F454910

General Info

Members Datasets Scaffolds Average Seq Length
496 319 992 341

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10165984|Ga0207708_101659841
Length 372
Sequence MRHVDMRKLPAAAQEERRRQVVGLRQRGLTYREIAEQVGLSRTGVIDICQRFAAEGAKGLVSKPRGRKPDEQRLLDAAQEAEVQRLIRRHTPDALGLPFALWSRAAVGMLVTRQCGVELAVRTVGKYLARWGFTAQKPIRRAYEQDPAAVRRWLRRDYPAIVARARQARGIIFWGDETGLRSDDVRGRGYAPRGRTPLVRVCHKRASLSLISAVANKGELRWMIVDGAVNAPALIRFLERLVREARRKVFLILDRLRVHRARLVQDWLAEHSSRIEVHYLPPXXPDLNPDEGLNADLKQVVPRKAPARSKQQLKRSAISHMRSLAKRPQRIRSIFQPGLFNAVGCGEGLGGNRRHRWQRGSGPAGVSFGGWP

Samples

Sample ID Description Type Environment
1 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
94 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
95 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
173 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
179 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
180 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
181 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
184 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
185 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
188 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
189 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
203 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
204 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
205 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
206 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
207 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
208 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
209 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
210 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
221 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
222 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
223 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
224 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
225 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
226 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
227 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
228 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
229 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
230 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
231 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
232 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
233 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
234 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
235 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
236 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
237 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
238 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
239 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
240 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
241 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
242 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
243 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
244 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
245 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
246 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
247 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
248 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
249 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
250 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
253 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
254 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
255 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
256 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
257 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
258 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
259 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
267 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
268 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
269 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
275 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
276 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
277 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
278 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
279 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
280 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
281 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
286 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
291 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
292 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
293 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
294 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
295 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
296 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
297 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
315 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
316 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
317 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
318 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
319 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0.2
Isolates 1.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 1.41
Rhizoplane 4.44
Rhizosphere 90.32
Stem 0
Stem Tuber 0
Unclassified 8.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207708_10165984 3300026075 Bacteria 1746
2 JGI24752J21851_1011272 3300001976 Unclassified 1167
3 JGI24746J21847_1013394 3300001977 Unclassified 1192
4 JGI24747J21853_1005890 3300001978 Unclassified 1144
5 JGI24740J21852_10054114 3300001979 Unclassified 1135
6 JGI24743J22301_10023949 3300001991 Unclassified 1177
7 JGI24743J22301_10025989 3300001991 Unclassified 1137
8 JGI24743J22301_10026551 3300001991 Bacteria 1127
