F455006

General Info

Members Datasets Scaffolds Average Seq Length
497 221 994 193

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100472352|Ga0068864_1004723522
Length 220
Sequence MWCPRCGSSQRDFSRNLKQDRFHALWRTRDVLEELKFCKECGANLYAVRQLVDKNEKSTKSLTGTILGWLRWLQSSEEAVRRQQALEIASGLTPEVKRYNEIKGGIITGSVGVALMIFLYVFMQGIIIGGKVPNDTAEILSRIWVAGVIPVFVGLALIFNGVFISKKALASSKRAPNSTSELTGEETPALRSANTAEFLPLNFSVTENTTRHLNQKEESR

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
168 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
169 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
178 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
179 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
190 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
191 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
192 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
193 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
194 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
195 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
196 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
197 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
198 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
199 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
200 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
201 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
202 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
203 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
204 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
205 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
206 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
207 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
208 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
209 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
210 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
211 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
212 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
213 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
214 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
215 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
216 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.21
Rhizosphere 97.79
Stem 0
Stem Tuber 0
Unclassified 11.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100472352 3300005618 Bacteria 1202
2 MRS1b_contig_2432709 2162886011 Unclassified 1147
3 MBSR1b_contig_12322913 2162886012 Unclassified 887
4 MBSR1b_contig_4403363 2162886012 Unclassified 1377
5 JGI24751J29686_10000100 3300002459 Bacteria 47651
6 JGI25406J46586_10003206 3300003203 Bacteria 7698
7 JGI25406J46586_10004745 3300003203 Bacteria 6318
8 JGI25406J46586_10007143 3300003203 Bacteria 5114
9 Ga0065714_10026438 3300005288 Bacteria 1183
10 Ga0065714_10064425 3300005288 Bacteria 189652
11 Ga0065704_10029120 3300005289 Bacteria 1170
12 Ga0065712_10012810 3300005290 Bacteria 1731
13 Ga0065712_10067727 3300005290 Bacteria 189643
14 Ga0065712_10071450 3300005290 Bacteria 5257
15 Ga0065712_10082661 3300005290 Bacteria 2881
16 Ga0065712_10143494 3300005290 Bacteria 1429
17 Ga0065715_10000520 3300005293 Bacteria 22337
18 Ga0065715_10001774 3300005293 Bacteria 6727
19 Ga0065715_10026682 3300005293 Unclassified 1474
20 Ga0065715_10055268 3300005293 Unclassified 906
21 Ga0065715_10129043 3300005293 Bacteria 2054
22 Ga0065715_10140112 3300005293 Bacteria 1867
23 Ga0065715_10396881 3300005293 Bacteria 855
24 Ga0065715_10594999 3300005293 Unclassified 711
25 Ga0065707_10177711 3300005295 Bacteria 1439
26 Ga0070676_10029384 3300005328 Bacteria 3126
27 Ga0070690_100055735 3300005330 Bacteria 2532
28 Ga0070670_100000190 3300005331 Bacteria 56382
29 Ga0070670_100029444 3300005331 Bacteria 4727
30 Ga0070670_100042431 3300005331 Bacteria 3911
31 Ga0070670_100053188 3300005331 Bacteria 3477
32 Ga0070670_100122044 3300005331 Bacteria 2247
33 Ga0070670_100360640 3300005331 Bacteria 1278
34 Ga0068869_100021893 3300005334 Bacteria 4399
35 Ga0068869_100061532 3300005334 Bacteria 2754
36 Ga0068869_100299237 3300005334 Bacteria 1298
37 Ga0068869_100890390 3300005334 Unclassified 770
38 Ga0070666_10096288 3300005335 Bacteria 2037
39 Ga0070682_100015744 3300005337 Bacteria 4387
40 Ga0070689_100004642 3300005340 Bacteria 9306
41 Ga0070689_100179175 3300005340 Bacteria 1720
42 Ga0070689_100749948 3300005340 Bacteria 856
43 Ga0070687_100078473 3300005343 Bacteria 1795
44 Ga0070687_100083082 3300005343 Bacteria 1753
45 Ga0070687_100318093 3300005343 Unclassified 993
46 Ga0070661_100220765 3300005344 Bacteria 1454
47 Ga0070661_100408842 3300005344 Bacteria 1074
48 Ga0070692_10010044 3300005345 Bacteria 4294
49 Ga0070692_10052556 3300005345 Bacteria 2122
