGI25161J50226_10003909 | 349 |
| 192 | 3300003763 | Ga0055529_1000407 | Ga0055529_10004073 | 349 |
| 193 | 3300003773 | Ga0055537_1000062 | Ga0055537_100006256 | 349 |
| 194 | 3300003773 | Ga0055537_1000451 | Ga0055537_10004514 | 349 |
| 195 | 3300003775 | Ga0055524_1002341 | Ga0055524_10023415 | 349 |
| 196 | 3300003784 | Ga0055534_1000019 | Ga0055534_100001939 | 349 |
| 197 | 3300003790 | Ga0055528_1000048 | Ga0055528_10000484 | 349 |
| 198 | 3300004625 | Ga0055543_1000450 | Ga0055543_100045023 | 349 |
| 199 | 3300005262 | Ga0065165_1001392 | Ga0065165_10013928 | 349 |
| 200 | 3300025208 | Ga0209436_100062 | Ga0209436_10006241 | 349 |
| 201 | 3300025250 | Ga0209026_1002852 | Ga0209026_10028522 | 349 |
| 202 | 3300025263 | Ga0209565_1000017 | Ga0209565_1000017316 | 349 |
| 203 | 3300025272 | Ga0209455_1000330 | Ga0209455_10003303 | 349 |
| 204 | 3300025273 | Ga0209673_1000007 | Ga0209673_1000007113 | 349 |
| 205 | 3300025284 | Ga0209130_1000336 | Ga0209130_100033636 | 349 |
| 206 | 3300025291 | Ga0209675_1000009 | Ga0209675_1000009405 | 349 |
| 207 | 3300025295 | Ga0209564_1000036 | Ga0209564_1000036113 | 349 |
| 208 | 3300025299 | Ga0209256_1000091 | Ga0209256_1000091113 | 349 |
| 209 | 3300037471 | Ga0395905_0118935 | Ga0395905_0118935_571_1695 | 349 |
| 210 | 3300046491 | Ga0495584_0004303 | Ga0495584_0004303_6570_7661 | 349 |
| 211 | 3300046492 | Ga0495585_0001792 | Ga0495585_0001792_3244_4350 | 349 |
| 212 | 3300046507 | Ga0495606_0008588 | Ga0495606_0008588_5430_6539 | 349 |
| 213 | 3300046518 | Ga0495631_0000750 | Ga0495631_0000750_14303_15409 | 349 |
| 214 | 3300046524 | Ga0495648_0052523 | Ga0495648_0052523_14_1237 | 349 |
| 215 | 3300046558 | Ga0495633_0001445 | Ga0495633_0001445_5653_6759 | 349 |
| 216 | 3300046665 | Ga0495661_0000324 | Ga0495661_0000324_39627_40733 | 349 |
| 217 | 3300046691 | Ga0495670_0000931 | Ga0495670_0000931_10291_11397 | 349 |
| 218 | 3300047320 | Ga0495672_0000032 | Ga0495672_0000032_36174_37388 | 349 |
| 219 | 3300047321 | Ga0495676_0043551 | Ga0495676_0043551_489_1598 | 349 |
| 220 | 3300047445 | Ga0495677_0000185 | Ga0495677_0000185_10330_11436 | 349 |
| 221 | 3300047470 | Ga0495681_0000323 | Ga0495681_0000323_11426_12532 | 349 |
| 222 | 3300047472 | Ga0495686_0001900 | Ga0495686_0001900_12840_13922 | 349 |
| 223 | 3300049459 | Ga0495678_043885 | Ga0495678_043885_486_1700 | 349 |
| 224 | 3300053087 | Ga0500643_001312 | Ga0500643_001312_7806_8900 | 349 |
| 225 | 3300004625 | Ga0055543_1005027 | Ga0055543_10050274 | 350 |
| 226 | 3300005262 | Ga0065165_1000111 | Ga0065165_100011196 | 350 |
| 227 | 3300025284 | Ga0209130_1000139 | Ga0209130_100013929 | 350 |
| 228 | 3300028794 | Ga0307515_10136714 | Ga0307515_101367143 | 350 |
| 229 | 3300048928 | Ga0496125_0039508 | Ga0496125_0039508_1479_2570 | 350 |
| 230 | 3300003215 | JGI25153J46596_10033832 | JGI25153J46596_100338322 | 351 |
| 231 | 3300003771 | Ga0055526_1000366 | Ga0055526_100036626 | 351 |
| 232 | 3300003771 | Ga0055526_1000591 | Ga0055526_100059116 | 351 |
| 233 | 3300005347 | Ga0070668_100002381 | Ga0070668_1000023813 | 351 |