9 JGI24750J21931_1012328 3300002070 Unclassified 1133
10 JGI24745J21846_1007515 3300002073 Unclassified 1221
11 JGI24745J21846_1008893 3300002073 Bacteria 1134
12 JGI24745J21846_1008921 3300002073 Unclassified 1133
13 JGI24748J21848_1008765 3300002074 Unclassified 1190
14 JGI24738J21930_10028754 3300002075 Unclassified 1137
15 JGI24749J21850_1012248 3300002076 Unclassified 1205
16 JGI24033J26618_1009419 3300002155 Unclassified 1137
17 rootH2_10252118 3300003320 Bacteria 1488
18 Ga0065712_10022068 3300005290 Bacteria 1396
19 Ga0065715_10192191 3300005293 Bacteria 1382
20 Ga0070658_10304325 3300005327 Bacteria 1360
21 Ga0070658_10328123 3300005327 Bacteria 1307
22 Ga0070676_10187179 3300005328 Bacteria 1349
23 Ga0070683_100382936 3300005329 Bacteria 1340
24 Ga0070683_100433800 3300005329 Bacteria 1254
25 Ga0070670_100455986 3300005331 Bacteria 1133
26 Ga0070677_10054869 3300005333 Bacteria 1624
27 Ga0070666_10129630 3300005335 Bacteria 1752
28 Ga0070680_100312058 3300005336 Bacteria 1334
29 Ga0070682_100119283 3300005337 Bacteria 1768
30 Ga0068868_100281941 3300005338 Bacteria 1406
31 Ga0070660_100251499 3300005339 Bacteria 1441
32 Ga0070689_100190157 3300005340 Bacteria 1671
33 Ga0070691_10113826 3300005341 Bacteria 1355
34 Ga0070687_100122274 3300005343 Bacteria 1490
35 Ga0070692_10102018 3300005345 Bacteria 1574
36 Ga0070668_100199948 3300005347 Bacteria 1640
37 Ga0070668_100293557 3300005347 Bacteria 1361
38 Ga0070669_100260159 3300005353 Bacteria 1384
39 Ga0070669_100399169 3300005353 Bacteria 1125
40 Ga0070675_100188238 3300005354 Bacteria 1787
41 Ga0070675_100367512 3300005354 Bacteria 1278
42 Ga0070675_100475558 3300005354 Unclassified 1123
43 Ga0070674_100128291 3300005356 Bacteria 1887
44 Ga0070674_100193358 3300005356 Bacteria 1566
45 Ga0070674_100203728 3300005356 Bacteria 1529
46 Ga0070688_100206018 3300005365 Bacteria 1378
47 Ga0070659_100295502 3300005366 Bacteria 1349
48 Ga0070659_100309947 3300005366 Bacteria 1318
49 Ga0070659_100360982 3300005366 Bacteria 1220
50 Ga0070667_100496341 3300005367 Bacteria 1119
51 Ga0070709_10174799 3300005434 Bacteria 1503
52 Ga0070714_100374781 3300005435 Bacteria 1341
53 Ga0070714_100377013 3300005435 Unclassified 1337
54 Ga0070713_100450615 3300005436 Bacteria 1208
55 Ga0070710_10148990 3300005437 Bacteria 1441
56 Ga0070701_10140289 3300005438 Bacteria 1381
57 Ga0070711_100394891 3300005439 Bacteria 1121
58 Ga0070700_100226284 3300005441 Bacteria 1328
59 Ga0070694_100265919 3300005444 Bacteria 1302
60 Ga0070663_100235807 3300005455 Bacteria 1442
61 Ga0070678_100231824 3300005456 Bacteria 1540
62 Ga0070678_100283232 3300005456 Bacteria 1402
63 Ga0070678_100294315 3300005456 Bacteria 1377
64 Ga0070662_100137773 3300005457 Bacteria 1888
65 Ga0070662_100205831 3300005457 Bacteria 1563
66 Ga0068867_100203896 3300005459 Bacteria 1585
67 Ga0068867_100429883 3300005459 Bacteria 1120
68 Ga0070685_10174764 3300005466 Bacteria 1378
69 Ga0070685_10200597 3300005466 Bacteria 1296
70 Ga0070679_100395252 3300005530 Bacteria 1329
71 Ga0070679_100459647 3300005530 Bacteria 1218
72 Ga0070684_100128038 3300005535 Bacteria 2289
73 Ga0070684_100209308 3300005535 Bacteria 1777
74 Ga0070684_100234659 3300005535 Bacteria 1675
75 Ga0070672_100312336 3300005543 Bacteria 1335
76 Ga0070672_100373660 3300005543 Bacteria 1218
77 Ga0070686_100159924 3300005544 Bacteria 1585
78 Ga0070686_100175566 3300005544 Bacteria 1518
79 Ga0070696_100202796 3300005546 Bacteria 1481
80 Ga0070693_100070439 3300005547 Bacteria 2057
81 Ga0070693_100091142 3300005547 Bacteria 1838
82 Ga0070693_100239997 3300005547 Bacteria 1196
83 Ga0070665_100422142 3300005548 Bacteria 1342
84 Ga0070665_100436522 3300005548 Bacteria 1319
85 Ga0068855_100440856 3300005563 Bacteria 1422
86 Ga0068855_100515714 3300005563 Bacteria 1297
87 Ga0070664_100396576 3300005564 Bacteria 1261
88 Ga0070664_100463357 3300005564 Bacteria 1165
89 Ga0068854_100154064 3300005578 Bacteria 1774
90 Ga0068854_100242662 3300005578 Bacteria 1435
91 Ga0068854_100332811 3300005578 Bacteria 1238
92 Ga0068856_100126766 3300005614 Bacteria 2556
93 Ga0070702_100221370 3300005615 Bacteria 1266
94 Ga0068852_100382229 3300005616 Bacteria 1381
95 Ga0068859_100330119 3300005617 Bacteria 1619
96 Ga0068859_100613726 3300005617 Bacteria 1180
97 Ga0068864_100291875 3300005618 Bacteria 1524
98 Ga0068866_10129007 3300005718 Bacteria 1435
99 Ga0068861_100257833 3300005719 Bacteria 1491
100 Ga0068851_10129506 3300005834 Bacteria 1363
101 Ga0068851_10185990 3300005834 Bacteria 1152
102 Ga0068870_10093060 3300005840 Bacteria 1689
103 Ga0068870_10156674 3300005840 Bacteria 1347
104 Ga0068863_100565421 3300005841 Bacteria 1124
105 Ga0068858_100420375 3300005842 Bacteria 1285
106 Ga0068860_100426341 3300005843 Bacteria 1315
107 Ga0068860_100545553 3300005843 Bacteria 1161
108 Ga0068862_100333888 3300005844 Bacteria 1402
109 Ga0068862_100430205 3300005844 Bacteria 1240
110 Ga0081538_10120975 3300005981 Bacteria 1258
111 Ga0081538_10122840 3300005981 Bacteria 1243
112 Ga0081538_10129218 3300005981 Bacteria 1192
113 Ga0081539_10017390 3300005985 Bacteria 5052
114 Ga0070717_10242279 3300006028 Bacteria 1590
115 Ga0075432_10065251 3300006058 Bacteria 1301
116 Ga0068871_100465243 3300006358 Bacteria 1135
117 Ga0075433_10447260 3300006852 Bacteria 1139
118 Ga0075434_100522090 3300006871 Bacteria 1208
119 Ga0097620_100330107 3300006931 Bacteria 1619
120 Ga0097620_100613775 3300006931 Bacteria 1180
121 Ga0075435_100342794 3300007076 Bacteria 1280
122 Ga0105250_10070602 3300009092 Bacteria 1410
123 Ga0105240_10496301 3300009093 Bacteria 1358
124 Ga0111539_10377833 3300009094 Bacteria 1649
125 Ga0111539_10468955 3300009094 Bacteria 1466
126 Ga0105247_10161173 3300009101 Bacteria 1485
127 Ga0105243_10238806 3300009148 Bacteria 1616
128 Ga0105243_10391838 3300009148 Bacteria 1288