50 Ga0070692_10187699 3300005345 Bacteria 1202
51 Ga0070692_10272349 3300005345 Bacteria 1023
52 Ga0070669_100027550 3300005353 Bacteria 4090
53 Ga0070669_100102957 3300005353 Bacteria 2156
54 Ga0070675_100044802 3300005354 Bacteria 3618
55 Ga0070675_100088122 3300005354 Bacteria 2596
56 Ga0070671_100001794 3300005355 Bacteria 16314
57 Ga0070671_100014863 3300005355 Bacteria 6289
58 Ga0070674_100165315 3300005356 Bacteria 1682
59 Ga0070673_100033116 3300005364 Bacteria 3897
60 Ga0070673_100310631 3300005364 Bacteria 1390
61 Ga0070673_100787116 3300005364 Bacteria 877
62 Ga0070688_100163595 3300005365 Bacteria 1530
63 Ga0070688_100223787 3300005365 Bacteria 1327
64 Ga0070659_100004509 3300005366 Bacteria 9949
65 Ga0070667_100009592 3300005367 Bacteria 8028
66 Ga0070667_100175820 3300005367 Bacteria 1892
67 Ga0070703_10070810 3300005406 Bacteria 1164
68 Ga0070701_10054184 3300005438 Bacteria 2090
69 Ga0070701_10063168 3300005438 Bacteria 1958
70 Ga0070701_10277180 3300005438 Bacteria 1023
71 Ga0070705_100006528 3300005440 Bacteria 5724
72 Ga0070705_100598721 3300005440 Unclassified 852
73 Ga0070700_100000047 3300005441 Bacteria 90040
74 Ga0070700_100081746 3300005441 Bacteria 2088
75 Ga0070700_100155896 3300005441 Bacteria 1567
76 Ga0070700_100156000 3300005441 Bacteria 1566
77 Ga0070700_100190241 3300005441 Bacteria 1434
78 Ga0070700_100464737 3300005441 Bacteria 966
79 Ga0070694_100034628 3300005444 Bacteria 3331
80 Ga0070694_100145302 3300005444 Bacteria 1727
81 Ga0070694_100200322 3300005444 Bacteria 1488
82 Ga0070694_100523389 3300005444 Unclassified 946
83 Ga0070694_100580371 3300005444 Unclassified 901
84 Ga0070694_100752820 3300005444 Bacteria 796
85 Ga0070678_100088055 3300005456 Bacteria 2373
86 Ga0070678_100886924 3300005456 Bacteria 815
87 Ga0070662_100029198 3300005457 Unclassified 3847
88 Ga0070681_10016154 3300005458 Bacteria 7442
89 Ga0068867_100028144 3300005459 Bacteria 4044
90 Ga0068867_100109637 3300005459 Bacteria 2119
91 Ga0068867_100247986 3300005459 Bacteria 1447
92 Ga0070685_10078438 3300005466 Bacteria 1974
93 Ga0070698_100029989 3300005471 Bacteria 5644
94 Ga0070699_100000978 3300005518 Bacteria 26634
95 Ga0070699_100007962 3300005518 Bacteria 9201
96 Ga0070699_100135003 3300005518 Bacteria 2177
97 Ga0070699_100302116 3300005518 Unclassified 1436
98 Ga0070699_101255853 3300005518 Unclassified 679
99 Ga0070679_100270859 3300005530 Bacteria 1652
100 Ga0070684_100122713 3300005535 Bacteria 2338
101 Ga0070697_100318643 3300005536 Bacteria 1339
102 Ga0068853_100067303 3300005539 Bacteria 3112
103 Ga0068853_100337031 3300005539 Bacteria 1401
104 Ga0070686_100043932 3300005544 Bacteria 2806
105 Ga0070695_100139487 3300005545 Bacteria 1680
106 Ga0070695_100435883 3300005545 Unclassified 1001
107 Ga0070695_100467483 3300005545 Bacteria 969
108 Ga0070696_100033275 3300005546 Bacteria 3541
109 Ga0070696_100157208 3300005546 Bacteria 1673
110 Ga0070696_100344001 3300005546 Unclassified 1153
111 Ga0070693_100001543 3300005547 Bacteria 10409
112 Ga0070693_100063630 3300005547 Bacteria 2151
113 Ga0070693_100197332 3300005547 Bacteria 1305
114 Ga0070665_100650331 3300005548 Bacteria 1067
115 Ga0070704_100099144 3300005549 Bacteria 2191
116 Ga0070704_100130854 3300005549 Bacteria 1945
117 Ga0068855_100021840 3300005563 Bacteria 7675
118 Ga0070664_100836294 3300005564 Bacteria 862
119 Ga0068857_100026877 3300005577 Bacteria 5075
120 Ga0068857_100275569 3300005577 Bacteria 1546
121 Ga0068857_100964534 3300005577 Bacteria 820
122 Ga0068854_100099412 3300005578 Bacteria 2179
123 Ga0068854_100120212 3300005578 Bacteria 1993
124 Ga0068854_100806451 3300005578 Bacteria 819
125 Ga0068854_100967057 3300005578 Bacteria 752
126 Ga0068854_100984383 3300005578 Bacteria 746
127 Ga0070702_100006592 3300005615 Bacteria 5508
128 Ga0070702_100027049 3300005615 Bacteria 3091
129 Ga0070702_100410359 3300005615 Bacteria 971
130 Ga0070702_100892952 3300005615 Bacteria 695
131 Ga0068852_100017089 3300005616 Bacteria 5683
132 Ga0068852_100084361 3300005616 Bacteria 2827
133 Ga0068852_100600423 3300005616 Bacteria 1105
134 Ga0068852_100961456 3300005616 Unclassified 872
135 Ga0068859_100003483 3300005617 Bacteria 16021
136 Ga0068859_100012935 3300005617 Bacteria 8383
137 Ga0068859_100019526 3300005617 Bacteria 6808
138 Ga0068859_100021522 3300005617 Bacteria 6472
139 Ga0068859_100069471 3300005617 Bacteria 3557
140 Ga0068859_100127399 3300005617 Bacteria 2616
141 Ga0068859_100142881 3300005617 Unclassified 2467
142 Ga0068859_100180629 3300005617 Bacteria 2193
143 Ga0068859_100212619 3300005617 Bacteria 2020
144 Ga0068859_100303652 3300005617 Bacteria 1689
145 Ga0068859_100857868 3300005617 Bacteria 994
146 Ga0068859_100955661 3300005617 Bacteria 940
147 Ga0068859_101146935 3300005617 Bacteria 855