| 234 | 3300005355 | Ga0070671_100001022 | Ga0070671_10000102210 | 351 |
| 235 | 3300005367 | Ga0070667_100093295 | Ga0070667_1000932952 | 351 |
| 236 | 3300005539 | Ga0068853_100119408 | Ga0068853_1001194082 | 351 |
| 237 | 3300005548 | Ga0070665_100000388 | Ga0070665_1000003883 | 351 |
| 238 | 3300005578 | Ga0068854_100000027 | Ga0068854_1000000278 | 351 |
| 239 | 3300005844 | Ga0068862_100030628 | Ga0068862_1000306282 | 351 |
| 240 | 3300006237 | Ga0097621_100002061 | Ga0097621_1000020613 | 351 |
| 241 | 3300006358 | Ga0068871_100002074 | Ga0068871_1000020743 | 351 |
| 242 | 3300009011 | Ga0105251_10000574 | Ga0105251_100005744 | 351 |
| 243 | 3300009174 | Ga0105241_10084693 | Ga0105241_100846932 | 351 |
| 244 | 3300009177 | Ga0105248_10007301 | Ga0105248_1000730110 | 351 |
| 245 | 3300010375 | Ga0105239_10004123 | Ga0105239_100041236 | 351 |
| 246 | 3300013307 | Ga0157372_10200471 | Ga0157372_102004712 | 351 |
| 247 | 3300025294 | Ga0209025_1008705 | Ga0209025_10087052 | 351 |
| 248 | 3300025295 | Ga0209564_1000009 | Ga0209564_1000009773 | 351 |
| 249 | 3300025295 | Ga0209564_1000045 | Ga0209564_1000045186 | 351 |
| 250 | 3300025297 | Ga0209758_1000456 | Ga0209758_100045663 | 351 |
| 251 | 3300025728 | Ga0207655_1009877 | Ga0207655_10098772 | 351 |
| 252 | 3300025735 | Ga0207713_1002768 | Ga0207713_10027687 | 351 |
| 253 | 3300025911 | Ga0207654_10091068 | Ga0207654_100910682 | 351 |
| 254 | 3300025924 | Ga0207694_10045106 | Ga0207694_100451061 | 351 |
| 255 | 3300025931 | Ga0207644_10001031 | Ga0207644_100010312 | 351 |
| 256 | 3300025941 | Ga0207711_10002707 | Ga0207711_100027073 | 351 |
| 257 | 3300025972 | Ga0207668_10000772 | Ga0207668_1000077212 | 351 |
| 258 | 3300025981 | Ga0207640_10000145 | Ga0207640_1000014534 | 351 |
| 259 | 3300025986 | Ga0207658_10010932 | Ga0207658_100109322 | 351 |
| 260 | 3300026035 | Ga0207703_10179181 | Ga0207703_101791811 | 351 |
| 261 | 3300026041 | Ga0207639_10007809 | Ga0207639_100078097 | 351 |
| 262 | 3300026088 | Ga0207641_10004653 | Ga0207641_100046534 | 351 |
| 263 | 3300028379 | Ga0268266_10001970 | Ga0268266_1000197015 | 351 |
| 264 | 3300028381 | Ga0268264_10020157 | Ga0268264_100201572 | 351 |
| 265 | 3300046471 | Ga0495650_0000131 | Ga0495650_0000131_74541_75746 | 351 |
| 266 | 3300046471 | Ga0495650_0000189 | Ga0495650_0000189_75474_76679 | 351 |
| 267 | 3300046491 | Ga0495584_0004746 | Ga0495584_0004746_2899_4038 | 351 |
| 268 | 3300046500 | Ga0495596_0012606 | Ga0495596_0012606_670_1809 | 351 |
| 269 | 3300046501 | Ga0495607_0004417 | Ga0495607_0004417_6134_7273 | 351 |
| 270 | 3300046501 | Ga0495607_0005378 | Ga0495607_0005378_2654_3859 | 351 |
| 271 | 3300046513 | Ga0495616_0017476 | Ga0495616_0017476_776_1915 | 351 |
| 272 | 3300046518 | Ga0495631_0001299 | Ga0495631_0001299_1236_2375 | 351 |
| 273 | 3300046528 | Ga0495642_0007637 | Ga0495642_0007637_2093_3232 | 351 |
| 274 | 3300046538 | Ga0495609_0010890 | Ga0495609_0010890_2947_4092 | 351 |
| 275 | 3300046538 | Ga0495609_0042192 | Ga0495609_0042192_133_1272 | 351 |
| 276 | 3300046558 | Ga0495633_0007281 | Ga0495633_0007281_37_1242 | 351 |