129 Ga0105243_10450138 3300009148 Bacteria 1208
130 Ga0105242_10245721 3300009176 Bacteria 1611
131 Ga0105237_10411111 3300009545 Bacteria 1358
132 Ga0105238_10377307 3300009551 Bacteria 1409
133 Ga0105249_10280855 3300009553 Bacteria 1663
134 Ga0105239_10485601 3300010375 Bacteria 1404
135 Ga0105246_10246507 3300011119 Bacteria 1415
136 Ga0105246_10293588 3300011119 Unclassified 1309
137 Ga0157319_1000983 3300012497 Bacteria 1385
138 Ga0157339_1001183 3300012505 Bacteria 1538
139 Ga0157338_1002607 3300012515 Bacteria 1428
140 Ga0157373_10160387 3300013100 Bacteria 1582
141 Ga0157373_10195506 3300013100 Bacteria 1426
142 Ga0157371_10212921 3300013102 Bacteria 1387
143 Ga0157370_10203895 3300013104 Bacteria 1834
144 Ga0157370_10439101 3300013104 Bacteria 1200
145 Ga0157369_10236702 3300013105 Bacteria 1908
146 Ga0157369_10430324 3300013105 Bacteria 1368
147 Ga0157374_10385203 3300013296 Bacteria 1397
148 Ga0157378_10364300 3300013297 Bacteria 1415
149 Ga0163162_10446746 3300013306 Bacteria 1425
150 Ga0163162_10487146 3300013306 Bacteria 1364
151 Ga0163162_10567086 3300013306 Bacteria 1263
152 Ga0157375_10459363 3300013308 Bacteria 1439
153 Ga0163163_10445370 3300014325 Bacteria 1355
154 Ga0157380_10068566 3300014326 Bacteria 2859
155 Ga0182008_10092842 3300014497 Bacteria 1489
156 Ga0157377_10107810 3300014745 Bacteria 1670
157 Ga0157377_10171107 3300014745 Bacteria 1359
158 Ga0157379_10158906 3300014968 Bacteria 2040
159 Ga0157379_10380148 3300014968 Bacteria 1296
160 Ga0163161_10230707 3300017792 Bacteria 1437
161 Ga0163161_10238351 3300017792 Bacteria 1414
162 Ga0206353_11780671 3300020082 Bacteria 1373
163 Ga0213873_10035291 3300021358 Bacteria 1264
164 Ga0213872_10102699 3300021361 Bacteria 1273
165 Ga0213874_10064843 3300021377 Bacteria 1152
166 Ga0213876_10137879 3300021384 Bacteria 1297
167 Ga0213876_10169730 3300021384 Bacteria 1160
168 Ga0207666_1010912 3300025271 Bacteria 1250
169 Ga0209025_1001215 3300025294 Bacteria 36003
170 Ga0207697_10089682 3300025315 Bacteria 1302
171 Ga0207656_10103762 3300025321 Bacteria 1306
172 Ga0207656_10136447 3300025321 Bacteria 1153
173 Ga0207653_10064083 3300025885 Bacteria 1245
174 Ga0207710_10115972 3300025900 Bacteria 1275
175 Ga0207688_10024267 3300025901 Bacteria 3325
176 Ga0207688_10058810 3300025901 Bacteria 2164
177 Ga0207688_10103239 3300025901 Bacteria 1648
178 Ga0207688_10165400 3300025901 Bacteria 1313
179 Ga0207680_10128401 3300025903 Bacteria 1668
180 Ga0207647_10165936 3300025904 Bacteria 1287
181 Ga0207699_10284347 3300025906 Bacteria 1150
182 Ga0207645_10156145 3300025907 Bacteria 1491
183 Ga0207643_10029733 3300025908 Bacteria 3039
184 Ga0207643_10177528 3300025908 Bacteria 1287
185 Ga0207707_10417835 3300025912 Bacteria 1150
186 Ga0207671_10284435 3300025914 Bacteria 1305
187 Ga0207693_10165840 3300025915 Bacteria 1739
188 Ga0207693_10168218 3300025915 Bacteria 1726
189 Ga0207663_10148895 3300025916 Unclassified 1640
190 Ga0207660_10344085 3300025917 Bacteria 1194
191 Ga0207657_10197370 3300025919 Bacteria 1620
192 Ga0207681_10263776 3300025923 Bacteria 1349
193 Ga0207681_10272416 3300025923 Bacteria 1329
194 Ga0207681_10357390 3300025923 Bacteria 1170
195 Ga0207659_10230973 3300025926 Bacteria 1492
196 Ga0207659_10389021 3300025926 Bacteria 1164
197 Ga0207700_10437330 3300025928 Bacteria 1151
198 Ga0207644_10263609 3300025931 Bacteria 1378
199 Ga0207644_10364172 3300025931 Bacteria 1176
200 Ga0207690_10274951 3300025932 Bacteria 1310
201 Ga0207690_10325692 3300025932 Bacteria 1209
202 Ga0207690_10346770 3300025932 Bacteria 1173
203 Ga0207706_10094452 3300025933 Bacteria 2630
204 Ga0207706_10298153 3300025933 Bacteria 1405
205 Ga0207706_10316600 3300025933 Bacteria 1358
206 Ga0207686_10234685 3300025934 Bacteria 1332
207 Ga0207670_10350269 3300025936 Bacteria 1169
208 Ga0207670_10350917 3300025936 Bacteria 1168
209 Ga0207669_10208786 3300025937 Bacteria 1423
210 Ga0207669_10281006 3300025937 Bacteria 1255
211 Ga0207669_10321088 3300025937 Bacteria 1185
212 Ga0207704_10275477 3300025938 Bacteria 1276
213 Ga0207704_10315216 3300025938 Bacteria 1204
214 Ga0207665_10118851 3300025939 Bacteria 1865
215 Ga0207691_10308652 3300025940 Bacteria 1358
216 Ga0207689_10396341 3300025942 Bacteria 1150
217 Ga0207661_10344433 3300025944 Bacteria 1343
218 Ga0207661_10373552 3300025944 Bacteria 1289
219 Ga0207661_10406253 3300025944 Bacteria 1235
220 Ga0207661_10431819 3300025944 Bacteria 1197
221 Ga0207679_10371826 3300025945 Bacteria 1251
222 Ga0207667_10453604 3300025949 Bacteria 1303
223 Ga0207651_10397443 3300025960 Bacteria 1171
224 Ga0207712_10391572 3300025961 Bacteria 1166
225 Ga0207712_10398830 3300025961 Bacteria 1156
226 Ga0207668_10385822 3300025972 Bacteria 1180
227 Ga0207668_10403209 3300025972 Bacteria 1156
228 Ga0207668_10415597 3300025972 Bacteria 1140
229 Ga0207640_10139626 3300025981 Bacteria 1764
230 Ga0207640_10140013 3300025981 Bacteria 1762
231 Ga0207640_10155285 3300025981 Bacteria 1686
232 Ga0207640_10376406 3300025981 Bacteria 1149
233 Ga0207658_10415975 3300025986 Bacteria 1184
234 Ga0207677_10103826 3300026023 Bacteria 2099
235 Ga0207677_10383992 3300026023 Bacteria 1186
236 Ga0207677_10400995 3300026023 Bacteria 1163
237 Ga0207703_10422647 3300026035 Unclassified 1240
238 Ga0207703_10462841 3300026035 Bacteria 1186
239 Ga0207703_10481143 3300026035 Bacteria 1163
240 Ga0207703_10647537 3300026035 Bacteria 1002
241 Ga0207639_10422578 3300026041 Bacteria 1205
242 Ga0207639_10479664 3300026041 Bacteria 1133
243 Ga0207708_10099371 3300026075 Bacteria 2251
244 Ga0207702_10489177 3300026078 Bacteria 1198
245 Ga0207641_10498220 3300026088 Bacteria 1182
246 Ga0207648_10176190 3300026089 Bacteria 1891
247 Ga0207648_10272958 3300026089 Bacteria 1511
248 Ga0207676_10102654 3300026095 Bacteria 2374