148 Ga0068859_101148627 3300005617 Bacteria 855
149 Ga0068859_101304615 3300005617 Unclassified 800
150 Ga0068859_101607757 3300005617 Unclassified 718
151 Ga0068864_100008955 3300005618 Bacteria 8251
152 Ga0068864_100123405 3300005618 Bacteria 2318
153 Ga0068864_100457464 3300005618 Bacteria 1221
154 Ga0068864_100681281 3300005618 Unclassified 1003
155 Ga0068864_100843411 3300005618 Unclassified 903
156 Ga0068864_101090432 3300005618 Bacteria 794
157 Ga0068864_101196565 3300005618 Bacteria 758
158 Ga0068866_10037865 3300005718 Bacteria 2371
159 Ga0068866_10515991 3300005718 Unclassified 793
160 Ga0068861_100089564 3300005719 Bacteria 2425
161 Ga0068861_100139551 3300005719 Bacteria 1977
162 Ga0068861_100497020 3300005719 Bacteria 1102
163 Ga0068851_10015373 3300005834 Bacteria 3646
164 Ga0068851_10508184 3300005834 Unclassified 723
165 Ga0068870_10019198 3300005840 Bacteria 3312
166 Ga0068870_10059964 3300005840 Bacteria 2041
167 Ga0068870_10252825 3300005840 Unclassified 1093
168 Ga0068870_10387402 3300005840 Unclassified 906
169 Ga0068863_100032179 3300005841 Bacteria 4999
170 Ga0068863_100070502 3300005841 Bacteria 3305
171 Ga0068863_100326257 3300005841 Bacteria 1492
172 Ga0068863_100348100 3300005841 Bacteria 1442
173 Ga0068863_100743194 3300005841 Bacteria 976
174 Ga0068858_100017765 3300005842 Bacteria 6661
175 Ga0068858_100057363 3300005842 Bacteria 3599
176 Ga0068858_100127273 3300005842 Bacteria 2386
177 Ga0068858_100139254 3300005842 Bacteria 2277
178 Ga0068858_100170438 3300005842 Bacteria 2052
179 Ga0068858_100415341 3300005842 Bacteria 1293
180 Ga0068858_100483890 3300005842 Bacteria 1195
181 Ga0068858_100542504 3300005842 Bacteria 1125
182 Ga0068860_100011886 3300005843 Bacteria 8582
183 Ga0068860_100138014 3300005843 Bacteria 2342
184 Ga0068860_100269802 3300005843 Bacteria 1660
185 Ga0068860_101298476 3300005843 Bacteria 748
186 Ga0068862_100149552 3300005844 Bacteria 2078
187 Ga0068862_101066449 3300005844 Bacteria 802
188 Ga0081539_10001165 3300005985 Bacteria 47581
189 Ga0081539_10003903 3300005985 Bacteria 17350
190 Ga0081539_10005776 3300005985 Bacteria 12336
191 Ga0081539_10059755 3300005985 Bacteria 2096
192 Ga0070715_10000349 3300006163 Bacteria 11566
193 Ga0097621_100006462 3300006237 Bacteria 8323
194 Ga0097621_100026034 3300006237 Bacteria 4584
195 Ga0097621_100553154 3300006237 Unclassified 1047
196 Ga0068871_100009119 3300006358 Bacteria 7169
197 Ga0068871_100015456 3300006358 Bacteria 5713
198 Ga0068871_100341981 3300006358 Bacteria 1321
199 Ga0075431_100994854 3300006847 Unclassified 806
200 Ga0075433_10015977 3300006852 Bacteria 6173
201 Ga0075433_10135002 3300006852 Bacteria 2193
202 Ga0075433_10139025 3300006852 Bacteria 2159
203 Ga0075434_100147304 3300006871 Bacteria 2375
204 Ga0075429_100117155 3300006880 Unclassified 2328
205 Ga0068865_100005045 3300006881 Bacteria 7989
206 Ga0075436_100172118 3300006914 Unclassified 1529
207 Ga0097620_100003483 3300006931 Bacteria 16021
208 Ga0097620_100012935 3300006931 Bacteria 8383
209 Ga0097620_100019526 3300006931 Bacteria 6808
210 Ga0097620_100021521 3300006931 Bacteria 6472
211 Ga0097620_100069468 3300006931 Bacteria 3557
212 Ga0097620_100127397 3300006931 Bacteria 2616
213 Ga0097620_100142875 3300006931 Unclassified 2467
214 Ga0097620_100180630 3300006931 Bacteria 2193
215 Ga0097620_100212631 3300006931 Bacteria 2020
216 Ga0097620_100303665 3300006931 Bacteria 1689
217 Ga0097620_100857735 3300006931 Bacteria 994
218 Ga0097620_100955666 3300006931 Bacteria 940
219 Ga0097620_101146906 3300006931 Bacteria 855
220 Ga0097620_101148730 3300006931 Bacteria 855
221 Ga0097620_101304380 3300006931 Unclassified 800
222 Ga0097620_101607704 3300006931 Unclassified 718
223 Ga0075435_100039743 3300007076 Bacteria 3755
224 Ga0105240_10019154 3300009093 Bacteria 9151
225 Ga0111539_10337368 3300009094 Bacteria 1755
226 Ga0105245_10039248 3300009098 Bacteria 4214
227 Ga0105247_10005623 3300009101 Bacteria 7866
228 Ga0105247_10169041 3300009101 Bacteria 1452
229 Ga0105247_10171549 3300009101 Bacteria 1443
230 Ga0105247_10508299 3300009101 Bacteria 879
231 Ga0105247_10585765 3300009101 Bacteria 825
232 Ga0114129_10037265 3300009147 Bacteria 6866
233 Ga0114129_10096943 3300009147 Bacteria 4082
234 Ga0114129_10803115 3300009147 Bacteria 1200
235 Ga0114129_11285003 3300009147 Bacteria 908
236 Ga0105243_10045663 3300009148 Bacteria 3444
237 Ga0105243_10517761 3300009148 Bacteria 1134
238 Ga0105243_10733691 3300009148 Unclassified 967
239 Ga0105243_11156871 3300009148 Bacteria 785
240 Ga0105241_10012730 3300009174 Bacteria 6173
241 Ga0105241_10485761 3300009174 Bacteria 1099
242 Ga0105241_10810615 3300009174 Unclassified 863
243 Ga0105241_10830293 3300009174 Bacteria 853
244 Ga0105241_11071783 3300009174 Bacteria 757