| 277 | 3300046615 | Ga0495656_0008629 | Ga0495656_0008629_370_1509 | 351 |
| 278 | 3300046616 | Ga0495668_0043248 | Ga0495668_0043248_1054_2199 | 351 |
| 279 | 3300046674 | Ga0495588_0067834 | Ga0495588_0067834_263_1405 | 351 |
| 280 | 3300046684 | Ga0495669_0037689 | Ga0495669_0037689_522_1661 | 351 |
| 281 | 3300046794 | Ga0495589_0024804 | Ga0495589_0024804_816_1955 | 351 |
| 282 | 3300047320 | Ga0495672_0123895 | Ga0495672_0123895_29_1168 | 351 |
| 283 | 3300048091 | Ga0495626_0063968 | Ga0495626_0063968_43_1182 | 351 |
| 284 | 3300048906 | Ga0496103_0002431 | Ga0496103_0002431_244_1359 | 351 |
| 285 | 3300048919 | Ga0496116_0009789 | Ga0496116_0009789_6420_7535 | 351 |
| 286 | 3300048920 | Ga0496117_0037156 | Ga0496117_0037156_762_1877 | 351 |
| 287 | 3300048924 | Ga0496121_0005483 | Ga0496121_0005483_13840_14955 | 351 |
| 288 | 3300048928 | Ga0496125_0018792 | Ga0496125_0018792_3874_4989 | 351 |
| 289 | 3300049459 | Ga0495678_009262 | Ga0495678_009262_2635_3774 | 351 |
| 290 | 3300053153 | Ga0500616_0003309 | Ga0500616_0003309_4880_5992 | 351 |
| 291 | iso_pu_bacteria | 2857564685 | 2857565324 | 351 |
| 292 | iso_pu_bacteria | 2919476304 | 2919481131 | 351 |
| 293 | 3300006946 | Ga0079104_1012100 | Ga0079104_10121003 | 352 |
| 294 | 3300009553 | Ga0105249_10000417 | Ga0105249_1000041722 | 352 |
| 295 | 3300015261 | Ga0182006_1000021 | Ga0182006_100002159 | 352 |
| 296 | 3300015265 | Ga0182005_1000020 | Ga0182005_1000020111 | 352 |
| 297 | 3300025246 | Ga0209646_1000087 | Ga0209646_1000087164 | 352 |
| 298 | 3300025961 | Ga0207712_10000308 | Ga0207712_1000030812 | 352 |
| 299 | 3300027111 | Ga0209281_1011866 | Ga0209281_10118662 | 352 |
| 300 | 3300046452 | Ga0495617_000006 | Ga0495617_000006_135803_137005 | 352 |
| 301 | 3300046463 | Ga0495653_0000011 | Ga0495653_0000011_13911_15113 | 352 |
| 302 | 3300046471 | Ga0495650_0000015 | Ga0495650_0000015_247132_248268 | 352 |
| 303 | 3300046471 | Ga0495650_0000339 | Ga0495650_0000339_43422_44624 | 352 |
| 304 | 3300046492 | Ga0495585_0001983 | Ga0495585_0001983_2320_3522 | 352 |
| 305 | 3300046507 | Ga0495606_0000304 | Ga0495606_0000304_9212_10420 | 352 |
| 306 | 3300046507 | Ga0495606_0001581 | Ga0495606_0001581_12650_13852 | 352 |
| 307 | 3300046512 | Ga0495610_0000004 | Ga0495610_0000004_92906_94108 | 352 |
| 308 | 3300046512 | Ga0495610_0000669 | Ga0495610_0000669_19_1227 | 352 |
| 309 | 3300046522 | Ga0495643_0000902 | Ga0495643_0000902_17053_18225 | 352 |
| 310 | 3300046524 | Ga0495648_0008685 | Ga0495648_0008685_2076_3278 | 352 |
| 311 | 3300046524 | Ga0495648_0022146 | Ga0495648_0022146_1735_2937 | 352 |
| 312 | 3300046542 | Ga0495597_0000119 | Ga0495597_0000119_55497_56669 | 352 |
| 313 | 3300046558 | Ga0495633_0000617 | Ga0495633_0000617_1993_3180 | 352 |
| 314 | 3300046558 | Ga0495633_0016536 | Ga0495633_0016536_1291_2493 | 352 |
| 315 | 3300046616 | Ga0495668_0000104 | Ga0495668_0000104_67544_68752 | 352 |
| 316 | 3300046616 | Ga0495668_0001909 | Ga0495668_0001909_8094_9296 | 352 |
| 317 | 3300046692 | Ga0495671_0000001 | Ga0495671_0000001_743950_745152 | 352 |