249 Ga0207676_10463082 3300026095 Bacteria 1197
250 Ga0207675_100180414 3300026118 Bacteria 2022
251 Ga0207683_10386143 3300026121 Bacteria 1287
252 Ga0207683_10390528 3300026121 Bacteria 1280
253 Ga0207683_10427899 3300026121 Bacteria 1219
254 Ga0207698_10296091 3300026142 Bacteria 1504
255 Ga0207698_10524718 3300026142 Bacteria 1156
256 Ga0207698_10552054 3300026142 Bacteria 1129
257 Ga0209996_1009959 3300027395 Bacteria 1256
258 Ga0209984_1008166 3300027424 Bacteria 1313
259 Ga0210002_1016884 3300027617 Bacteria 1158
260 Ga0209966_1025856 3300027695 Bacteria 1167
261 Ga0207428_10311794 3300027907 Bacteria 1163
262 Ga0207428_10324517 3300027907 Bacteria 1137
263 Ga0268266_10325157 3300028379 Bacteria 1440
264 Ga0268266_10477911 3300028379 Bacteria 1187
265 Ga0268266_10484337 3300028379 Bacteria 1179
266 Ga0268266_10502661 3300028379 Bacteria 1157
267 Ga0268265_10469218 3300028380 Bacteria 1179
268 Ga0268265_10478957 3300028380 Bacteria 1168
269 Ga0268264_10305022 3300028381 Bacteria 1500
270 Ga0268264_10341870 3300028381 Bacteria 1422
271 Ga0268264_10454236 3300028381 Bacteria 1242
272 Ga0268264_10516235 3300028381 Bacteria 1167
273 Ga0265323_10062585 3300028653 Unclassified 1290
274 Ga0265323_10070882 3300028653 Bacteria 1191
275 Ga0265322_10010927 3300028654 Unclassified 2633
276 Ga0265322_10044825 3300028654 Bacteria 1259
277 Ga0265322_10045883 3300028654 Unclassified 1242
278 Ga0307515_10317116 3300028794 Bacteria 1228
279 Ga0265324_10015260 3300029957 Unclassified 2828
280 Ga0265330_10050992 3300031235 Unclassified 1814
281 Ga0265330_10074878 3300031235 Bacteria 1462
282 Ga0265332_10117716 3300031238 Unclassified 1116
283 Ga0265328_10092499 3300031239 Unclassified 1117
284 Ga0265320_10057746 3300031240 Bacteria 1860
285 Ga0265325_10040698 3300031241 Bacteria 2439
286 Ga0265329_10030731 3300031242 Bacteria 1748
287 Ga0265329_10055537 3300031242 Bacteria 1256
288 Ga0265340_10038844 3300031247 Bacteria 2352
289 Ga0265340_10104395 3300031247 Bacteria 1315
290 Ga0265339_10032289 3300031249 Bacteria 2953
291 Ga0265331_10136559 3300031250 Unclassified 1116
292 Ga0265327_10027830 3300031251 Bacteria 3245
293 Ga0265316_10170343 3300031344 Bacteria 1624
294 Ga0265316_10304447 3300031344 Unclassified 1160
295 Ga0265316_10324636 3300031344 Unclassified 1117
296 Ga0265313_10080440 3300031595 Unclassified 1480
297 Ga0316575_10063822 3300031665 Bacteria 1474
298 Ga0316579_10100114 3300031691 Bacteria 1387
299 Ga0265314_10217450 3300031711 Unclassified 1117
300 Ga0265342_10039510 3300031712 Bacteria 2866
301 Ga0265342_10170059 3300031712 Bacteria 1199
302 Ga0316578_10029433 3300031728 Bacteria 3117
303 Ga0307410_10054855 3300031852 Bacteria 2703
304 Ga0326468_10000793 3300031889 Bacteria 3184
305 Ga0326468_10003752 3300031889 Bacteria 1300
306 Ga0326468_10004674 3300031889 Bacteria 1204
307 Ga0307406_10398053 3300031901 Bacteria 1091
308 Ga0307412_10156990 3300031911 Bacteria 1685
309 Ga0307409_100263772 3300031995 Bacteria 1582
310 Ga0307409_100381715 3300031995 Bacteria 1340
311 Ga0307409_100435592 3300031995 Bacteria 1261
312 Ga0307416_100377358 3300032002 Bacteria 1447
313 Ga0307416_100659956 3300032002 Bacteria 1131
314 Ga0307414_10251137 3300032004 Bacteria 1470
315 Ga0307414_10320234 3300032004 Bacteria 1319
316 Ga0307411_10375570 3300032005 Bacteria 1167
317 Ga0307415_100338050 3300032126 Bacteria 1262
318 Ga0373938_0016032 3300034957 Unclassified 1459
319 Ga0373940_0041214 3300035088 Bacteria 1269
320 Ga0373951_0032122 3300035091 Unclassified 1240
321 Ga0373941_0099111 3300035115 Bacteria 1011
322 Ga0373957_0026784 3300035120 Bacteria 2089
323 Ga0373960_0052654 3300035121 Bacteria 1212
324 Ga0373946_0081764 3300035171 Bacteria 1415
325 Ga0373962_0024694 3300035242 Bacteria 1609
326 Ga0316574_0136328 3300035398 Bacteria 1580
327 Ga0373931_0198016 3300035691 Bacteria 1198
328 Ga0373935_0278708 3300035692 Bacteria 1177
329 Ga0373933_0157826 3300035724 Bacteria 1439
330 Ga0373947_0038523 3300035725 Bacteria 2840
331 Ga0316584_0271051 3300036712 Bacteria 1235
332 Ga0395900_0298271 3300037418 Unclassified 1599
333 Ga0395898_0476563 3300037466 Bacteria 1187
334 Ga0436364_0149593 3300037853 Bacteria 1984
335 Ga0436364_1376026 3300037853 Bacteria 2499
336 Ga0395901_0378525 3300038443 Bacteria 1457
337 Ga0436365_1028603 3300039437 Bacteria 1379
338 Ga0436360_0045902 3300039438 Bacteria 3392
339 Ga0436361_0574273 3300039447 Bacteria 1387
340 Ga0436361_0796747 3300039447 Bacteria 1292
341 Ga0436361_1038217 3300039447 Bacteria 3955
342 Ga0436361_1074974 3300039447 Bacteria 20661
343 Ga0436363_1038879 3300039450 Bacteria 1351
344 Ga0436363_1362647 3300039450 Bacteria 2174
345 Ga0436363_1687244 3300039450 Bacteria 1307
346 Ga0436362_0267641 3300039453 Bacteria 2246
347 Ga0439465_0056774 3300041413 Bacteria 1291
348 Ga0451802_1797938 3300041460 Bacteria 1711
349 Ga0451804_0731619 3300041463 Bacteria 1591
350 Ga0451835_1035077 3300041492 Bacteria 1239
351 Ga0451845_0165222 3300041501 Bacteria 949
352 Ga0451849_1105039 3300041505 Bacteria 1610
353 Ga0451851_0502050 3300041507 Bacteria 1479
354 Ga0451853_2160327 3300041512 Bacteria 1137
355 Ga0439431_0004659 3300041997 Bacteria 3015
356 Ga0439433_0038775 3300041999 Bacteria 1106
357 Ga0439448_0030952 3300042005 Bacteria 1699
358 Ga0439450_027648 3300042008 Bacteria 1257
359 Ga0439455_0034155 3300042012 Bacteria 1278
360 Ga0450920_025466 3300042122 Bacteria 1152
361 Ga0450923_022497 3300042125 Bacteria 1236
362 Ga0450898_011205 3300042134 Bacteria 1464
363 Ga0450898_018112 3300042134 Bacteria 1217
364 Ga0450900_012328 3300042136 Bacteria 1119
365 Ga0450905_014201 3300042142 Bacteria 1134
366 Ga0439458_0036715 3300042157 Bacteria 1180
367 Ga0439435_0061777 3300042436 Bacteria 1093
368 Ga0439459_0011162 3300042438 Bacteria 1579
369 Ga0439459_0022331 3300042438 Bacteria 1224