245 Ga0105242_10039284 3300009176 Bacteria 3808
246 Ga0105242_10061539 3300009176 Bacteria 3087
247 Ga0105242_10062081 3300009176 Bacteria 3075
248 Ga0105248_10012096 3300009177 Bacteria 9520
249 Ga0105248_10024652 3300009177 Bacteria 6689
250 Ga0105248_10058467 3300009177 Bacteria 4330
251 Ga0105248_10114069 3300009177 Bacteria 3048
252 Ga0105248_10164133 3300009177 Bacteria 2504
253 Ga0105248_10289432 3300009177 Bacteria 1845
254 Ga0105248_10463608 3300009177 Bacteria 1428
255 Ga0105237_10000843 3300009545 Bacteria 41798
256 Ga0105237_10788851 3300009545 Bacteria 957
257 Ga0105238_10003205 3300009551 Bacteria 16335
258 Ga0105238_10808492 3300009551 Bacteria 953
259 Ga0105249_10112658 3300009553 Bacteria 2573
260 Ga0105249_10357329 3300009553 Bacteria 1481
261 Ga0105249_11706844 3300009553 Bacteria 702
262 Ga0105239_10284891 3300010375 Bacteria 1860
263 Ga0105246_10239073 3300011119 Bacteria 1435
264 Ga0105246_10671690 3300011119 Bacteria 904
265 Ga0157373_10080148 3300013100 Bacteria 2302
266 Ga0157371_10334650 3300013102 Bacteria 1100
267 Ga0157371_10385781 3300013102 Bacteria 1023
268 Ga0157378_10010534 3300013297 Bacteria 8080
269 Ga0157378_10010652 3300013297 Bacteria 8035
270 Ga0163162_10011422 3300013306 Bacteria 8660
271 Ga0163162_10296471 3300013306 Bacteria 1749
272 Ga0163162_10329033 3300013306 Bacteria 1660
273 Ga0163162_11073485 3300013306 Bacteria 912
274 Ga0157372_10006102 3300013307 Bacteria 12803
275 Ga0157372_10861367 3300013307 Unclassified 1052
276 Ga0157372_10968476 3300013307 Bacteria 986
277 Ga0157372_11358614 3300013307 Bacteria 819
278 Ga0157375_10040857 3300013308 Unclassified 4474
279 Ga0157375_10447525 3300013308 Bacteria 1457
280 Ga0157375_10629843 3300013308 Bacteria 1230
281 Ga0157375_10834869 3300013308 Bacteria 1069
282 Ga0157375_10848865 3300013308 Bacteria 1060
283 Ga0163163_10000209 3300014325 Bacteria 60592
284 Ga0163163_10007701 3300014325 Bacteria 9516
285 Ga0163163_10060915 3300014325 Bacteria 3738
286 Ga0163163_10304927 3300014325 Bacteria 1645
287 Ga0163163_10317293 3300014325 Bacteria 1612
288 Ga0163163_10485979 3300014325 Bacteria 1296
289 Ga0163163_10759996 3300014325 Bacteria 1033
290 Ga0163163_11730981 3300014325 Unclassified 686
291 Ga0157380_10040864 3300014326 Bacteria 3616
292 Ga0157380_10972237 3300014326 Bacteria 880
293 Ga0157380_11068479 3300014326 Bacteria 844
294 Ga0157377_10023725 3300014745 Bacteria 3254
295 Ga0157379_10330278 3300014968 Bacteria 1393
296 Ga0157379_11288753 3300014968 Bacteria 705
297 Ga0157379_11433076 3300014968 Unclassified 670
298 Ga0157376_10064736 3300014969 Bacteria 3084
299 Ga0157376_10237574 3300014969 Unclassified 1696
300 Ga0163161_10021051 3300017792 Bacteria 4583
301 Ga0213876_10000242 3300021384 Bacteria 52167
302 Ga0213876_10105208 3300021384 Bacteria 1497
303 Ga0207697_10040807 3300025315 Unclassified 1905
304 Ga0207656_10015828 3300025321 Bacteria 2926
305 Ga0207653_10001107 3300025885 Bacteria 8832
306 Ga0207642_10009616 3300025899 Bacteria 3372
307 Ga0207710_10063235 3300025900 Bacteria 1683
308 Ga0207710_10103708 3300025900 Bacteria 1344
309 Ga0207710_10295175 3300025900 Bacteria 818
310 Ga0207688_10198419 3300025901 Bacteria 1202
311 Ga0207680_10047970 3300025903 Bacteria 2534
312 Ga0207647_10050369 3300025904 Bacteria 2579
313 Ga0207685_10000074 3300025905 Bacteria 23654
314 Ga0207645_10067788 3300025907 Bacteria 2281
315 Ga0207645_10177414 3300025907 Bacteria 1397
316 Ga0207643_10003881 3300025908 Bacteria 8042
317 Ga0207643_10079816 3300025908 Bacteria 1895
318 Ga0207643_10460249 3300025908 Unclassified 810
319 Ga0207654_10503047 3300025911 Bacteria 856
320 Ga0207654_10647514 3300025911 Bacteria 757
321 Ga0207707_10092311 3300025912 Bacteria 2646
322 Ga0207695_10053429 3300025913 Bacteria 4225
323 Ga0207671_10001210 3300025914 Bacteria 30665
324 Ga0207660_10167507 3300025917 Bacteria 1699
325 Ga0207662_10015344 3300025918 Bacteria 4311
326 Ga0207662_10043152 3300025918 Bacteria 2660
327 Ga0207662_10113824 3300025918 Bacteria 1689
328 Ga0207681_10027174 3300025923 Bacteria 3698
329 Ga0207681_10051371 3300025923 Bacteria 2793
330 Ga0207681_10337334 3300025923 Bacteria 1203
331 Ga0207650_10000007 3300025925 Bacteria 530810
332 Ga0207650_10043978 3300025925 Bacteria 3281
333 Ga0207650_10127743 3300025925 Bacteria 1986
334 Ga0207650_10200721 3300025925 Bacteria 1597
335 Ga0207650_10958167 3300025925 Bacteria 727
336 Ga0207659_10075908 3300025926 Bacteria 2468
337 Ga0207659_10160158 3300025926 Bacteria 1766
338 Ga0207659_10376912 3300025926 Unclassified 1182
339 Ga0207644_10166205 3300025931 Bacteria 1719
340 Ga0207644_10369234 3300025931 Unclassified 1168
341 Ga0207690_10195781 3300025932 Bacteria 1531
342 Ga0207706_10089873 3300025933 Bacteria 2700
343 Ga0207706_10243074 3300025933 Bacteria 1573