| 318 | 3300046810 | Ga0495660_0008367 | Ga0495660_0008367_1383_2585 | 352 |
| 319 | 3300047323 | Ga0495683_0004190 | Ga0495683_0004190_437_1639 | 352 |
| 320 | 3300047323 | Ga0495683_0036403 | Ga0495683_0036403_280_1413 | 352 |
| 321 | 3300047443 | Ga0495687_001010 | Ga0495687_001010_12608_13780 | 352 |
| 322 | 3300047443 | Ga0495687_002259 | Ga0495687_002259_179_1351 | 352 |
| 323 | 3300047469 | Ga0495673_0000006 | Ga0495673_0000006_384357_385550 | 352 |
| 324 | 3300047469 | Ga0495673_0000141 | Ga0495673_0000141_14273_15475 | 352 |
| 325 | 3300047472 | Ga0495686_0009599 | Ga0495686_0009599_161_1369 | 352 |
| 326 | 3300048924 | Ga0496121_0053674 | Ga0496121_0053674_1852_3054 | 352 |
| 327 | 3300048925 | Ga0496122_0090148 | Ga0496122_0090148_53_1255 | 352 |
| 328 | 3300048926 | Ga0496123_0002569 | Ga0496123_0002569_8127_9329 | 352 |
| 329 | 3300048929 | Ga0496126_0003811 | Ga0496126_0003811_7264_8457 | 352 |
| 330 | 3300049459 | Ga0495678_000016 | Ga0495678_000016_210944_212173 | 352 |
| 331 | 3300053145 | Ga0500586_001585 | Ga0500586_001585_2876_4078 | 352 |
| 332 | iso_pu_bacteria | 2643221645 | 2644254049 | 352 |
| 333 | iso_pu_bacteria | 2738541297 | 2738824918 | 352 |
| 334 | iso_pu_bacteria | 2738541357 | 2739148715 | 352 |
| 335 | iso_pu_bacteria | 2738543003 | 2739190634 | 352 |
| 336 | iso_pu_bacteria | 2738543026 | 2739317111 | 352 |
| 337 | iso_pu_bacteria | 2738543029 | 2739335352 | 352 |
| 338 | iso_pu_bacteria | 2821131069 | 2821133531 | 352 |
| 339 | iso_pu_bacteria | 2857553236 | 2857553659 | 352 |
| 340 | iso_pu_bacteria | 2904424332 | 2904426632 | 352 |
| 341 | 3300046452 | Ga0495617_002143 | Ga0495617_002143_5083_6273 | 353 |
| 342 | 3300046453 | Ga0495627_000005 | Ga0495627_000005_236269_237489 | 353 |
| 343 | 3300046457 | Ga0495590_0000003 | Ga0495590_0000003_195226_196401 | 353 |
| 344 | 3300046460 | Ga0495638_0000198 | Ga0495638_0000198_70225_71400 | 353 |
| 345 | 3300046475 | Ga0495639_0019942 | Ga0495639_0019942_34_1209 | 353 |
| 346 | 3300046501 | Ga0495607_0005421 | Ga0495607_0005421_5788_6963 | 353 |
| 347 | 3300046506 | Ga0495583_0000265 | Ga0495583_0000265_14767_15942 | 353 |
| 348 | 3300046507 | Ga0495606_0000068 | Ga0495606_0000068_31580_32740 | 353 |
| 349 | 3300046507 | Ga0495606_0001638 | Ga0495606_0001638_13890_15104 | 353 |
| 350 | 3300046507 | Ga0495606_0117352 | Ga0495606_0117352_317_1513 | 353 |
| 351 | 3300046522 | Ga0495643_0000106 | Ga0495643_0000106_68958_70142 | 353 |
| 352 | 3300046522 | Ga0495643_0032393 | Ga0495643_0032393_110_1342 | 353 |
| 353 | 3300046524 | Ga0495648_0000087 | Ga0495648_0000087_11719_12894 | 353 |
| 354 | 3300046528 | Ga0495642_0000767 | Ga0495642_0000767_8221_9396 | 353 |
| 355 | 3300046538 | Ga0495609_0002236 | Ga0495609_0002236_7073_8278 | 353 |
| 356 | 3300046538 | Ga0495609_0021580 | Ga0495609_0021580_1296_2480 | 353 |
| 357 | 3300046542 | Ga0495597_0000273 | Ga0495597_0000273_19408_20589 | 353 |
| 358 | 3300046557 | Ga0495622_0000498 | Ga0495622_0000498_12147_13322 | 353 |
| 359 | 3300046558 | Ga0495633_0001486 | Ga0495633_0001486_14968_16143 | 353 |