370 Ga0466969_0113651 3300044656 Unclassified 1265
371 Ga0466969_0124571 3300044656 Bacteria 1198
372 Ga0453683_0197391 3300044673 Unclassified 1277
373 Ga0466965_0093766 3300044683 Bacteria 1529
374 Ga0466965_0119607 3300044683 Bacteria 1359
375 Ga0466965_0151701 3300044683 Bacteria 1211
376 Ga0466966_0005163 3300044684 Bacteria 8581
377 Ga0466966_0038978 3300044684 Bacteria 3060
378 Ga0466966_0089807 3300044684 Bacteria 1908
379 Ga0466966_0231196 3300044684 Bacteria 1115
380 Ga0466961_0154206 3300044693 Unclassified 1433
381 Ga0466961_0165161 3300044693 Bacteria 1378
382 Ga0466961_0204573 3300044693 Bacteria 1220
383 Ga0466963_0146685 3300044694 Bacteria 1637
384 Ga0466963_0184377 3300044694 Bacteria 1457
385 Ga0466963_0184855 3300044694 Bacteria 1455
386 Ga0466963_0313638 3300044694 Bacteria 1103
387 Ga0466964_0029290 3300044706 Bacteria 2173
388 Ga0466964_0048314 3300044706 Bacteria 1739
389 Ga0466964_0150007 3300044706 Bacteria 1080
390 Ga0466971_0082483 3300044719 Bacteria 1467
391 Ga0466971_0110796 3300044719 Bacteria 1266
392 Ga0466971_0111150 3300044719 Unclassified 1264
393 Ga0466971_0122288 3300044719 Bacteria 1205
394 Ga0466971_0134709 3300044719 Bacteria 1148
395 Ga0466971_0142024 3300044719 Bacteria 1118
396 Ga0466968_0116756 3300044735 Bacteria 1204
397 Ga0466970_0164369 3300044765 Bacteria 1228
398 Ga0466957_0048963 3300044842 Bacteria 2568
399 Ga0466957_0178922 3300044842 Bacteria 1384
400 Ga0466957_0226018 3300044842 Bacteria 1237
401 Ga0466957_0239002 3300044842 Bacteria 1204
402 Ga0466957_0259570 3300044842 Bacteria 1157
403 Ga0466960_0126373 3300044901 Bacteria 1344
404 Ga0466960_0145381 3300044901 Unclassified 1262
405 Ga0466959_0087626 3300045049 Unclassified 2239
406 Ga0466959_0159662 3300045049 Bacteria 1585
407 Ga0466959_0226111 3300045049 Bacteria 1296
408 Ga0466959_0248413 3300045049 Bacteria 1227
409 Ga0466959_0280243 3300045049 Bacteria 1144
410 Ga0466959_0285780 3300045049 Bacteria 1131
411 Ga0466958_0247166 3300045836 Bacteria 1140
412 Ga0466967_0117186 3300045976 Bacteria 2455
413 Ga0466967_0484851 3300045976 Bacteria 1211
414 Ga0466967_0500503 3300045976 Bacteria 1192
415 Ga0466967_0510483 3300045976 Bacteria 1180
416 Ga0466967_0786732 3300045976 Bacteria 944
417 Ga0495641_0122493 3300046461 Bacteria 1160
418 Ga0495639_0131685 3300046475 Bacteria 1197
419 Ga0495664_0217610 3300046477 Bacteria 1156
420 Ga0495585_0129399 3300046492 Bacteria 1330
421 Ga0495594_0181525 3300046499 Bacteria 1198
422 Ga0495596_0094071 3300046500 Bacteria 1163
423 Ga0495606_0164360 3300046507 Bacteria 1293
424 Ga0495608_0154380 3300046511 Bacteria 1462
425 Ga0495618_0197879 3300046514 Bacteria 1272
426 Ga0495628_0165429 3300046516 Bacteria 1679
427 Ga0495630_0165527 3300046517 Bacteria 1683
428 Ga0495644_0077692 3300046523 Bacteria 1251
429 Ga0495640_0118074 3300046533 Bacteria 1726
430 Ga0495586_0150881 3300046535 Bacteria 1307
431 Ga0495598_0055005 3300046537 Bacteria 1210
432 Ga0495597_0097265 3300046542 Bacteria 1244
433 Ga0495645_0234648 3300046543 Bacteria 1227
434 Ga0495622_0066326 3300046557 Bacteria 1668
435 Ga0495622_0138575 3300046557 Bacteria 1105
436 Ga0495667_0201921 3300046559 Bacteria 1272
437 Ga0495668_0159538 3300046616 Bacteria 1235
438 Ga0495634_0113980 3300046642 Bacteria 1736
439 Ga0495647_0060865 3300046681 Bacteria 1489
440 Ga0495658_0172120 3300046683 Bacteria 1340
441 Ga0495670_0168077 3300046691 Bacteria 1154
442 Ga0495671_0145091 3300046692 Bacteria 1156
443 Ga0495604_0243592 3300047317 Bacteria 1228
444 Ga0495674_0339291 3300047319 Bacteria 1221
445 Ga0495676_0299081 3300047321 Bacteria 1086
446 Ga0495680_0257331 3300047322 Bacteria 1235
447 Ga0495677_0088440 3300047445 Bacteria 1166
448 Ga0495685_082917 3300047447 Bacteria 1067
449 Ga0495684_0264373 3300047471 Bacteria 1247
450 Ga0495686_0200728 3300047472 Bacteria 1145
451 Ga0495593_0147382 3300047673 Bacteria 1191
452 Ga0495615_0020971 3300048090 Bacteria 1470
453 Ga0495615_0028661 3300048090 Bacteria 1315
454 Ga0496100_0092034 3300048903 Bacteria 2071
455 Ga0496100_0171416 3300048903 Bacteria 1563
456 Ga0496101_0331443 3300048904 Bacteria 1195
457 Ga0496101_0363678 3300048904 Bacteria 1137
458 Ga0496103_0236155 3300048906 Bacteria 1176
459 Ga0496103_0243306 3300048906 Bacteria 1157
460 Ga0496106_0310309 3300048909 Bacteria 1265
461 Ga0496106_0312347 3300048909 Bacteria 1261
462 Ga0496108_0401804 3300048911 Bacteria 1196
463 Ga0496109_0238701 3300048912 Bacteria 1710
464 Ga0496110_0347406 3300048913 Bacteria 1351
465 Ga0496111_0299258 3300048914 Bacteria 1192
466 Ga0496112_0219285 3300048915 Bacteria 1858
467 Ga0496112_0350160 3300048915 Bacteria 1419
468 Ga0496112_0415377 3300048915 Bacteria 1284
469 Ga0496113_0212167 3300048916 Bacteria 1541
470 Ga0496113_0276785 3300048916 Bacteria 1341
471 Ga0496114_0303144 3300048917 Bacteria 1410
472 Ga0496114_0355981 3300048917 Bacteria 1295
473 Ga0496115_0348309 3300048918 Bacteria 1208
474 Ga0496126_0287233 3300048929 Bacteria 1361
475 Ga0501071_0349563 3300049587 Bacteria 1125
476 Ga0501045_0215518 3300049824 Bacteria 1430
477 nmdc:mga09592_426124_c1 3300050508 Bacteria 1146
478 nmdc:mga08y16_495073_c1 3300050511 Bacteria 1243
479 nmdc:mga08y16_527103_c1 3300050511 Bacteria 1198
480 nmdc:mga0rr50_328073_c1 3300050513 Bacteria 1284
481 nmdc:mga0rr50_377091_c1 3300050513 Bacteria 1196
482 Ga0500566_0127088 3300053094 Bacteria 1368
483 Ga0590071_027495 3300059421 Bacteria 1350
484 Ga0466962_0064617 3300061719 Unclassified 1747
485 Ga0466962_0100539 3300061719 Unclassified 1388
486 Ga0466962_0114234 3300061719 Bacteria 1301
487 Ga0466962_0119069 3300061719 Bacteria 1273
488 Ga0466962_0131073 3300061719 Bacteria 1211
489 Ga0466962_0133774 3300061719 Bacteria 1199
490 2509073544 2508501114 Bacteria 7082538
491 2835313513 2835312727 Bacteria 7413381