344 Ga0207686_10032762 3300025934 Bacteria 3096
345 Ga0207686_10073714 3300025934 Bacteria 2203
346 Ga0207709_10212840 3300025935 Bacteria 1389
347 Ga0207670_10000123 3300025936 Bacteria 51150
348 Ga0207669_10239070 3300025937 Bacteria 1345
349 Ga0207704_10262805 3300025938 Bacteria 1302
350 Ga0207691_10010959 3300025940 Bacteria 8699
351 Ga0207711_10003299 3300025941 Bacteria 14026
352 Ga0207711_10188936 3300025941 Bacteria 1876
353 Ga0207711_10246526 3300025941 Bacteria 1639
354 Ga0207711_10380534 3300025941 Bacteria 1310
355 Ga0207711_10893364 3300025941 Bacteria 826
356 Ga0207689_10005481 3300025942 Bacteria 11350
357 Ga0207689_10027345 3300025942 Bacteria 4775
358 Ga0207689_10287551 3300025942 Bacteria 1362
359 Ga0207689_10974432 3300025942 Bacteria 715
360 Ga0207679_10128542 3300025945 Bacteria 2029
361 Ga0207667_10500542 3300025949 Bacteria 1232
362 Ga0207667_10831335 3300025949 Bacteria 918
363 Ga0207651_10139931 3300025960 Bacteria 1868
364 Ga0207651_10710975 3300025960 Bacteria 886
365 Ga0207712_10002666 3300025961 Bacteria 11416
366 Ga0207712_10551953 3300025961 Unclassified 991
367 Ga0207640_10029189 3300025981 Bacteria 3382
368 Ga0207640_10188700 3300025981 Bacteria 1552
369 Ga0207640_10212205 3300025981 Bacteria 1476
370 Ga0207640_10385899 3300025981 Bacteria 1136
371 Ga0207658_10130705 3300025986 Bacteria 2017
372 Ga0207677_10282239 3300026023 Bacteria 1364
373 Ga0207703_10071084 3300026035 Bacteria 2874
374 Ga0207703_10124987 3300026035 Bacteria 2213
375 Ga0207703_10257243 3300026035 Bacteria 1577
376 Ga0207703_10497009 3300026035 Bacteria 1144
377 Ga0207703_10625015 3300026035 Bacteria 1020
378 Ga0207703_10954184 3300026035 Bacteria 822
379 Ga0207639_10130882 3300026041 Bacteria 2077
380 Ga0207639_10399488 3300026041 Bacteria 1238
381 Ga0207639_10866967 3300026041 Unclassified 843
382 Ga0207639_11440928 3300026041 Unclassified 646
383 Ga0207678_10336025 3300026067 Bacteria 1301
384 Ga0207708_10000113 3300026075 Bacteria 62692
385 Ga0207708_10006990 3300026075 Bacteria 8344
386 Ga0207708_10038058 3300026075 Bacteria 3664
387 Ga0207708_10064284 3300026075 Bacteria 2802
388 Ga0207708_10139587 3300026075 Bacteria 1900
389 Ga0207641_10045832 3300026088 Bacteria 3684
390 Ga0207641_10854155 3300026088 Bacteria 902
391 Ga0207648_10014413 3300026089 Bacteria 7305
392 Ga0207648_10156224 3300026089 Bacteria 2014
393 Ga0207648_10213658 3300026089 Bacteria 1713
394 Ga0207648_10639773 3300026089 Unclassified 982
395 Ga0207648_10660701 3300026089 Bacteria 966
396 Ga0207676_10014688 3300026095 Bacteria 5640
397 Ga0207676_10042613 3300026095 Bacteria 3491
398 Ga0207676_10153235 3300026095 Bacteria 1987
399 Ga0207676_10989030 3300026095 Unclassified 828
400 Ga0207674_10049009 3300026116 Bacteria 4321
401 Ga0207674_10457990 3300026116 Bacteria 1233
402 Ga0207674_10479604 3300026116 Bacteria 1202
403 Ga0207674_10928986 3300026116 Bacteria 838
404 Ga0207675_100022074 3300026118 Bacteria 5926
405 Ga0207675_100041420 3300026118 Bacteria 4301
406 Ga0207683_10117938 3300026121 Bacteria 2380
407 Ga0207683_10560283 3300026121 Bacteria 1057
408 Ga0207683_11105409 3300026121 Unclassified 735
409 Ga0207698_10148075 3300026142 Bacteria 2033
410 Ga0207698_10884502 3300026142 Unclassified 900
411 Ga0207428_10244347 3300027907 Bacteria 1340
412 Ga0268265_10273829 3300028380 Bacteria 1507
413 Ga0268264_10157821 3300028381 Bacteria 2040
414 Ga0268264_10219085 3300028381 Bacteria 1751
415 Ga0268264_10764744 3300028381 Unclassified 963
416 Ga0268264_10775500 3300028381 Bacteria 956
417 Ga0307513_10001943 3300031456 Bacteria 29245
418 Ga0307408_100005433 3300031548 Bacteria 8533
419 Ga0307405_10388649 3300031731 Bacteria 1088
420 Ga0307413_10028620 3300031824 Bacteria 3106
421 Ga0307410_10050737 3300031852 Bacteria 2792
422 Ga0307406_10041126 3300031901 Bacteria 2878
423 Ga0307416_100010995 3300032002 Bacteria 6009
424 Ga0307414_10036570 3300032004 Bacteria 3279
425 Ga0307411_10029849 3300032005 Bacteria 3336
426 Ga0307411_10109205 3300032005 Bacteria 1975
427 Ga0307415_100004487 3300032126 Bacteria 7251
428 Ga0373959_0017312 3300034820 Bacteria 1345
429 Ga0373940_0035833 3300035088 Bacteria 1345
430 Ga0373951_0004388 3300035091 Bacteria 3353
431 Ga0373941_0035781 3300035115 Bacteria 1506
432 Ga0373953_0235044 3300035117 Unclassified 795
433 Ga0373961_0010014 3300035241 Bacteria 2331
434 Ga0395899_0277163 3300037312 Unclassified 1142
435 Ga0395900_0023234 3300037418 Bacteria 6347
436 Ga0395898_0242819 3300037466 Bacteria 1718
437 Ga0395905_0039282 3300037471 Bacteria 4440
438 Ga0242419_001787 3300038698 Bacteria 1357
439 Ga0242422_01241 3300038699 Bacteria 1752
440 Ga0242420_026468 3300038996 Bacteria 1058
441 Ga0436365_0093604 3300039437 Bacteria 2137