| 360 | 3300046616 | Ga0495668_0001257 | Ga0495668_0001257_5455_6630 | 353 |
| 361 | 3300046660 | Ga0495625_0000038 | Ga0495625_0000038_115749_116924 | 353 |
| 362 | 3300046660 | Ga0495625_0043220 | Ga0495625_0043220_2011_3207 | 353 |
| 363 | 3300046810 | Ga0495660_0011189 | Ga0495660_0011189_526_1701 | 353 |
| 364 | 3300046810 | Ga0495660_0066474 | Ga0495660_0066474_118_1350 | 353 |
| 365 | 3300047320 | Ga0495672_0000141 | Ga0495672_0000141_76_1260 | 353 |
| 366 | 3300047469 | Ga0495673_0000024 | Ga0495673_0000024_2587_3777 | 353 |
| 367 | 3300047470 | Ga0495681_0000900 | Ga0495681_0000900_13479_14711 | 353 |
| 368 | 3300047472 | Ga0495686_0000225 | Ga0495686_0000225_9010_10176 | 353 |
| 369 | 3300047472 | Ga0495686_0047544 | Ga0495686_0047544_1490_2677 | 353 |
| 370 | 3300048919 | Ga0496116_0081891 | Ga0496116_0081891_592_1812 | 353 |
| 371 | 3300049459 | Ga0495678_000101 | Ga0495678_000101_103336_104520 | 353 |
| 372 | 3300049823 | Ga0501044_0010579 | Ga0501044_0010579_6662_7780 | 353 |
| 373 | 3300053094 | Ga0500566_0143230 | Ga0500566_0143230_39_1154 | 353 |
| 374 | 3300053122 | Ga0500608_093429 | Ga0500608_093429_272_1387 | 353 |
| 375 | 3300053145 | Ga0500586_000584 | Ga0500586_000584_6130_7332 | 353 |
| 376 | iso_pu_bacteria | 2842711865 | 2842716861 | 353 |
| 377 | iso_pu_bacteria | 2857558681 | 2857561262 | 353 |
| 378 | 3300005339 | Ga0070660_100000544 | Ga0070660_1000005445 | 354 |
| 379 | 3300005367 | Ga0070667_100001390 | Ga0070667_10000139018 | 354 |
| 380 | 3300005617 | Ga0068859_100321934 | Ga0068859_1003219341 | 354 |
| 381 | 3300005841 | Ga0068863_100001578 | Ga0068863_10000157821 | 354 |
| 382 | 3300005843 | Ga0068860_100000013 | Ga0068860_10000001316 | 354 |
| 383 | 3300006931 | Ga0097620_100321933 | Ga0097620_1003219331 | 354 |
| 384 | 3300025919 | Ga0207657_10003918 | Ga0207657_100039183 | 354 |
| 385 | 3300025986 | Ga0207658_10000067 | Ga0207658_10000067101 | 354 |
| 386 | 3300028381 | Ga0268264_10000039 | Ga0268264_1000003920 | 354 |
| 387 | 3300044658 | Ga0466972_0002161 | Ga0466972_0002161_8503_9606 | 354 |
| 388 | 3300044683 | Ga0466965_0029309 | Ga0466965_0029309_16_1119 | 354 |
| 389 | 3300044735 | Ga0466968_0072018 | Ga0466968_0072018_13_1116 | 354 |
| 390 | 3300044765 | Ga0466970_0027698 | Ga0466970_0027698_339_1442 | 354 |
| 391 | 3300044901 | Ga0466960_0012052 | Ga0466960_0012052_1890_2993 | 354 |
| 392 | 3300045049 | Ga0466959_0224286 | Ga0466959_0224286_133_1236 | 354 |
| 393 | 3300046557 | Ga0495622_0008114 | Ga0495622_0008114_1733_2833 | 354 |
| 394 | 3300046558 | Ga0495633_0005153 | Ga0495633_0005153_2737_3849 | 354 |
| 395 | 3300046692 | Ga0495671_0006624 | Ga0495671_0006624_520_1620 | 354 |
| 396 | 3300049679 | Ga0501249_000185 | Ga0501249_000185_5947_7047 | 354 |
| 397 | 3300053118 | Ga0500594_0039531 | Ga0500594_0039531_95_1195 | 354 |
| 398 | 3300053157 | Ga0500624_000053 | Ga0500624_000053_65170_66282 | 354 |
| 399 | 3300001989 | JGI24739J22299_10001696 | JGI24739J22299_100016964 | 355 |
| 400 | 3300001989 | JGI24739J22299_10018418 | JGI24739J22299_100184182 | 355 |