492 2835316411 2835312727 Bacteria 7413381
493 2835318099 2835312727 Bacteria 7413381
494 2835318955 2835312727 Bacteria 7413381
495 2894234234 2894232714 Bacteria 8834183
496 2894242066 2894232714 Bacteria 8834183
497 Ga0207708_10165984
498 JGI24752J21851_1011272
499 JGI24746J21847_1013394
500 JGI24747J21853_1005890
501 JGI24740J21852_10054114
502 JGI24743J22301_10023949
503 JGI24743J22301_10025989
504 JGI24743J22301_10026551
505 JGI24750J21931_1012328
506 JGI24745J21846_1007515
507 JGI24745J21846_1008893
508 JGI24745J21846_1008921
509 JGI24748J21848_1008765
510 JGI24738J21930_10028754
511 JGI24749J21850_1012248
512 JGI24033J26618_1009419
513 rootH2_10252118
514 Ga0065712_10022068
515 Ga0065715_10192191
516 Ga0070658_10304325
517 Ga0070658_10328123
518 Ga0070676_10187179
519 Ga0070683_100382936
520 Ga0070683_100433800
521 Ga0070670_100455986
522 Ga0070677_10054869
523 Ga0070666_10129630
524 Ga0070680_100312058
525 Ga0070682_100119283
526 Ga0068868_100281941
527 Ga0070660_100251499
528 Ga0070689_100190157
529 Ga0070691_10113826
530 Ga0070687_100122274
531 Ga0070692_10102018
532 Ga0070668_100199948
533 Ga0070668_100293557
534 Ga0070669_100260159
535 Ga0070669_100399169
536 Ga0070675_100188238
537 Ga0070675_100367512
538 Ga0070675_100475558
539 Ga0070674_100128291
540 Ga0070674_100193358
541 Ga0070674_100203728
542 Ga0070688_100206018
543 Ga0070659_100295502
544 Ga0070659_100309947
545 Ga0070659_100360982
546 Ga0070667_100496341
547 Ga0070709_10174799
548 Ga0070714_100374781
549 Ga0070714_100377013
550 Ga0070713_100450615
551 Ga0070710_10148990
552 Ga0070701_10140289
553 Ga0070711_100394891
554 Ga0070700_100226284
555 Ga0070694_100265919
556 Ga0070663_100235807
557 Ga0070678_100231824
558 Ga0070678_100283232
559 Ga0070678_100294315
560 Ga0070662_100137773
561 Ga0070662_100205831
562 Ga0068867_100203896
563 Ga0068867_100429883
564 Ga0070685_10174764
565 Ga0070685_10200597
566 Ga0070679_100395252
567 Ga0070679_100459647
568 Ga0070684_100128038
569 Ga0070684_100209308
570 Ga0070684_100234659
571 Ga0070672_100312336
572 Ga0070672_100373660
573 Ga0070686_100159924
574 Ga0070686_100175566
575 Ga0070696_100202796
576 Ga0070693_100070439
577 Ga0070693_100091142
578 Ga0070693_100239997
579 Ga0070665_100422142
580 Ga0070665_100436522
581 Ga0068855_100440856
582 Ga0068855_100515714
583 Ga0070664_100396576
584 Ga0070664_100463357
585 Ga0068854_100154064
586 Ga0068854_100242662
587 Ga0068854_100332811
588 Ga0068856_100126766
589 Ga0070702_100221370
590 Ga0068852_100382229
591 Ga0068859_100330119
592 Ga0068859_100613726
593 Ga0068864_100291875
594 Ga0068866_10129007
595 Ga0068861_100257833
596 Ga0068851_10129506
597 Ga0068851_10185990
598 Ga0068870_10093060
599 Ga0068870_10156674
600 Ga0068863_100565421
601 Ga0068858_100420375
602 Ga0068860_100426341
603 Ga0068860_100545553
604 Ga0068862_100333888
605 Ga0068862_100430205
606 Ga0081538_10120975
607 Ga0081538_10122840
608 Ga0081538_10129218
609 Ga0081539_10017390
610 Ga0070717_10242279
611 Ga0075432_10065251
612 Ga0068871_100465243
613 Ga0075433_10447260
614 Ga0075434_100522090
615 Ga0097620_100330107
616 Ga0097620_100613775
617 Ga0075435_100342794
618 Ga0105250_10070602
619 Ga0105240_10496301
620 Ga0111539_10377833
621 Ga0111539_10468955
622 Ga0105247_10161173
623 Ga0105243_10238806
624 Ga0105243_10391838
625 Ga0105243_10450138
626 Ga0105242_10245721
627 Ga0105237_10411111
628 Ga0105238_10377307
629 Ga0105249_10280855
630 Ga0105239_10485601
631 Ga0105246_10246507
632 Ga0105246_10293588
633 Ga0157319_1000983
634 Ga0157339_1001183
635 Ga0157338_1002607
636 Ga0157373_10160387
637 Ga0157373_10195506
638 Ga0157371_10212921
639 Ga0157370_10203895
640 Ga0157370_10439101
641 Ga0157369_10236702
642 Ga0157369_10430324
643 Ga0157374_10385203
644 Ga0157378_10364300
645 Ga0163162_10446746
646 Ga0163162_10487146
647 Ga0163162_10567086
648 Ga0157375_10459363
649 Ga0163163_10445370
650 Ga0157380_10068566
651 Ga0182008_10092842
652 Ga0157377_10107810
653 Ga0157377_10171107
654 Ga0157379_10158906
655 Ga0157379_10380148
656 Ga0163161_10230707
657 Ga0163161_10238351
658 Ga0206353_11780671
659 Ga0213873_10035291
660 Ga0213872_10102699
661 Ga0213874_10064843
662 Ga0213876_10137879
663 Ga0213876_10169730
664 Ga0207666_1010912
665 Ga0209025_1001215
666 Ga0207697_10089682
667 Ga0207656_10103762
668 Ga0207656_10136447
669 Ga0207653_10064083
670 Ga0207710_10115972
671 Ga0207688_10024267
672 Ga0207688_10058810
673 Ga0207688_10103239
674 Ga0207688_10165400
675 Ga0207680_10128401
676 Ga0207647_10165936
677 Ga0207699_10284347
678 Ga0207645_10156145
679 Ga0207643_10029733
680 Ga0207643_10177528
681 Ga0207707_10417835
682 Ga0207671_10284435
683 Ga0207693_10165840
684 Ga0207693_10168218
685 Ga0207663_10148895
686 Ga0207660_10344085
687 Ga0207657_10197370
688 Ga0207681_10263776
689 Ga0207681_10272416
690 Ga0207681_10357390
691 Ga0207659_10230973
692 Ga0207659_10389021
693 Ga0207700_10437330
694 Ga0207644_10263609
695 Ga0207644_10364172
696 Ga0207690_10274951
697 Ga0207690_10325692
698 Ga0207690_10346770
699 Ga0207706_10094452
700 Ga0207706_10298153
701 Ga0207706_10316600
702 Ga0207686_10234685
703 Ga0207670_10350269
704 Ga0207670_10350917
705 Ga0207669_10208786
706 Ga0207669_10281006
707 Ga0207669_10321088
708 Ga0207704_10275477
709 Ga0207704_10315216
710 Ga0207665_10118851
711 Ga0207691_10308652
712 Ga0207689_10396341
713 Ga0207661_10344433
714 Ga0207661_10373552
715 Ga0207661_10406253
716 Ga0207661_10431819
717 Ga0207679_10371826
718 Ga0207667_10453604
719 Ga0207651_10397443
720 Ga0207712_10391572
721 Ga0207712_10398830
722 Ga0207668_10385822
723 Ga0207668_10403209
724 Ga0207668_10415597
725 Ga0207640_10139626
726 Ga0207640_10140013
727 Ga0207640_10155285
728 Ga0207640_10376406
729 Ga0207658_10415975
730 Ga0207677_10103826
731 Ga0207677_10383992
732 Ga0207677_10400995
733 Ga0207703_10422647
734 Ga0207703_10462841