442 Ga0436365_0359048 3300039437 Bacteria 106834
443 Ga0439448_0005550 3300042005 Bacteria 3599
444 Ga0439455_0044498 3300042012 Bacteria 1145
445 Ga0495669_0102704 3300046684 Unclassified 1329
446 Ga0496102_1301739 3300048905 Bacteria 646
447 Ga0496106_0060070 3300048909 Bacteria 2881
448 Ga0496108_0179324 3300048911 Bacteria 1834
449 Ga0496112_0128943 3300048915 Bacteria 2500
450 Ga0496112_0208756 3300048915 Bacteria 1911
451 Ga0496113_0718460 3300048916 Bacteria 797
452 Ga0501290_079411 3300049513 Bacteria 557
453 Ga0501291_008351 3300049514 Bacteria 1429
454 Ga0501291_018405 3300049514 Bacteria 1086
455 Ga0501292_005919 3300049515 Bacteria 1722
456 Ga0501296_002229 3300049519 Bacteria 2011
457 Ga0501296_016251 3300049519 Bacteria 924
458 Ga0501299_030466 3300049522 Bacteria 1038
459 Ga0501198_006147 3300049649 Bacteria 1703
460 Ga0501198_011382 3300049649 Bacteria 1327
461 Ga0501202_008497 3300049652 Bacteria 1872
462 Ga0501207_011444 3300049654 Bacteria 1321
463 Ga0501209_018654 3300049656 Bacteria 1607
464 Ga0501216_003929 3300049660 Bacteria 2188
465 Ga0501216_013020 3300049660 Bacteria 1373
466 Ga0501217_000077 3300049661 Bacteria 11891
467 Ga0501223_000616 3300049663 Bacteria 8549
468 Ga0501227_011594 3300049665 Bacteria 1921
469 Ga0501227_012237 3300049665 Bacteria 1877
470 Ga0501230_012008 3300049667 Bacteria 1380
471 Ga0501233_002602 3300049668 Bacteria 3189
472 Ga0501233_004368 3300049668 Bacteria 2589
473 Ga0501235_026421 3300049669 Bacteria 1301
474 Ga0501239_014072 3300049672 Bacteria 922
475 Ga0501240_003749 3300049673 Bacteria 1721
476 Ga0501243_015442 3300049675 Bacteria 1228
477 Ga0501257_010138 3300049686 Bacteria 2134
478 Ga0501260_008909 3300049689 Bacteria 994
479 Ga0501221_011786 3300049704 Bacteria 1581
480 Ga0501225_0001038 3300049705 Bacteria 8721
481 Ga0501225_0017571 3300049705 Bacteria 1985
482 Ga0501234_010480 3300049707 Bacteria 1444
483 Ga0501241_021360 3300049758 Bacteria 1193
484 Ga0501263_039566 3300049760 Bacteria 689
485 Ga0501273_002361 3300049770 Bacteria 1914
486 Ga0501273_003835 3300049770 Bacteria 1622
487 Ga0501273_013652 3300049770 Bacteria 1038
488 Ga0501226_000779 3300049853 Bacteria 4287
489 nmdc:mga05p37_1126536_c1 3300050507 Unclassified 819
490 nmdc:mga05p37_60553_c1 3300050507 Bacteria 4661
491 nmdc:mga05p37_961425_c1 3300050507 Bacteria 913
492 nmdc:mga09592_445273_c1 3300050508 Unclassified 1118
493 nmdc:mga0n895_256402_c1 3300050512 Bacteria 1775
494 nmdc:mga0n895_84943_c1 3300050512 Bacteria 3159
495 nmdc:mga0rr50_47512_c1 3300050513 Bacteria 3167
496 nmdc:mga0a205_315179_c1 3300050515 Unclassified 1436
497 nmdc:mga0a205_723360_c1 3300050515 Unclassified 845
498 Ga0068864_100472352
499 MRS1b_contig_2432709
500 MBSR1b_contig_12322913
501 MBSR1b_contig_4403363
502 JGI24751J29686_10000100
503 JGI25406J46586_10003206
504 JGI25406J46586_10004745
505 JGI25406J46586_10007143
506 Ga0065714_10026438
507 Ga0065714_10064425
508 Ga0065704_10029120
509 Ga0065712_10012810
510 Ga0065712_10067727
511 Ga0065712_10071450
512 Ga0065712_10082661
513 Ga0065712_10143494
514 Ga0065715_10000520
515 Ga0065715_10001774
516 Ga0065715_10026682
517 Ga0065715_10055268
518 Ga0065715_10129043
519 Ga0065715_10140112
520 Ga0065715_10396881
521 Ga0065715_10594999
522 Ga0065707_10177711
523 Ga0070676_10029384
524 Ga0070690_100055735
525 Ga0070670_100000190
526 Ga0070670_100029444
527 Ga0070670_100042431
528 Ga0070670_100053188
529 Ga0070670_100122044
530 Ga0070670_100360640
531 Ga0068869_100021893
532 Ga0068869_100061532
533 Ga0068869_100299237
534 Ga0068869_100890390
535 Ga0070666_10096288
536 Ga0070682_100015744
537 Ga0070689_100004642
538 Ga0070689_100179175
539 Ga0070689_100749948
540 Ga0070687_100078473
541 Ga0070687_100083082
542 Ga0070687_100318093
543 Ga0070661_100220765
544 Ga0070661_100408842
545 Ga0070692_10010044
546 Ga0070692_10052556
547 Ga0070692_10187699
548 Ga0070692_10272349
549 Ga0070669_100027550
550 Ga0070669_100102957
551 Ga0070675_100044802
552 Ga0070675_100088122
553 Ga0070671_100001794
554 Ga0070671_100014863
555 Ga0070674_100165315
556 Ga0070673_100033116
557 Ga0070673_100310631
558 Ga0070673_100787116
559 Ga0070688_100163595
560 Ga0070688_100223787
561 Ga0070659_100004509
562 Ga0070667_100009592
563 Ga0070667_100175820
564 Ga0070703_10070810
565 Ga0070701_10054184
566 Ga0070701_10063168
567 Ga0070701_10277180
568 Ga0070705_100006528
569 Ga0070705_100598721
570 Ga0070700_100000047
571 Ga0070700_100081746
572 Ga0070700_100155896
573 Ga0070700_100156000
574 Ga0070700_100190241
575 Ga0070700_100464737
576 Ga0070694_100034628
577 Ga0070694_100145302
578 Ga0070694_100200322
579 Ga0070694_100523389
580 Ga0070694_100580371
581 Ga0070694_100752820
582 Ga0070678_100088055
583 Ga0070678_100886924
584 Ga0070662_100029198
585 Ga0070681_10016154
586 Ga0068867_100028144
587 Ga0068867_100109637
588 Ga0068867_100247986
589 Ga0070685_10078438
590 Ga0070698_100029989
591 Ga0070699_100000978
592 Ga0070699_100007962
593 Ga0070699_100135003
594 Ga0070699_100302116
595 Ga0070699_101255853
596 Ga0070679_100270859
597 Ga0070684_100122713
598 Ga0070697_100318643
599 Ga0068853_100067303
600 Ga0068853_100337031
601 Ga0070686_100043932
602 Ga0070695_100139487
603 Ga0070695_100435883
604 Ga0070695_100467483
605 Ga0070696_100033275
606 Ga0070696_100157208
607 Ga0070696_100344001
608 Ga0070693_100001543
609 Ga0070693_100063630
610 Ga0070693_100197332
611 Ga0070665_100650331
612 Ga0070704_100099144
613 Ga0070704_100130854
614 Ga0068855_100021840
615 Ga0070664_100836294
616 Ga0068857_100026877
617 Ga0068857_100275569
618 Ga0068857_100964534
619 Ga0068854_100099412
620 Ga0068854_100120212
621 Ga0068854_100806451
622 Ga0068854_100967057
623 Ga0068854_100984383
624 Ga0070702_100006592
625 Ga0070702_100027049
626 Ga0070702_100410359
627 Ga0070702_100892952
628 Ga0068852_100017089
629 Ga0068852_100084361
630 Ga0068852_100600423
631 Ga0068852_100961456
632 Ga0068859_100003483
633 Ga0068859_100012935
634 Ga0068859_100019526
635 Ga0068859_100021522
636 Ga0068859_100069471
637 Ga0068859_100127399
638 Ga0068859_100142881
639 Ga0068859_100180629
640 Ga0068859_100212619
641 Ga0068859_100303652
642 Ga0068859_100857868
643 Ga0068859_100955661
644 Ga0068859_101146935
645 Ga0068859_101148627
646 Ga0068859_101304615
647 Ga0068859_101607757
648 Ga0068864_100008955
649 Ga0068864_100123405
650 Ga0068864_100457464
651 Ga0068864_100681281
652 Ga0068864_100843411
653 Ga0068864_101090432
654 Ga0068864_101196565
655 Ga0068866_10037865
656 Ga0068866_10515991
657 Ga0068861_100089564
658 Ga0068861_100139551
659 Ga0068861_100497020
660 Ga0068851_10015373
661 Ga0068851_10508184
662 Ga0068870_10019198
663 Ga0068870_10059964
664 Ga0068870_10252825
665 Ga0068870_10387402
666 Ga0068863_100032179
667 Ga0068863_100070502
668 Ga0068863_100326257
669 Ga0068863_100348100
670 Ga0068863_100743194
671 Ga0068858_100017765
672 Ga0068858_100057363
673 Ga0068858_100127273
674 Ga0068858_100139254
675 Ga0068858_100170438
676 Ga0068858_100415341
677 Ga0068858_100483890
678 Ga0068858_100542504
679 Ga0068860_100011886
680 Ga0068860_100138014
681 Ga0068860_100269802
682 Ga0068860_101298476
683 Ga0068862_100149552
684 Ga0068862_101066449
685 Ga0081539_10001165
686 Ga0081539_10003903
687 Ga0081539_10005776
688 Ga0081539_10059755
689 Ga0070715_10000349
690 Ga0097621_100006462
691 Ga0097621_100026034
692 Ga0097621_100553154
693 Ga0068871_100009119
694 Ga0068871_100015456
695 Ga0068871_100341981
696 Ga0075431_100994854
697 Ga0075433_10015977
698 Ga0075433_10135002
699 Ga0075433_10139025
700 Ga0075434_100147304
701 Ga0075429_100117155
702 Ga0068865_100005045
703 Ga0075436_100172118
704 Ga0097620_100003483
705 Ga0097620_100012935
706 Ga0097620_100019526
707 Ga0097620_100021521
708 Ga0097620_100069468
709 Ga0097620_100127397
710 Ga0097620_100142875
711 Ga0097620_100180630
712 Ga0097620_100212631
713 Ga0097620_100303665
714 Ga0097620_100857735
715 Ga0097620_100955666
716 Ga0097620_101146906
717 Ga0097620_101148730
718 Ga0097620_101304380
719 Ga0097620_101607704
720 Ga0075435_100039743
721 Ga0105240_10019154
722 Ga0111539_10337368
723 Ga0105245_10039248
724 Ga0105247_10005623
725 Ga0105247_10169041
726 Ga0105247_10171549
727 Ga0105247_10508299
728 Ga0105247_10585765
729 Ga0114129_10037265
730 Ga0114129_10096943
731 Ga0114129_10803115
732 Ga0114129_11285003
733 Ga0105243_10045663
734 Ga0105243_10517761
735 Ga0105243_10733691
736 Ga0105243_11156871
737 Ga0105241_10012730
738 Ga0105241_10485761
739 Ga0105241_10810615
740 Ga0105241_10830293
741 Ga0105241_11071783
742 Ga0105242_10039284
743 Ga0105242_10061539
744 Ga0105242_10062081
745 Ga0105248_10012096
746 Ga0105248_10024652
747 Ga0105248_10058467
748 Ga0105248_10114069
749 Ga0105248_10164133
750 Ga0105248_10289432
751 Ga0105248_10463608
752 Ga0105237_10000843
753 Ga0105237_10788851
754 Ga0105238_10003205
755 Ga0105238_10808492
756 Ga0105249_10112658
757 Ga0105249_10357329
758 Ga0105249_11706844
759 Ga0105239_10284891
760 Ga0105246_10239073
761 Ga0105246_10671690
762 Ga0157373_10080148
763 Ga0157371_10334650
764 Ga0157371_10385781
765 Ga0157378_10010534
766 Ga0157378_10010652
767 Ga0163162_10011422
768 Ga0163162_10296471
769 Ga0163162_10329033
770 Ga0163162_11073485
771 Ga0157372_10006102
772 Ga0157372_10861367
773 Ga0157372_10968476
774 Ga0157372_11358614
775 Ga0157375_10040857
776 Ga0157375_10447525
777 Ga0157375_10629843
778 Ga0157375_10834869
779 Ga0157375_10848865
780 Ga0163163_10000209
781 Ga0163163_10007701
782 Ga0163163_10060915
783 Ga0163163_10304927
784 Ga0163163_10317293
785 Ga0163163_10485979
786 Ga0163163_10759996
787 Ga0163163_11730981
788 Ga0157380_10040864
789 Ga0157380_10972237
790 Ga0157380_11068479
791 Ga0157377_10023725
792 Ga0157379_10330278
793 Ga0157379_11288753
794 Ga0157379_11433076
795 Ga0157376_10064736
796 Ga0157376_10237574
797 Ga0163161_10021051
798 Ga0213876_10000242
799 Ga0213876_10105208
800 Ga0207697_10040807
801 Ga0207656_10015828
802 Ga0207653_10001107
803 Ga0207642_10009616
804 Ga0207710_10063235
805 Ga0207710_10103708
806 Ga0207710_10295175
807 Ga0207688_10198419
808 Ga0207680_10047970
809 Ga0207647_10050369
810 Ga0207685_10000074
811 Ga0207645_10067788
812 Ga0207645_10177414
813 Ga0207643_10003881
814 Ga0207643_10079816
815 Ga0207643_10460249
816 Ga0207654_10503047
817 Ga0207654_10647514
818 Ga0207707_10092311
819 Ga0207695_10053429
820 Ga0207671_10001210
821 Ga0207660_10167507
822 Ga0207662_10015344
823 Ga0207662_10043152
824 Ga0207662_10113824
825 Ga0207681_10027174
826 Ga0207681_10051371
827 Ga0207681_10337334
828 Ga0207650_10000007
829 Ga0207650_10043978
830 Ga0207650_10127743
831 Ga0207650_10200721
832 Ga0207650_10958167
833 Ga0207659_10075908
834 Ga0207659_10160158
835 Ga0207659_10376912
836 Ga0207644_10166205
837 Ga0207644_10369234
838 Ga0207690_10195781
839 Ga0207706_10089873
840 Ga0207706_10243074
841 Ga0207686_10032762
842 Ga0207686_10073714
843 Ga0207709_10212840
844 Ga0207670_10000123
845 Ga0207669_10239070
846 Ga0207704_10262805
847 Ga0207691_10010959
848 Ga0207711_10003299
849 Ga0207711_10188936
850 Ga0207711_10246526
851 Ga0207711_10380534
852 Ga0207711_10893364
853 Ga0207689_10005481
854 Ga0207689_10027345
855 Ga0207689_10287551
856 Ga0207689_10974432
857 Ga0207679_10128542
858 Ga0207667_10500542
859 Ga0207667_10831335
860 Ga0207651_10139931
861 Ga0207651_10710975
862 Ga0207712_10002666
863 Ga0207712_10551953
864 Ga0207640_10029189
865 Ga0207640_10188700
866 Ga0207640_10212205
867 Ga0207640_10385899
868 Ga0207658_10130705
869 Ga0207677_10282239
870 Ga0207703_10071084
871 Ga0207703_10124987
872 Ga0207703_10257243
873 Ga0207703_10497009
874 Ga0207703_10625015
875 Ga0207703_10954184
876 Ga0207639_10130882
877 Ga0207639_10399488
878 Ga0207639_10866967
879 Ga0207639_11440928
880 Ga0207678_10336025
881 Ga0207708_10000113
882 Ga0207708_10006990
883 Ga0207708_10038058
884 Ga0207708_10064284
885 Ga0207708_10139587
886 Ga0207641_10045832
887 Ga0207641_10854155
888 Ga0207648_10014413
889 Ga0207648_10156224
890 Ga0207648_10213658
891 Ga0207648_10639773
892 Ga0207648_10660701
893 Ga0207676_10014688
894 Ga0207676_10042613
895 Ga0207676_10153235
896 Ga0207676_10989030
897 Ga0207674_10049009
898 Ga0207674_10457990
899 Ga0207674_10479604
900 Ga0207674_10928986
901 Ga0207675_100022074
902 Ga0207675_100041420
903 Ga0207683_10117938
904 Ga0207683_10560283
905 Ga0207683_11105409
906 Ga0207698_10148075
907 Ga0207698_10884502
908 Ga0207428_10244347
909 Ga0268265_10273829
910 Ga0268264_10157821
911 Ga0268264_10219085
912 Ga0268264_10764744
913 Ga0268264_10775500
914 Ga0307513_10001943
915 Ga0307408_100005433
916 Ga0307405_10388649
917 Ga0307413_10028620
918 Ga0307410_10050737
919 Ga0307406_10041126
920 Ga0307416_100010995
921 Ga0307414_10036570
922 Ga0307411_10029849
923 Ga0307411_10109205
924 Ga0307415_100004487
925 Ga0373959_0017312
926 Ga0373940_0035833
927 Ga0373951_0004388
928 Ga0373941_0035781
929 Ga0373953_0235044
930 Ga0373961_0010014
931 Ga0395899_0277163
932 Ga0395900_0023234
933 Ga0395898_0242819
934 Ga0395905_0039282
935 Ga0242419_001787
936 Ga0242422_01241
937 Ga0242420_026468
938 Ga0436365_0093604
939 Ga0436365_0359048
940 Ga0439448_0005550
941 Ga0439455_0044498
942 Ga0495669_0102704
943 Ga0496102_1301739
944 Ga0496106_0060070
945 Ga0496108_0179324
946 Ga0496112_0128943
947 Ga0496112_0208756
948 Ga0496113_0718460
949 Ga0501290_079411
950 Ga0501291_008351
951 Ga0501291_018405
952 Ga0501292_005919
953 Ga0501296_002229
954 Ga0501296_016251
955 Ga0501299_030466
956 Ga0501198_006147
957 Ga0501198_011382
958 Ga0501202_008497
959 Ga0501207_011444
960 Ga0501209_018654
961 Ga0501216_003929
962 Ga0501216_013020
963 Ga0501217_000077
964 Ga0501223_000616
965 Ga0501227_011594
966 Ga0501227_012237
967 Ga0501230_012008
968 Ga0501233_002602
969 Ga0501233_004368
970 Ga0501235_026421
971 Ga0501239_014072
972 Ga0501240_003749
973 Ga0501243_015442
974 Ga0501257_010138
975 Ga0501260_008909
976 Ga0501221_011786
977 Ga0501225_0001038
978 Ga0501225_0017571
979 Ga0501234_010480
980 Ga0501241_021360
981 Ga0501263_039566
982 Ga0501273_002361
983 Ga0501273_003835
984 Ga0501273_013652
985 Ga0501226_000779
986 nmdc:mga05p37_1126536_c1
987 nmdc:mga05p37_60553_c1
988 nmdc:mga05p37_961425_c1
989 nmdc:mga09592_445273_c1
990 nmdc:mga0n895_256402_c1
991 nmdc:mga0n895_84943_c1
992 nmdc:mga0rr50_47512_c1
993 nmdc:mga0a205_315179_c1
994 nmdc:mga0a205_723360_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map