| 401 | 3300001989 | JGI24739J22299_10021643 | JGI24739J22299_100216433 | 355 |
| 402 | 3300001990 | JGI24737J22298_10000864 | JGI24737J22298_100008646 | 355 |
| 403 | 3300001990 | JGI24737J22298_10002862 | JGI24737J22298_100028622 | 355 |
| 404 | 3300002067 | JGI24735J21928_10001679 | JGI24735J21928_100016795 | 355 |
| 405 | 3300002075 | JGI24738J21930_10003391 | JGI24738J21930_100033912 | 355 |
| 406 | 3300003214 | JGI25165J46597_1000188 | JGI25165J46597_100018842 | 355 |
| 407 | 3300005327 | Ga0070658_10041598 | Ga0070658_100415981 | 355 |
| 408 | 3300005327 | Ga0070658_10070822 | Ga0070658_100708223 | 355 |
| 409 | 3300005334 | Ga0068869_100000848 | Ga0068869_1000008488 | 355 |
| 410 | 3300005335 | Ga0070666_10012477 | Ga0070666_100124773 | 355 |
| 411 | 3300005338 | Ga0068868_100000154 | Ga0068868_10000015425 | 355 |
| 412 | 3300005339 | Ga0070660_100102891 | Ga0070660_1001028912 | 355 |
| 413 | 3300005354 | Ga0070675_100008581 | Ga0070675_1000085813 | 355 |
| 414 | 3300005355 | Ga0070671_100011487 | Ga0070671_1000114873 | 355 |
| 415 | 3300005356 | Ga0070674_100001435 | Ga0070674_10000143510 | 355 |
| 416 | 3300005364 | Ga0070673_100000023 | Ga0070673_10000002387 | 355 |
| 417 | 3300005366 | Ga0070659_100059344 | Ga0070659_1000593442 | 355 |
| 418 | 3300005366 | Ga0070659_100149929 | Ga0070659_1001499291 | 355 |
| 419 | 3300005457 | Ga0070662_100015094 | Ga0070662_1000150945 | 355 |
| 420 | 3300005459 | Ga0068867_100000007 | Ga0068867_10000000719 | 355 |
| 421 | 3300005543 | Ga0070672_100288368 | Ga0070672_1002883682 | 355 |
| 422 | 3300005563 | Ga0068855_100000029 | Ga0068855_10000002942 | 355 |
| 423 | 3300005577 | Ga0068857_100015770 | Ga0068857_1000157704 | 355 |
| 424 | 3300005614 | Ga0068856_100004098 | Ga0068856_1000040984 | 355 |
| 425 | 3300005614 | Ga0068856_100247632 | Ga0068856_1002476322 | 355 |
| 426 | 3300005616 | Ga0068852_100004278 | Ga0068852_1000042782 | 355 |
| 427 | 3300005718 | Ga0068866_10012667 | Ga0068866_100126672 | 355 |
| 428 | 3300006881 | Ga0068865_100000010 | Ga0068865_100000010161 | 355 |
| 429 | 3300009093 | Ga0105240_10110430 | Ga0105240_101104302 | 355 |
| 430 | 3300009098 | Ga0105245_10002089 | Ga0105245_100020895 | 355 |
| 431 | 3300009148 | Ga0105243_10000950 | Ga0105243_1000095019 | 355 |
| 432 | 3300009148 | Ga0105243_10042667 | Ga0105243_100426672 | 355 |
| 433 | 3300009176 | Ga0105242_10000210 | Ga0105242_1000021019 | 355 |
| 434 | 3300009545 | Ga0105237_10155826 | Ga0105237_101558262 | 355 |
| 435 | 3300010375 | Ga0105239_10000980 | Ga0105239_1000098027 | 355 |
| 436 | 3300011119 | Ga0105246_10000472 | Ga0105246_1000047215 | 355 |
| 437 | 3300013104 | Ga0157370_10000203 | Ga0157370_1000020358 | 355 |
| 438 | 3300013296 | Ga0157374_10000830 | Ga0157374_1000083019 | 355 |
| 439 | 3300013297 | Ga0157378_10001477 | Ga0157378_1000147712 | 355 |
| 440 | 3300013307 | Ga0157372_10012786 | Ga0157372_1001278612 | 355 |
| 441 | 3300013307 | Ga0157372_10021148 | Ga0157372_100211483 | 355 |
| 442 | 3300013308 | Ga0157375_10002120 | Ga0157375_100021208 | 355 |