735 Ga0207703_10481143
736 Ga0207703_10647537
737 Ga0207639_10422578
738 Ga0207639_10479664
739 Ga0207708_10099371
740 Ga0207702_10489177
741 Ga0207641_10498220
742 Ga0207648_10176190
743 Ga0207648_10272958
744 Ga0207676_10102654
745 Ga0207676_10463082
746 Ga0207675_100180414
747 Ga0207683_10386143
748 Ga0207683_10390528
749 Ga0207683_10427899
750 Ga0207698_10296091
751 Ga0207698_10524718
752 Ga0207698_10552054
753 Ga0209996_1009959
754 Ga0209984_1008166
755 Ga0210002_1016884
756 Ga0209966_1025856
757 Ga0207428_10311794
758 Ga0207428_10324517
759 Ga0268266_10325157
760 Ga0268266_10477911
761 Ga0268266_10484337
762 Ga0268266_10502661
763 Ga0268265_10469218
764 Ga0268265_10478957
765 Ga0268264_10305022
766 Ga0268264_10341870
767 Ga0268264_10454236
768 Ga0268264_10516235
769 Ga0265323_10062585
770 Ga0265323_10070882
771 Ga0265322_10010927
772 Ga0265322_10044825
773 Ga0265322_10045883
774 Ga0307515_10317116
775 Ga0265324_10015260
776 Ga0265330_10050992
777 Ga0265330_10074878
778 Ga0265332_10117716
779 Ga0265328_10092499
780 Ga0265320_10057746
781 Ga0265325_10040698
782 Ga0265329_10030731
783 Ga0265329_10055537
784 Ga0265340_10038844
785 Ga0265340_10104395
786 Ga0265339_10032289
787 Ga0265331_10136559
788 Ga0265327_10027830
789 Ga0265316_10170343
790 Ga0265316_10304447
791 Ga0265316_10324636
792 Ga0265313_10080440
793 Ga0316575_10063822
794 Ga0316579_10100114
795 Ga0265314_10217450
796 Ga0265342_10039510
797 Ga0265342_10170059
798 Ga0316578_10029433
799 Ga0307410_10054855
800 Ga0326468_10000793
801 Ga0326468_10003752
802 Ga0326468_10004674
803 Ga0307406_10398053
804 Ga0307412_10156990
805 Ga0307409_100263772
806 Ga0307409_100381715
807 Ga0307409_100435592
808 Ga0307416_100377358
809 Ga0307416_100659956
810 Ga0307414_10251137
811 Ga0307414_10320234
812 Ga0307411_10375570
813 Ga0307415_100338050
814 Ga0373938_0016032
815 Ga0373940_0041214
816 Ga0373951_0032122
817 Ga0373941_0099111
818 Ga0373957_0026784
819 Ga0373960_0052654
820 Ga0373946_0081764
821 Ga0373962_0024694
822 Ga0316574_0136328
823 Ga0373931_0198016
824 Ga0373935_0278708
825 Ga0373933_0157826
826 Ga0373947_0038523
827 Ga0316584_0271051
828 Ga0395900_0298271
829 Ga0395898_0476563
830 Ga0436364_0149593
831 Ga0436364_1376026
832 Ga0395901_0378525
833 Ga0436365_1028603
834 Ga0436360_0045902
835 Ga0436361_0574273
836 Ga0436361_0796747
837 Ga0436361_1038217
838 Ga0436361_1074974
839 Ga0436363_1038879
840 Ga0436363_1362647
841 Ga0436363_1687244
842 Ga0436362_0267641
843 Ga0439465_0056774
844 Ga0451802_1797938
845 Ga0451804_0731619
846 Ga0451835_1035077
847 Ga0451845_0165222
848 Ga0451849_1105039
849 Ga0451851_0502050
850 Ga0451853_2160327
851 Ga0439431_0004659
852 Ga0439433_0038775
853 Ga0439448_0030952
854 Ga0439450_027648
855 Ga0439455_0034155
856 Ga0450920_025466
857 Ga0450923_022497
858 Ga0450898_011205
859 Ga0450898_018112
860 Ga0450900_012328
861 Ga0450905_014201
862 Ga0439458_0036715
863 Ga0439435_0061777
864 Ga0439459_0011162
865 Ga0439459_0022331
866 Ga0466969_0113651
867 Ga0466969_0124571
868 Ga0453683_0197391
869 Ga0466965_0093766
870 Ga0466965_0119607
871 Ga0466965_0151701
872 Ga0466966_0005163
873 Ga0466966_0038978
874 Ga0466966_0089807
875 Ga0466966_0231196
876 Ga0466961_0154206
877 Ga0466961_0165161
878 Ga0466961_0204573
879 Ga0466963_0146685
880 Ga0466963_0184377
881 Ga0466963_0184855
882 Ga0466963_0313638
883 Ga0466964_0029290
884 Ga0466964_0048314
885 Ga0466964_0150007
886 Ga0466971_0082483
887 Ga0466971_0110796
888 Ga0466971_0111150
889 Ga0466971_0122288
890 Ga0466971_0134709
891 Ga0466971_0142024
892 Ga0466968_0116756
893 Ga0466970_0164369
894 Ga0466957_0048963
895 Ga0466957_0178922
896 Ga0466957_0226018
897 Ga0466957_0239002
898 Ga0466957_0259570
899 Ga0466960_0126373
900 Ga0466960_0145381
901 Ga0466959_0087626
902 Ga0466959_0159662
903 Ga0466959_0226111
904 Ga0466959_0248413
905 Ga0466959_0280243
906 Ga0466959_0285780
907 Ga0466958_0247166
908 Ga0466967_0117186
909 Ga0466967_0484851
910 Ga0466967_0500503
911 Ga0466967_0510483
912 Ga0466967_0786732
913 Ga0495641_0122493
914 Ga0495639_0131685
915 Ga0495664_0217610
916 Ga0495585_0129399
917 Ga0495594_0181525
918 Ga0495596_0094071
919 Ga0495606_0164360
920 Ga0495608_0154380
921 Ga0495618_0197879
922 Ga0495628_0165429
923 Ga0495630_0165527
924 Ga0495644_0077692
925 Ga0495640_0118074
926 Ga0495586_0150881
927 Ga0495598_0055005
928 Ga0495597_0097265
929 Ga0495645_0234648
930 Ga0495622_0066326
931 Ga0495622_0138575
932 Ga0495667_0201921
933 Ga0495668_0159538
934 Ga0495634_0113980
935 Ga0495647_0060865
936 Ga0495658_0172120
937 Ga0495670_0168077
938 Ga0495671_0145091
939 Ga0495604_0243592
940 Ga0495674_0339291
941 Ga0495676_0299081
942 Ga0495680_0257331
943 Ga0495677_0088440
944 Ga0495685_082917
945 Ga0495684_0264373
946 Ga0495686_0200728
947 Ga0495593_0147382
948 Ga0495615_0020971
949 Ga0495615_0028661
950 Ga0496100_0092034
951 Ga0496100_0171416
952 Ga0496101_0331443
953 Ga0496101_0363678
954 Ga0496103_0236155
955 Ga0496103_0243306
956 Ga0496106_0310309
957 Ga0496106_0312347
958 Ga0496108_0401804
959 Ga0496109_0238701
960 Ga0496110_0347406
961 Ga0496111_0299258
962 Ga0496112_0219285
963 Ga0496112_0350160
964 Ga0496112_0415377
965 Ga0496113_0212167
966 Ga0496113_0276785
967 Ga0496114_0303144
968 Ga0496114_0355981
969 Ga0496115_0348309
970 Ga0496126_0287233
971 Ga0501071_0349563
972 Ga0501045_0215518
973 nmdc:mga09592_426124_c1
974 nmdc:mga08y16_495073_c1
975 nmdc:mga08y16_527103_c1
976 nmdc:mga0rr50_328073_c1
977 nmdc:mga0rr50_377091_c1
978 Ga0500566_0127088
979 Ga0590071_027495
980 Ga0466962_0064617
981 Ga0466962_0100539
982 Ga0466962_0114234
983 Ga0466962_0119069
984 Ga0466962_0131073
985 Ga0466962_0133774
986 2509073544
987 2835313513
988 2835316411
989 2835318099
990 2835318955
991 2894234234
992 2894242066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13358