| 443 | 3300014969 | Ga0157376_10000047 | Ga0157376_1000004719 | 355 |
| 444 | 3300017792 | Ga0163161_10050708 | Ga0163161_100507082 | 355 |
| 445 | 3300025250 | Ga0209026_1002441 | Ga0209026_10024413 | 355 |
| 446 | 3300025254 | Ga0209148_1001013 | Ga0209148_10010137 | 355 |
| 447 | 3300025261 | Ga0209233_1000120 | Ga0209233_1000120183 | 355 |
| 448 | 3300025272 | Ga0209455_1000692 | Ga0209455_100069211 | 355 |
| 449 | 3300025899 | Ga0207642_10007810 | Ga0207642_100078102 | 355 |
| 450 | 3300025904 | Ga0207647_10005555 | Ga0207647_100055554 | 355 |
| 451 | 3300025904 | Ga0207647_10040018 | Ga0207647_100400182 | 355 |
| 452 | 3300025904 | Ga0207647_10150770 | Ga0207647_101507701 | 355 |
| 453 | 3300025909 | Ga0207705_10000316 | Ga0207705_100003167 | 355 |
| 454 | 3300025909 | Ga0207705_10000963 | Ga0207705_1000096313 | 355 |
| 455 | 3300025909 | Ga0207705_10009514 | Ga0207705_100095142 | 355 |
| 456 | 3300025913 | Ga0207695_10132278 | Ga0207695_101322782 | 355 |
| 457 | 3300025914 | Ga0207671_10001304 | Ga0207671_100013048 | 355 |
| 458 | 3300025914 | Ga0207671_10103565 | Ga0207671_101035652 | 355 |
| 459 | 3300025926 | Ga0207659_10024690 | Ga0207659_100246903 | 355 |
| 460 | 3300025931 | Ga0207644_10159172 | Ga0207644_101591722 | 355 |
| 461 | 3300025933 | Ga0207706_10004690 | Ga0207706_100046902 | 355 |
| 462 | 3300025933 | Ga0207706_10031591 | Ga0207706_100315912 | 355 |
| 463 | 3300025933 | Ga0207706_10111154 | Ga0207706_101111541 | 355 |
| 464 | 3300025934 | Ga0207686_10033791 | Ga0207686_100337913 | 355 |
| 465 | 3300025935 | Ga0207709_10000050 | Ga0207709_10000050232 | 355 |
| 466 | 3300025935 | Ga0207709_10046973 | Ga0207709_100469732 | 355 |
| 467 | 3300025937 | Ga0207669_10041392 | Ga0207669_100413922 | 355 |
| 468 | 3300025938 | Ga0207704_10000020 | Ga0207704_10000020142 | 355 |
| 469 | 3300025942 | Ga0207689_10001541 | Ga0207689_100015415 | 355 |
| 470 | 3300025949 | Ga0207667_10000035 | Ga0207667_10000035181 | 355 |
| 471 | 3300025960 | Ga0207651_10000005 | Ga0207651_1000000519 | 355 |
| 472 | 3300025981 | Ga0207640_10015331 | Ga0207640_100153314 | 355 |
| 473 | 3300026023 | Ga0207677_10000373 | Ga0207677_100003739 | 355 |
| 474 | 3300026078 | Ga0207702_10012620 | Ga0207702_100126205 | 355 |
| 475 | 3300026089 | Ga0207648_10000017 | Ga0207648_10000017142 | 355 |
| 476 | 3300026121 | Ga0207683_10029414 | Ga0207683_100294144 | 355 |
| 477 | 3300026142 | Ga0207698_10000712 | Ga0207698_100007127 | 355 |
| 478 | 3300026142 | Ga0207698_10091126 | Ga0207698_100911262 | 355 |
| 479 | 3300037312 | Ga0395899_0002116 | Ga0395899_0002116_10988_12094 | 355 |
| 480 | 3300041462 | Ga0451806_567525 | Ga0451806_567525_2364_3470 | 355 |
| 481 | 3300041486 | Ga0451807_2303118 | Ga0451807_2303118_347_1453 | 355 |
| 482 | 3300042005 | Ga0439448_0000332 | Ga0439448_0000332_8872_9942 | 355 |
| 483 | 3300042005 | Ga0439448_0003494 | Ga0439448_0003494_2970_4076 | 355 |
| 484 | 3300042012 | Ga0439455_0000252 | Ga0439455_0000252_428_1534 | 355 |
| 485 | 3300042012 | Ga0439455_0000304 | Ga0439455_0000304_3290_4360 | 355 |