DDE_3

DDE superfamily endonuclease

171

314

0.98

PF13518

HTH_28

Helix-turn-helix domain

17

68

0.97

PF13592

HTH_33

Winged helix-turn helix

98

157

0.97

PF13384

HTH_23

Homeodomain-like domain

12

61

0.94

PF13551

HTH_29

Winged helix-turn helix

18

81

0.89

PF13565

HTH_32

Homeodomain-like domain

45

128

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x6s-assembly2.cif.gz_C human foamy virus integrase - catalytic core. magnesium-bound structure. 0.7864 175 306
4mq3-assembly1.cif.gz_A the 1.1 angstrom structure of catalytic core domain of fiv integrase 0.7849 175 328
2x6n-assembly3.cif.gz_C human foamy virus integrase - catalytic core. manganese-bound structure. 0.7747 175 306
5jl4-assembly1.cif.gz_A inhibitor resistant mutant catalytic core domain of hiv-1 integrase 0.7607 175 322
4mq3-assembly1.cif.gz_A the 1.1 angstrom structure of catalytic core domain of fiv integrase 0.7582 175 328
ID Description Score Start End Superfamily
af_Q21972_79_144_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.875 13 60 1.10.10.10
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8061 175 325 3.30.420.10
4mq3A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7849 175 328 3.30.420.10
af_A0A2R8QDF6_1_153_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7789 175 316 3.30.420.10
af_P0CF56_119_291_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7682 175 326 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A6H1RB55-F1-model_v4 Transposase 0.9779 214 348 GO:0003676
AF-Q5GW53-F1-model_v4 Transposase 0.9757 216 348 GO:0003676
AF-A0A6M5YYN3-F1-model_v4 Mobile element protein 0.9725 216 348 GO:0003676
AF-R9J500-F1-model_v4 Tc1-like transposase DDE domain-containing protein 0.9675 216 346 GO:0003676
AF-A0A554X6F3-F1-model_v4 DDE superfamily endonuclease 0.9629 216 348 GO:0003676
GO:0004519

Map