| 486 | 3300042157 | Ga0439458_0000255 | Ga0439458_0000255_8322_9392 | 355 |
| 487 | 3300042157 | Ga0439458_0000305 | Ga0439458_0000305_6301_7407 | 355 |
| 488 | 3300046507 | Ga0495606_0162843 | Ga0495606_0162843_109_1215 | 355 |
| 489 | 3300047472 | Ga0495686_0000844 | Ga0495686_0000844_26638_27726 | 355 |
| 490 | 3300048920 | Ga0496117_0014903 | Ga0496117_0014903_210_1337 | 355 |
| 491 | 3300048921 | Ga0496118_0031397 | Ga0496118_0031397_2091_3239 | 355 |
| 492 | 3300048922 | Ga0496119_0061244 | Ga0496119_0061244_528_1634 | 355 |
| 493 | 3300048923 | Ga0496120_0071956 | Ga0496120_0071956_777_1883 | 355 |
| 494 | 3300048924 | Ga0496121_0003499 | Ga0496121_0003499_6567_7697 | 355 |
| 495 | 3300048924 | Ga0496121_0005228 | Ga0496121_0005228_58_1188 | 355 |
| 496 | 3300048924 | Ga0496121_0056640 | Ga0496121_0056640_1864_2970 | 355 |
| 497 | 3300048928 | Ga0496125_0012910 | Ga0496125_0012910_3855_4961 | 355 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pz0-assembly1.cif.gz_A | crystal structure of glycerophosphodiester phosphodiesterase (gdpd) from t. tengcongensis | 0.8569 | 20 | 350 |
| 5t91-assembly1.cif.gz_A | crystal structure of b. subtilis 168 glpq in complex with bicine | 0.8511 | 19 | 353 |
| 2pz0-assembly1.cif.gz_A | crystal structure of glycerophosphodiester phosphodiesterase (gdpd) from t. tengcongensis | 0.8502 | 20 | 350 |
| 3qvq-assembly1.cif.gz_D | the structure of an oleispira antarctica phosphodiesterase olei02445 in complex with the product sn-glycerol-3-phosphate | 0.8466 | 20 | 351 |
| 5t9c-assembly1.cif.gz_E | crystal structure of b. subtilis 168 glpq in complex with glycerol-3-phosphate (1 hour soak) | 0.8374 | 15 | 353 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9FJ62_365_668_3.20.20.190 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase | 0.8898 | 22 | 349 | 3.20.20.190 |
| af_Q9SD81_43_361_3.20.20.190 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase | 0.887 | 24 | 345 | 3.20.20.190 |
| af_Q9FJ62_365_668_3.20.20.190 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase | 0.8814 | 22 | 349 | 3.20.20.190 |
| af_Q9FGT9_39_339_3.20.20.190 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase | 0.8771 | 19 | 349 | 3.20.20.190 |
| af_I1KYF2_42_344_3.20.20.190 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase | 0.8741 | 20 | 348 | 3.20.20.190 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N7RM14-F1-model_v4 | glycerophosphodiester phosphodiesterase (EC 3.1.4.46) | 0.9943 | 53 | 350 |
GO:0006071
GO:0006629 GO:0008889 GO:0042597 |
| AF-A0A4Q4CT74-F1-model_v4 | glycerophosphodiester phosphodiesterase (EC 3.1.4.46) | 0.991 | 21 | 167 |
GO:0006071
GO:0006629 GO:0008889 GO:0042597 |
| AF-A0A534A915-F1-model_v4 | glycerophosphodiester phosphodiesterase (EC 3.1.4.46) | 0.9884 | 16 | 350 |
GO:0006071
GO:0006629 GO:0008889 GO:0042597 |
| AF-A0A7Z0JEC4-F1-model_v4 | deleted | 0.9884 | 24 | 352 |
|
| AF-U2GZQ8-F1-model_v4 | glycerophosphodiester phosphodiesterase (EC 3.1.4.46) | 0.9883 | 24 | 352 |
GO:0006071
GO:0006629 GO:0008889 GO:0042597 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar