F454862

General Info

Members Datasets Scaffolds Average Seq Length
496 279 496 334

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10120258|Ga0075364_101202581
Length 351
Sequence MAQATETQNGTGIDVVGVSKNFGDFLALQDVNLEVPNGSMTALLGPSGSGKSTLLRTIAGLEDPTAGRVLIGGEDQTRKPVRTRNVGFVFQHYAAFIAFGPKVRKWPKERVSERVYELLDLVQLSGLAKRYPSQLSGGQRQRMALARALAVEPSVLLLDEPFGALDAKVRKDLRTWLRRLHDEVHVTTIFVTHDQEEAMDIAEQIVVMNNGKIEQTGTASDLYDAPANEFVMGFVGEVNRLAGKLVRPHDVEIHTSAEADTVEAKIDRIVKLGFAGRVEMVTVNEHSEVWAQLTTSELDALNLTDGQLVFIRPKGDAVVKDDTGALDQLTEEENQTPDSDKPTAVTPGLPV

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
141 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
142 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
143 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
144 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
145 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
275 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
276 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0
Rhizoplane 9.07
Rhizosphere 88.51
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000010 3300001977 Bacteria 18578
2 JGI24748J21848_1000423 3300002074 Bacteria 4709
3 JGI24034J26672_10000194 3300002239 Bacteria 8135
4 Ga0070677_10000001 3300005333 Bacteria 118426
5 Ga0070666_10021720 3300005335 Bacteria 4160
6 Ga0070680_100061693 3300005336 Bacteria 3069
7 Ga0070682_100000028 3300005337 Bacteria 185177
8 Ga0070682_100000049 3300005337 Bacteria 127229
9 Ga0070682_100001860 3300005337 Bacteria 11772
10 Ga0070682_100188695 3300005337 Bacteria 1446
11 Ga0068868_100000261 3300005338 Bacteria 35848
12 Ga0068868_100004032 3300005338 Bacteria 10238
13 Ga0068868_100021305 3300005338 Bacteria 4881
14 Ga0070660_100048024 3300005339 Bacteria 3277
15 Ga0070689_100014641 3300005340 Bacteria 5702
16 Ga0070691_10000001 3300005341 Bacteria 94744
17 Ga0070691_10001179 3300005341 Bacteria 10941
18 Ga0070661_100000226 3300005344 Bacteria 46716
19 Ga0070692_10002161 3300005345 Bacteria 7532
20 Ga0070692_10033529 3300005345 Bacteria 2588
21 Ga0070668_100015913 3300005347 Bacteria 5627
22 Ga0070674_100000001 3300005356 Bacteria 277173
23 Ga0070674_100000022 3300005356 Bacteria 85839
24 Ga0070674_100024507 3300005356 Bacteria 3917
25 Ga0070674_100091805 3300005356 Bacteria 2194
26 Ga0070688_100000124 3300005365 Bacteria 41106
27 Ga0070688_100000345 3300005365 Bacteria 23573
28 Ga0070688_100001399 3300005365 Bacteria 12014
29 Ga0070688_100165978 3300005365 Bacteria 1520
30 Ga0070703_10017167 3300005406 Bacteria 2084
31 Ga0070709_10044107 3300005434 Bacteria 2760
32 Ga0070714_100035519 3300005435 Bacteria 4179
33 Ga0070713_100061024 3300005436 Bacteria 3154
34 Ga0070710_10003862 3300005437 Bacteria 7092
35 Ga0070701_10001269 3300005438 Bacteria 9261
36 Ga0070711_100011091 3300005439 Bacteria 5592
37 Ga0070711_100014451 3300005439 Bacteria 4975
38 Ga0070705_100057994 3300005440 Bacteria 2286
39 Ga0070700_100003142 3300005441 Bacteria 8485
40 Ga0070700_100007408 3300005441 Bacteria 5923
41 Ga0070663_100013431 3300005455 Bacteria 5223
42 Ga0070678_100004128 3300005456 Bacteria 8183
43 Ga0070662_100000007 3300005457 Bacteria 168761
44 Ga0068867_100000294 3300005459 Bacteria 32742
45 Ga0070685_10000025 3300005466 Bacteria 100621
46 Ga0070685_10000249 3300005466 Bacteria 35286
47 Ga0070685_10001901 3300005466 Bacteria 10854
48 Ga0070679_100002214 3300005530 Bacteria 17551
49 Ga0068853_100002403 3300005539 Bacteria 13996
50 Ga0068853_100018058 3300005539 Bacteria 5832
51 Ga0070672_100000087 3300005543 Bacteria 44462
52 Ga0070672_100007193 3300005543 Bacteria 7535
53 Ga0070686_100013351 3300005544 Bacteria 4700
54 Ga0070695_100156022 3300005545 Bacteria 1597
55 Ga0070696_100008544 3300005546 Bacteria 6853
56 Ga0070665_100000068 3300005548 Bacteria 204531
57 Ga0070665_100000783 3300005548 Bacteria 41826
58 Ga0070665_100006147 3300005548 Bacteria 12278
59 Ga0070665_100051760 3300005548 Bacteria 4118
60 Ga0070704_100010413 3300005549 Bacteria 5656
61 Ga0070704_100109314 3300005549 Bacteria 2101
62 Ga0068855_100116645 3300005563 Bacteria 3060
63 Ga0068854_100000090 3300005578 Bacteria 64443
64 Ga0068854_100043092 3300005578 Bacteria 3197
65 Ga0068856_100005720 3300005614 Bacteria 12246
66 Ga0068856_100019936 3300005614 Bacteria 6508
67 Ga0068856_100022995 3300005614 Bacteria 6060
68 Ga0070702_100017948 3300005615 Bacteria 3660
69 Ga0070702_100119791 3300005615 Bacteria 1646
70 Ga0068852_100000006 3300005616 Bacteria 159569
71 Ga0068852_100145787 3300005616 Bacteria 2196
72 Ga0068859_100017962 3300005617 Bacteria 7109
73 Ga0068864_100000023 3300005618 Bacteria 257064
74 Ga0068866_10000001 3300005718 Bacteria 519680
75 Ga0068866_10000140 3300005718 Bacteria 32464
76 Ga0068866_10002178 3300005718 Bacteria 8155
77 Ga0068866_10010556 3300005718 Bacteria 3965
78 Ga0068851_10001723 3300005834 Bacteria 9553
79 Ga0068851_10034037 3300005834 Bacteria 2542
80 Ga0068863_100001412 3300005841 Bacteria 23785
81 Ga0068863_100494086 3300005841 Bacteria 1204
82 Ga0068858_100000012 3300005842 Bacteria 216931
83 Ga0068858_100000131 3300005842 Bacteria 77960
84 Ga0068858_100062192 3300005842 Bacteria 3452
85 Ga0068860_100238950 3300005843 Bacteria 1767
86 Ga0068862_100083988 3300005844 Bacteria 2766
87 Ga0081455_10010784 3300005937 Bacteria 9234
88 Ga0081540_1066433 3300005983 Bacteria 1690
89 Ga0081539_10007678 3300005985 Bacteria 9693
90 Ga0081539_10024590 3300005985 Bacteria 3902
91 Ga0075364_10120258 3300006051 Bacteria 1758
92 Ga0070715_10000001 3300006163 Bacteria 693690
93 Ga0070712_100026218 3300006175 Bacteria 3880
94 Ga0068871_100008611 3300006358 Bacteria 7336
95 Ga0068871_100292947 3300006358 Bacteria 1427
96 Ga0075430_100004189 3300006846 Bacteria 12172
97 Ga0075430_100068981 3300006846 Bacteria 2967
98 Ga0075431_100197760 3300006847 Bacteria 2058
99 Ga0075433_10000597 3300006852 Bacteria 23988
100 Ga0075433_10101579 3300006852 Bacteria 2546
101 Ga0075433_10473184 3300006852 Bacteria 1104
102 Ga0075434_100083515 3300006871 Bacteria 3191
103 Ga0075429_100004148 3300006880 Bacteria 12395
104 Ga0068865_100000023 3300006881 Bacteria 100785
105 Ga0068865_100002979 3300006881 Bacteria 10103
106 Ga0075436_100246004 3300006914 Bacteria 1273
107 Ga0097620_100017962 3300006931 Bacteria 7109
108 Ga0075435_100110224 3300007076 Bacteria 2289
109 Ga0105245_10000662 3300009098 Bacteria 31191
110 Ga0105245_10006750 3300009098 Bacteria 10065
111 Ga0105245_10116421 3300009098 Bacteria 2492
112 Ga0114129_10020139 3300009147 Bacteria 9494
113 Ga0114129_10063935 3300009147 Bacteria 5135
114 Ga0114129_10069019 3300009147 Bacteria 4927
115 Ga0114129_10261070 3300009147 Bacteria 2321
116 Ga0105243_10006384 3300009148 Bacteria 9107
117 Ga0105243_10072865 3300009148 Bacteria 2781
118 Ga0105243_10095392 3300009148 Bacteria 2458
119 Ga0105241_10011135 3300009174 Bacteria 6595
120 Ga0105242_10000051 3300009176 Bacteria 79661
121 Ga0105242_10024571 3300009176 Bacteria 4760
122 Ga0105248_10000008 3300009177 Bacteria 403910
123 Ga0105248_10013117 3300009177 Bacteria 9125
124 Ga0105238_10000023 3300009551 Bacteria 196844
125 Ga0105249_10000074 3300009553 Bacteria 145235
126 Ga0105249_10024164 3300009553 Bacteria 5461
127 Ga0105239_10011666 3300010375 Bacteria 9808
128 Ga0105239_10124159 3300010375 Bacteria 2868
129 Ga0105246_10022109 3300011119 Bacteria 4101
130 Ga0157371_10013444 3300013102 Bacteria 6215
131 Ga0157370_10002517 3300013104 Bacteria 22034
132 Ga0157370_10083236 3300013104 Bacteria 3009
133 Ga0157370_10356390 3300013104 Bacteria 1348
134 Ga0157369_10000020 3300013105 Bacteria 241679
135 Ga0157374_10027488 3300013296 Bacteria 5134
136 Ga0157378_10009022 3300013297 Bacteria 8681
137 Ga0157378_10024717 3300013297 Bacteria 5289
138 Ga0163162_10016057 3300013306 Bacteria 7317
139 Ga0157372_10000253 3300013307 Bacteria 59272
140 Ga0157375_10000109 3300013308 Bacteria 80349
141 Ga0157375_10007058 3300013308 Bacteria 9813
142 Ga0157375_10020073 3300013308 Bacteria 6097
143 Ga0163163_10133411 3300014325 Bacteria 2524
144 Ga0157380_10000037 3300014326 Bacteria 80856
145 Ga0157380_10000487 3300014326 Bacteria 24132
146 Ga0157376_10009638 3300014969 Bacteria 7026
147 Ga0157376_10009684 3300014969 Bacteria 7012
148 Ga0163161_10000013 3300017792 Bacteria 258747
149 Ga0207656_10001124 3300025321 Bacteria 8785
150 Ga0207656_10011067 3300025321 Bacteria 3398
151 Ga0207653_10006060 3300025885 Bacteria 3769
152 Ga0207682_10000034 3300025893 Bacteria 56869
153 Ga0207692_10013980 3300025898 Bacteria 3496
154 Ga0207642_10000006 3300025899 Bacteria 230268
155 Ga0207642_10000007 3300025899 Bacteria 226017
156 Ga0207642_10002435 3300025899 Bacteria 5796
157 Ga0207642_10003589 3300025899 Bacteria 4920
158 Ga0207642_10003698 3300025899 Bacteria 4861
159 Ga0207680_10027702 3300025903 Bacteria 3160
160 Ga0207647_10017527 3300025904 Bacteria 4867
161 Ga0207685_10000011 3300025905 Bacteria 213430
162 Ga0207699_10031010 3300025906 Bacteria 2998
163 Ga0207654_10018008 3300025911 Bacteria 3703
164 Ga0207693_10000351 3300025915 Bacteria 42500
165 Ga0207663_10001227 3300025916 Bacteria 11833
166 Ga0207663_10024412 3300025916 Bacteria 3481
167 Ga0207660_10136448 3300025917 Bacteria 1872
168 Ga0207657_10006050 3300025919 Bacteria 12580
169 Ga0207649_10000009 3300025920 Bacteria 295544
170 Ga0207652_10002532 3300025921 Bacteria 15343
171 Ga0207652_10134941 3300025921 Bacteria 2203
172 Ga0207646_10110549 3300025922 Bacteria 2466
173 Ga0207694_10000004 3300025924 Bacteria 967075
174 Ga0207659_10000033 3300025926 Bacteria 113729
175 Ga0207687_10000007 3300025927 Bacteria 604185
176 Ga0207687_10000026 3300025927 Bacteria 173968
177 Ga0207687_10000055 3300025927 Bacteria 88382
178 Ga0207687_10002371 3300025927 Bacteria 12795
179 Ga0207687_10046767 3300025927 Bacteria 2997
180 Ga0207700_10045579 3300025928 Bacteria 3237
181 Ga0207690_10001511 3300025932 Bacteria 14543
182 Ga0207706_10000018 3300025933 Bacteria 168729
183 Ga0207706_10127402 3300025933 Bacteria 2239
184 Ga0207686_10000083 3300025934 Bacteria 79869
185 Ga0207686_10007376 3300025934 Bacteria 5919
186 Ga0207686_10029784 3300025934 Bacteria 3225
187 Ga0207709_10001209 3300025935 Bacteria 18555
188 Ga0207709_10129308 3300025935 Bacteria 1718
189 Ga0207670_10050657 3300025936 Bacteria 2784
190 Ga0207670_10051024 3300025936 Bacteria 2775
191 Ga0207669_10000002 3300025937 Bacteria 377651
192 Ga0207669_10000009 3300025937 Bacteria 168012
193 Ga0207704_10000068 3300025938 Bacteria 65896
194 Ga0207704_10001860 3300025938 Bacteria 9446
195 Ga0207691_10000382 3300025940 Bacteria 44447
196 Ga0207691_10014505 3300025940 Bacteria 7515
197 Ga0207711_10000006 3300025941 Bacteria 792692
198 Ga0207711_10057111 3300025941 Bacteria 3355
199 Ga0207661_10000056 3300025944 Bacteria 85250
200 Ga0207661_10002003 3300025944 Bacteria 14030
201 Ga0207679_10062460 3300025945 Bacteria 2776
202 Ga0207667_10245735 3300025949 Bacteria 1831
203 Ga0207712_10000007 3300025961 Bacteria 539589
204 Ga0207712_10004322 3300025961 Bacteria 8972
205 Ga0207668_10012936 3300025972 Bacteria 5125
206 Ga0207640_10000178 3300025981 Bacteria 46342
207 Ga0207640_10034810 3300025981 Bacteria 3147
208 Ga0207658_10028847 3300025986 Bacteria 3912
209 Ga0207677_10000046 3300026023 Bacteria 105382
210 Ga0207677_10001380 3300026023 Bacteria 12957
211 Ga0207703_10000111 3300026035 Bacteria 96592
212 Ga0207703_10000310 3300026035 Bacteria 52770
213 Ga0207703_10051697 3300026035 Bacteria 3332
214 Ga0207639_10004273 3300026041 Bacteria 9633
215 Ga0207639_10007912 3300026041 Bacteria 7264
216 Ga0207639_10131956 3300026041 Bacteria 2069
217 Ga0207678_10021211 3300026067 Bacteria 5695
218 Ga0207708_10000515 3300026075 Bacteria 29848
219 Ga0207702_10000158 3300026078 Bacteria 79984
220 Ga0207702_10002069 3300026078 Bacteria 19408
221 Ga0207702_10015866 3300026078 Bacteria 6238
222 Ga0207702_10109523 3300026078 Bacteria 2453
223 Ga0207641_10000170 3300026088 Bacteria 91128
224 Ga0207641_10001999 3300026088 Bacteria 19452
225 Ga0207648_10000637 3300026089 Bacteria 39335
226 Ga0207648_10004975 3300026089 Bacteria 13515
227 Ga0207676_10000025 3300026095 Bacteria 261714
228 Ga0207683_10002177 3300026121 Bacteria 17208
229 Ga0207683_10006812 3300026121 Bacteria 9784
230 Ga0207698_10000013 3300026142 Bacteria 255414
231 Ga0207698_10067244 3300026142 Bacteria 2825
232 Ga0268266_10000020 3300028379 Bacteria 527065
233 Ga0268266_10000406 3300028379 Bacteria 65477
234 Ga0268266_10047348 3300028379 Bacteria 3683
235 Ga0268264_10010337 3300028381 Bacteria 7720
236 Ga0265337_1000011 3300028556 Bacteria 87087
237 Ga0265326_10000063 3300028558 Bacteria 61665
238 Ga0265319_1000020 3300028563 Bacteria 153921
239 Ga0265334_10027990 3300028573 Bacteria 2268
240 Ga0265322_10000001 3300028654 Bacteria 543854
241 Ga0265336_10004194 3300028666 Bacteria 5485
242 Ga0265338_10000222 3300028800 Bacteria 105765
243 Ga0265324_10001878 3300029957 Bacteria 11310
244 Ga0265320_10000002 3300031240 Bacteria 542875
245 Ga0265325_10021261 3300031241 Bacteria 3568
246 Ga0265329_10006318 3300031242 Bacteria 4709
247 Ga0265331_10001337 3300031250 Bacteria 18236
248 Ga0265327_10000011 3300031251 Bacteria 543807
249 Ga0265313_10027368 3300031595 Bacteria 2985
250 Ga0265314_10000062 3300031711 Bacteria 159496
251 Ga0316576_10127254 3300031727 Bacteria 1915
252 Ga0307405_10068525 3300031731 Bacteria 2271
253 Ga0307415_100008149 3300032126 Bacteria 5792
254 Ga0373937_0085726 3300036401 Bacteria 2915
255 Ga0316584_0029996 3300036712 Bacteria 4017
256 Ga0395899_0010077 3300037312 Bacteria 7245
257 Ga0395900_0005524 3300037418 Bacteria 13238
258 Ga0395900_0032995 3300037418 Bacteria 5328
259 Ga0395898_0054281 3300037466 Bacteria 3911
260 Ga0395898_0054957 3300037466 Bacteria 3884
261 Ga0395898_0169179 3300037466 Bacteria 2089
262 Ga0395905_0028154 3300037471 Bacteria 5296
263 Ga0395905_0150948 3300037471 Bacteria 2186
264 Ga0395901_0012891 3300038443 Bacteria 8478
265 Ga0395901_0021037 3300038443 Bacteria 6683
266 Ga0466963_0000062 3300044694 Bacteria 36386
267 Ga0466963_0074972 3300044694 Bacteria 2283
268 Ga0466957_0069941 3300044842 Bacteria 2169
269 Ga0466967_0211855 3300045976 Bacteria 1838
270 Ga0466967_0287017 3300045976 Bacteria 1580
271 Ga0495592_0004272 3300046454 Bacteria 10445
272 Ga0495603_0000005 3300046455 Bacteria 75902
273 Ga0495603_0015523 3300046455 Bacteria 4610
274 Ga0495629_0000919 3300046459 Bacteria 23655
275 Ga0495629_0212431 3300046459 Bacteria 1336
276 Ga0495641_0000003 3300046461 Bacteria 242879
277 Ga0495653_0008533 3300046463 Bacteria 8404
278 Ga0495653_0038009 3300046463 Bacteria 3779
279 Ga0495582_0000023 3300046473 Bacteria 83274
280 Ga0495662_0000036 3300046476 Bacteria 44993
281 Ga0495662_0015833 3300046476 Bacteria 3660
282 Ga0495594_0000107 3300046499 Bacteria 38765
283 Ga0495606_0000072 3300046507 Bacteria 173678
284 Ga0495608_0000060 3300046511 Bacteria 88189
285 Ga0495608_0001623 3300046511 Bacteria 16129
286 Ga0495618_0000053 3300046514 Bacteria 84115
287 Ga0495628_0001375 3300046516 Bacteria 22311
288 Ga0495628_0010707 3300046516 Bacteria 7767
289 Ga0495628_0178817 3300046516 Bacteria 1605
290 Ga0495628_0229163 3300046516 Bacteria 1393
291 Ga0495630_0000560 3300046517 Bacteria 27056
292 Ga0495630_0002335 3300046517 Bacteria 13198
293 Ga0495644_0000995 3300046523 Bacteria 11795
294 Ga0495652_0000171 3300046529 Bacteria 74097
295 Ga0495652_0003006 3300046529 Bacteria 16917
296 Ga0495652_0209827 3300046529 Bacteria 1471
297 Ga0495640_0004258 3300046533 Bacteria 11437
298 Ga0495640_0014786 3300046533 Bacteria 5895
299 Ga0495587_0000574 3300046536 Bacteria 25248
300 Ga0495587_0033218 3300046536 Bacteria 3116
301 Ga0495621_0042048 3300046539 Bacteria 1607
302 Ga0495645_0016051 3300046543 Bacteria 5339
303 Ga0495645_0038005 3300046543 Bacteria 3510
304 Ga0495622_0000259 3300046557 Bacteria 40357
305 Ga0495667_0000018 3300046559 Bacteria 188610
306 Ga0495656_0000290 3300046615 Bacteria 17454
307 Ga0495634_0000193 3300046642 Bacteria 56072
308 Ga0495634_0001330 3300046642 Bacteria 22503
309 Ga0495634_0025203 3300046642 Bacteria 4167
310 Ga0495635_0000042 3300046663 Bacteria 84550
311 Ga0495588_0000134 3300046674 Bacteria 117581
312 Ga0495657_0000004 3300046675 Bacteria 266465
313 Ga0495657_0004865 3300046675 Bacteria 10693
314 Ga0495647_0000019 3300046681 Bacteria 78887
315 Ga0495658_0000021 3300046683 Bacteria 83269
316 Ga0495658_0006767 3300046683 Bacteria 5641
317 Ga0495669_0001196 3300046684 Bacteria 10785
318 Ga0495613_0000042 3300046689 Bacteria 130403
319 Ga0495613_0000197 3300046689 Bacteria 59091
320 Ga0495613_0050419 3300046689 Bacteria 3069
321 Ga0495624_0000030 3300046690 Bacteria 91755
322 Ga0495670_0002313 3300046691 Bacteria 9417
323 Ga0495649_0085529 3300046694 Bacteria 1683
324 Ga0495600_0000282 3300046809 Bacteria 27447
325 Ga0495600_0014415 3300046809 Bacteria 4982
326 Ga0495604_0000055 3300047317 Bacteria 100430
327 Ga0495604_0000155 3300047317 Bacteria 60014
328 Ga0495604_0068840 3300047317 Bacteria 2685
329 Ga0495674_0000029 3300047319 Bacteria 118854
330 Ga0495676_0000903 3300047321 Bacteria 24846
331 Ga0495676_0013738 3300047321 Bacteria 7264
332 Ga0495680_0000094 3300047322 Bacteria 80355
333 Ga0495680_0000352 3300047322 Bacteria 51468
334 Ga0495680_0179663 3300047322 Bacteria 1528
335 Ga0495675_0000040 3300047444 Bacteria 86266
336 Ga0495675_0140960 3300047444 Bacteria 1494
337 Ga0495685_051098 3300047447 Bacteria 1402
338 Ga0495593_0023569 3300047673 Bacteria 3420
339 Ga0495602_0000070 3300048088 Bacteria 100656
340 Ga0495602_0000533 3300048088 Bacteria 35335
341 Ga0495602_0036615 3300048088 Bacteria 4565
342 Ga0496100_0000005 3300048903 Bacteria 312112
343 Ga0496100_0000007 3300048903 Bacteria 261266
344 Ga0496100_0057195 3300048903 Bacteria 2553
345 Ga0496101_0000013 3300048904 Bacteria 261266
346 Ga0496101_0000022 3300048904 Bacteria 216728
347 Ga0496101_0010052 3300048904 Bacteria 6236
348 Ga0496104_0000013 3300048907 Bacteria 397163
349 Ga0496104_0000190 3300048907 Bacteria 55572
350 Ga0496104_0080903 3300048907 Bacteria 3097
351 Ga0496105_0000006 3300048908 Bacteria 393578
352 Ga0496105_0000197 3300048908 Bacteria 40456
353 Ga0496105_0038384 3300048908 Bacteria 3945
354 Ga0496105_0079460 3300048908 Bacteria 2709
355 Ga0496106_0000006 3300048909 Bacteria 251855
356 Ga0496106_0000333 3300048909 Bacteria 33134
357 Ga0496106_0025730 3300048909 Bacteria 4380
358 Ga0496107_0000007 3300048910 Bacteria 257113
359 Ga0496107_0000011 3300048910 Bacteria 201631
360 Ga0496107_0008865 3300048910 Bacteria 6970
361 Ga0496107_0339628 3300048910 Bacteria 1117
362 Ga0496108_0000001 3300048911 Bacteria 919044
363 Ga0496108_0000133 3300048911 Bacteria 72253
364 Ga0496108_0000146 3300048911 Bacteria 67618
365 Ga0496108_0011508 3300048911 Bacteria 7189
366 Ga0496108_0050659 3300048911 Bacteria 3476
367 Ga0496109_0000006 3300048912 Bacteria 325513
368 Ga0496109_0000021 3300048912 Bacteria 189945
369 Ga0496109_0000060 3300048912 Bacteria 115800
370 Ga0496109_0000075 3300048912 Bacteria 105050
371 Ga0496109_0018677 3300048912 Bacteria 6094
372 Ga0496110_0000287 3300048913 Bacteria 33028
373 Ga0496110_0010923 3300048913 Bacteria 7406
374 Ga0496110_0053359 3300048913 Bacteria 3554
375 Ga0496111_0000077 3300048914 Bacteria 40767
376 Ga0496112_0000006 3300048915 Bacteria 365227
377 Ga0496112_0012069 3300048915 Bacteria 7926
378 Ga0496112_0099902 3300048915 Bacteria 2871
379 Ga0496113_0000054 3300048916 Bacteria 49229
380 Ga0496113_0012331 3300048916 Bacteria 5742
381 Ga0496113_0300927 3300048916 Bacteria 1284
382 Ga0496114_0000088 3300048917 Bacteria 65300
383 Ga0496114_0071595 3300048917 Bacteria 2914
384 Ga0496115_0000003 3300048918 Bacteria 354994
385 Ga0496115_0000119 3300048918 Bacteria 71710
386 Ga0496115_0021597 3300048918 Bacteria 4974
387 Ga0496117_0025669 3300048920 Bacteria 4627
388 Ga0496118_0005040 3300048921 Bacteria 15236
389 Ga0496119_0001484 3300048922 Bacteria 28124
390 Ga0496119_0078935 3300048922 Bacteria 1902
391 Ga0496120_0001894 3300048923 Bacteria 23214
392 Ga0496121_0032823 3300048924 Bacteria 4710
393 Ga0496125_0121039 3300048928 Bacteria 1867
394 Ga0496126_0208039 3300048929 Bacteria 1648
395 Ga0501031_0000058 3300049568 Bacteria 59109
396 Ga0501031_0001373 3300049568 Bacteria 15036
397 Ga0501032_0002722 3300049569 Bacteria 13772
398 Ga0501032_0006593 3300049569 Bacteria 8525
399 Ga0501032_0131848 3300049569 Bacteria 1649
400 Ga0501033_0000134 3300049570 Bacteria 71995
401 Ga0501033_0015135 3300049570 Bacteria 5853
402 Ga0501034_0017696 3300049571 Bacteria 7308
403 Ga0501034_0213834 3300049571 Bacteria 1883
404 Ga0501036_0000307 3300049572 Bacteria 34058
405 Ga0501036_0002950 3300049572 Bacteria 13516
406 Ga0501037_0000202 3300049573 Bacteria 53677
407 Ga0501037_0002322 3300049573 Bacteria 13746
408 Ga0501038_0000485 3300049574 Bacteria 34975
409 Ga0501038_0001365 3300049574 Bacteria 22259
410 Ga0501039_0000462 3300049575 Bacteria 29588
411 Ga0501039_0039291 3300049575 Bacteria 3655
412 Ga0501040_0000041 3300049576 Bacteria 58334
413 Ga0501040_0031592 3300049576 Bacteria 3580
414 Ga0501040_0102236 3300049576 Bacteria 2000
415 Ga0501041_0000148 3300049577 Bacteria 30860
416 Ga0501042_0000056 3300049578 Bacteria 39426
417 Ga0501043_0000118 3300049579 Bacteria 73474
418 Ga0501043_0002786 3300049579 Bacteria 14607
419 Ga0501046_0000178 3300049580 Bacteria 64877
420 Ga0501046_0003436 3300049580 Bacteria 14532
421 Ga0501046_0050129 3300049580 Bacteria 3299
422 Ga0501047_0000647 3300049581 Bacteria 36587
423 Ga0501047_0001317 3300049581 Bacteria 24412
424 Ga0501047_0108495 3300049581 Bacteria 2658
425 Ga0501047_0157707 3300049581 Bacteria 2142
426 Ga0501048_0001339 3300049582 Bacteria 18675
427 Ga0501048_0002614 3300049582 Bacteria 13786
428 Ga0501067_0062069 3300049583 Bacteria 2069
429 Ga0501068_0002389 3300049584 Bacteria 9978
430 Ga0501069_0000746 3300049585 Bacteria 15198
431 Ga0501070_0000309 3300049586 Bacteria 44629
432 Ga0501070_0000732 3300049586 Bacteria 30016
433 Ga0501070_0166630 3300049586 Bacteria 1815
434 Ga0501071_0000010 3300049587 Bacteria 67846
435 Ga0501072_0000178 3300049588 Bacteria 45720
436 Ga0501072_0008083 3300049588 Bacteria 7983
437 Ga0501073_0011454 3300049589 Bacteria 6488
438 Ga0501073_0028488 3300049589 Bacteria 3991
439 Ga0501074_0003551 3300049590 Bacteria 11059
440 Ga0501074_0019790 3300049590 Bacteria 4888
441 Ga0501074_0033990 3300049590 Bacteria 3696
442 Ga0501075_0000113 3300049591 Bacteria 38784
443 Ga0501075_0010829 3300049591 Bacteria 6427
444 Ga0501076_0000127 3300049592 Bacteria 42296
445 Ga0501077_0003194 3300049593 Bacteria 9874
446 Ga0501077_0065398 3300049593 Bacteria 2306
447 Ga0501079_0000204 3300049741 Bacteria 34524
448 Ga0501080_0001801 3300049742 Bacteria 18361
449 Ga0501081_0000002 3300049743 Bacteria 102870
450 Ga0501081_0149296 3300049743 Bacteria 1678
451 Ga0501083_0000160 3300049744 Bacteria 44202
452 Ga0501083_0009824 3300049744 Bacteria 6754
453 Ga0501035_0000568 3300049822 Bacteria 40873
454 Ga0501035_0020800 3300049822 Bacteria 6028
455 Ga0501044_0001651 3300049823 Bacteria 26204
456 Ga0501044_0096298 3300049823 Bacteria 2981
457 Ga0501045_0000049 3300049824 Bacteria 51937
458 nmdc:mga05p37_164848_c1 3300050507 Bacteria 2705
459 nmdc:mga05p37_28282_c1 3300050507 Bacteria 6836
460 nmdc:mga05p37_3073_c1 3300050507 Bacteria 19391
461 nmdc:mga05p37_335680_c1 3300050507 Bacteria 1784
462 nmdc:mga05p37_93680_c1 3300050507 Bacteria 3701
463 nmdc:mga09592_15147_c1 3300050508 Bacteria 6300
464 nmdc:mga09592_95093_c1 3300050508 Bacteria 2548
465 nmdc:mga0qj67_9614_c1 3300050509 Bacteria 7206
466 nmdc:mga06r32_154192_c1 3300050510 Bacteria 2277
467 nmdc:mga0n895_194933_c1 3300050512 Bacteria 2057
468 nmdc:mga0a205_125_c2 3300050515 Bacteria 7254
469 nmdc:mga0a205_273218_c1 3300050515 Bacteria 1567
470 nmdc:mga0a205_6_c1 3300050515 Bacteria 129758
471 Ga0495601_0000032 3300053077 Bacteria 102174
472 Ga0495601_0000045 3300053077 Bacteria 73391
473 Ga0495601_0041266 3300053077 Bacteria 2892
474 Ga0495601_0273212 3300053077 Bacteria 1102
475 Ga0495612_0000073 3300053078 Bacteria 45639
476 Ga0495612_0001420 3300053078 Bacteria 9841
477 Ga0495612_0019153 3300053078 Bacteria 2741
478 Ga0495595_0000003 3300053084 Bacteria 266465
479 Ga0495595_0000066 3300053084 Bacteria 51901
480 Ga0495595_0011247 3300053084 Bacteria 3738
481 Ga0495619_0000032 3300053085 Bacteria 139067
482 Ga0495619_0000137 3300053085 Bacteria 54479
483 Ga0495619_0000404 3300053085 Bacteria 29419
484 Ga0495619_0000438 3300053085 Bacteria 28186
485 Ga0495619_0001777 3300053085 Bacteria 14331
486 Ga0495619_0015423 3300053085 Bacteria 4834
487 Ga0495619_0154375 3300053085 Bacteria 1584
488 Ga0500566_0003977 3300053094 Bacteria 8824
489 Ga0500595_039671 3300053119 Bacteria 1522
490 Ga0500614_000116 3300053123 Bacteria 19156
491 Ga0501084_0004621 3300054114 Bacteria 11247
492 Ga0501082_0000717 3300060353 Bacteria 29164
493 Ga0501082_0013634 3300060353 Bacteria 6986
494 Ga0530510_0000049 3300061734 Bacteria 55964
495 Ga0530510_0006213 3300061734 Bacteria 8305
496 Ga0530510_0225332 3300061734 Bacteria 1394

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025922 Ga0207646_10110549 Ga0207646_101105492 297
2 3300005337 Ga0070682_100188695 Ga0070682_1001886952 302
3 3300005548 Ga0070665_100051760 Ga0070665_1000517604 302
4 3300025986 Ga0207658_10028847 Ga0207658_100288475 302
5 3300028379 Ga0268266_10000406 Ga0268266_1000040637 302
6 3300048929 Ga0496126_0208039 Ga0496126_0208039_335_1372 311
7 3300037312 Ga0395899_0010077 Ga0395899_0010077_2518_3456 312
8 3300037418 Ga0395900_0032995 Ga0395900_0032995_1463_2401 312
9 3300037466 Ga0395898_0054281 Ga0395898_0054281_123_1061 312
10 3300037471 Ga0395905_0028154 Ga0395905_0028154_1572_2510 312
11 3300038443 Ga0395901_0021037 Ga0395901_0021037_1226_2164 312
12 3300044694 Ga0466963_0000062 Ga0466963_0000062_24956_25993 313
13 3300048928 Ga0496125_0121039 Ga0496125_0121039_364_1401 314
14 3300037466 Ga0395898_0169179 Ga0395898_0169179_750_1709 315
15 3300025949 Ga0207667_10245735 Ga0207667_102457352 316
16 3300049569 Ga0501032_0131848 Ga0501032_0131848_459_1496 316
17 3300005335 Ga0070666_10021720 Ga0070666_100217202 317
18 3300005336 Ga0070680_100061693 Ga0070680_1000616933 317
19 3300005337 Ga0070682_100001860 Ga0070682_10000186010 317
20 3300005338 Ga0068868_100021305 Ga0068868_1000213052 317
21 3300005339 Ga0070660_100048024 Ga0070660_1000480243 317
22 3300005340 Ga0070689_100014641 Ga0070689_1000146412 317
23 3300005345 Ga0070692_10002161 Ga0070692_100021615 317
24 3300005347 Ga0070668_100015913 Ga0070668_1000159133 317
25 3300005356 Ga0070674_100024507 Ga0070674_1000245072 317
26 3300005365 Ga0070688_100001399 Ga0070688_1000013998 317
27 3300005406 Ga0070703_10017167 Ga0070703_100171672 317
28 3300005434 Ga0070709_10044107 Ga0070709_100441073 317
29 3300005437 Ga0070710_10003862 Ga0070710_100038625 317
30 3300005438 Ga0070701_10001269 Ga0070701_100012697 317
31 3300005439 Ga0070711_100011091 Ga0070711_1000110913 317
32 3300005440 Ga0070705_100057994 Ga0070705_1000579942 317
33 3300005441 Ga0070700_100003142 Ga0070700_1000031424 317
34 3300005455 Ga0070663_100013431 Ga0070663_1000134313 317
35 3300005456 Ga0070678_100004128 Ga0070678_1000041285 317
36 3300005466 Ga0070685_10001901 Ga0070685_100019018 317
37 3300005539 Ga0068853_100018058 Ga0068853_1000180582 317
38 3300005543 Ga0070672_100007193 Ga0070672_1000071933 317
39 3300005546 Ga0070696_100008544 Ga0070696_1000085444 317
40 3300005548 Ga0070665_100006147 Ga0070665_1000061476 317
41 3300005549 Ga0070704_100010413 Ga0070704_1000104134 317
42 3300005578 Ga0068854_100043092 Ga0068854_1000430922 317
43 3300005614 Ga0068856_100022995 Ga0068856_1000229953 317
44 3300005615 Ga0070702_100017948 Ga0070702_1000179483 317
45 3300005616 Ga0068852_100145787 Ga0068852_1001457872 317
46 3300005617 Ga0068859_100017962 Ga0068859_1000179626 317
47 3300005718 Ga0068866_10002178 Ga0068866_100021785 317
48 3300005842 Ga0068858_100062192 Ga0068858_1000621923 317
49 3300005844 Ga0068862_100083988 Ga0068862_1000839883 317
50 3300005985 Ga0081539_10007678 Ga0081539_1000767810 317
51 3300006175 Ga0070712_100026218 Ga0070712_1000262183 317
52 3300006358 Ga0068871_100008611 Ga0068871_1000086114 317
53 3300006881 Ga0068865_100002979 Ga0068865_1000029795 317
54 3300006931 Ga0097620_100017962 Ga0097620_1000179626 317
55 3300009098 Ga0105245_10116421 Ga0105245_101164212 317
56 3300009148 Ga0105243_10006384 Ga0105243_100063844 317
57 3300009174 Ga0105241_10011135 Ga0105241_100111353 317
58 3300009177 Ga0105248_10013117 Ga0105248_100131178 317
59 3300009553 Ga0105249_10024164 Ga0105249_100241645 317
60 3300010375 Ga0105239_10011666 Ga0105239_100116664 317
61 3300011119 Ga0105246_10022109 Ga0105246_100221092 317
62 3300013296 Ga0157374_10027488 Ga0157374_100274883 317
63 3300013297 Ga0157378_10009022 Ga0157378_100090225 317
64 3300013306 Ga0163162_10016057 Ga0163162_100160574 317
65 3300013308 Ga0157375_10020073 Ga0157375_100200735 317
66 3300014969 Ga0157376_10009638 Ga0157376_100096386 317
67 3300025885 Ga0207653_10006060 Ga0207653_100060602 317
68 3300025898 Ga0207692_10013980 Ga0207692_100139803 317
69 3300025899 Ga0207642_10003698 Ga0207642_100036983 317
70 3300025903 Ga0207680_10027702 Ga0207680_100277023 317
71 3300025904 Ga0207647_10017527 Ga0207647_100175272 317
72 3300025906 Ga0207699_10031010 Ga0207699_100310102 317
73 3300025915 Ga0207693_10000351 Ga0207693_1000035114 317
74 3300025916 Ga0207663_10024412 Ga0207663_100244123 317
75 3300025917 Ga0207660_10136448 Ga0207660_101364482 317
76 3300025919 Ga0207657_10006050 Ga0207657_1000605010 317
77 3300025921 Ga0207652_10134941 Ga0207652_101349413 317
78 3300025927 Ga0207687_10046767 Ga0207687_100467672 317
79 3300025933 Ga0207706_10127402 Ga0207706_101274023 317
80 3300025935 Ga0207709_10001209 Ga0207709_1000120919 317
81 3300025936 Ga0207670_10051024 Ga0207670_100510242 317
82 3300025938 Ga0207704_10001860 Ga0207704_100018605 317
83 3300025940 Ga0207691_10014505 Ga0207691_100145054 317
84 3300025941 Ga0207711_10057111 Ga0207711_100571113 317
85 3300025961 Ga0207712_10004322 Ga0207712_100043226 317
86 3300025972 Ga0207668_10012936 Ga0207668_100129364 317
87 3300025981 Ga0207640_10034810 Ga0207640_100348102 317
88 3300026035 Ga0207703_10051697 Ga0207703_100516973 317
89 3300026041 Ga0207639_10007912 Ga0207639_100079125 317
90 3300026067 Ga0207678_10021211 Ga0207678_100212113 317
91 3300026075 Ga0207708_10000515 Ga0207708_1000051522 317
92 3300026078 Ga0207702_10109523 Ga0207702_101095233 317
93 3300026089 Ga0207648_10000637 Ga0207648_1000063742 317
94 3300026121 Ga0207683_10002177 Ga0207683_100021774 317
95 3300028379 Ga0268266_10047348 Ga0268266_100473483 317
96 3300048903 Ga0496100_0057195 Ga0496100_0057195_1494_2447 317
97 3300048904 Ga0496101_0010052 Ga0496101_0010052_369_1322 317
98 3300048907 Ga0496104_0080903 Ga0496104_0080903_1649_2602 317
99 3300048909 Ga0496106_0025730 Ga0496106_0025730_3095_4048 317
100 3300048910 Ga0496107_0008865 Ga0496107_0008865_1539_2492 317
101 3300048912 Ga0496109_0018677 Ga0496109_0018677_328_1281 317
102 3300048915 Ga0496112_0099902 Ga0496112_0099902_469_1422 317
103 3300048918 Ga0496115_0021597 Ga0496115_0021597_1687_2640 317
104 3300005545 Ga0070695_100156022 Ga0070695_1001560222 318
105 3300005549 Ga0070704_100109314 Ga0070704_1001093142 318
106 3300006852 Ga0075433_10473184 Ga0075433_104731841 318
107 3300006871 Ga0075434_100083515 Ga0075434_1000835152 318
108 3300009148 Ga0105243_10072865 Ga0105243_100728653 318
109 3300025927 Ga0207687_10000055 Ga0207687_1000005585 318
110 3300049576 Ga0501040_0102236 Ga0501040_0102236_828_1784 318
111 3300049580 Ga0501046_0050129 Ga0501046_0050129_799_1755 318
112 3300049593 Ga0501077_0065398 Ga0501077_0065398_514_1470 318
113 3300050512 nmdc:mga0n895_194933_c1 nmdc:mga0n895_194933_c1_252_1208 318
114 3300061734 Ga0530510_0006213 Ga0530510_0006213_3392_4348 318
115 3300005530 Ga0070679_100002214 Ga0070679_1000022146 319
116 3300006852 Ga0075433_10101579 Ga0075433_101015791 319
117 3300007076 Ga0075435_100110224 Ga0075435_1001102242 319
118 3300009147 Ga0114129_10020139 Ga0114129_100201392 319
119 3300025921 Ga0207652_10002532 Ga0207652_1000253213 319
120 3300031727 Ga0316576_10127254 Ga0316576_101272541 319
121 3300036712 Ga0316584_0029996 Ga0316584_0029996_3007_3966 319
122 3300050507 nmdc:mga05p37_335680_c1 nmdc:mga05p37_335680_c1_781_1740 319
123 3300050515 nmdc:mga0a205_273218_c1 nmdc:mga0a205_273218_c1_397_1356 319
124 3300046473 Ga0495582_0000023 Ga0495582_0000023_66433_67395 320
125 3300046683 Ga0495658_0000021 Ga0495658_0000021_66433_67395 320
126 3300048916 Ga0496113_0012331 Ga0496113_0012331_1022_1984 320
127 3300050515 nmdc:mga0a205_125_c2 nmdc:mga0a205_125_c2_3351_4313 320
128 3300006846 Ga0075430_100068981 Ga0075430_1000689813 321
129 3300009147 Ga0114129_10063935 Ga0114129_100639355 321
130 3300050507 nmdc:mga05p37_164848_c1 nmdc:mga05p37_164848_c1_554_1519 321
131 3300050508 nmdc:mga09592_95093_c1 nmdc:mga09592_95093_c1_442_1407 321
132 3300061734 Ga0530510_0225332 Ga0530510_0225332_207_1172 321
133 3300006051 Ga0075364_10120258 Ga0075364_101202581 322
134 3300006846 Ga0075430_100004189 Ga0075430_1000041894 322
135 3300006880 Ga0075429_100004148 Ga0075429_1000041487 322
136 3300009147 Ga0114129_10069019 Ga0114129_100690193 322
137 3300009147 Ga0114129_10261070 Ga0114129_102610702 322
138 3300026078 Ga0207702_10000158 Ga0207702_1000015818 322
139 3300037418 Ga0395900_0005524 Ga0395900_0005524_4984_5967 322
140 3300038443 Ga0395901_0012891 Ga0395901_0012891_7194_8177 322
141 3300048908 Ga0496105_0038384 Ga0496105_0038384_328_1365 322
142 3300048922 Ga0496119_0001484 Ga0496119_0001484_6040_7077 322
143 3300049568 Ga0501031_0001373 Ga0501031_0001373_8567_9547 322
144 3300049569 Ga0501032_0006593 Ga0501032_0006593_6970_7950 322
145 3300049570 Ga0501033_0000134 Ga0501033_0000134_46391_47371 322
146 3300049572 Ga0501036_0000307 Ga0501036_0000307_8567_9547 322
147 3300049573 Ga0501037_0000202 Ga0501037_0000202_45467_46447 322
148 3300049574 Ga0501038_0001365 Ga0501038_0001365_15080_16060 322
149 3300049575 Ga0501039_0000462 Ga0501039_0000462_20811_21791 322
150 3300049576 Ga0501040_0000041 Ga0501040_0000041_42403_43383 322
151 3300049577 Ga0501041_0000148 Ga0501041_0000148_14801_15781 322
152 3300049578 Ga0501042_0000056 Ga0501042_0000056_5490_6470 322
153 3300049579 Ga0501043_0000118 Ga0501043_0000118_45467_46447 322
154 3300049580 Ga0501046_0000178 Ga0501046_0000178_39386_40366 322
155 3300049581 Ga0501047_0001317 Ga0501047_0001317_17943_18923 322
156 3300049582 Ga0501048_0001339 Ga0501048_0001339_5490_6470 322
157 3300049584 Ga0501068_0002389 Ga0501068_0002389_3509_4489 322
158 3300049585 Ga0501069_0000746 Ga0501069_0000746_11908_12888 322
159 3300049586 Ga0501070_0000732 Ga0501070_0000732_7082_8062 322
160 3300049587 Ga0501071_0000010 Ga0501071_0000010_44115_45095 322
161 3300049588 Ga0501072_0000178 Ga0501072_0000178_5483_6463 322
162 3300049589 Ga0501073_0011454 Ga0501073_0011454_3133_4113 322
163 3300049590 Ga0501074_0003551 Ga0501074_0003551_6809_7789 322
164 3300049591 Ga0501075_0000113 Ga0501075_0000113_36971_37951 322
165 3300049592 Ga0501076_0000127 Ga0501076_0000127_40483_41463 322
166 3300049593 Ga0501077_0003194 Ga0501077_0003194_8061_9041 322
167 3300049741 Ga0501079_0000204 Ga0501079_0000204_6791_7771 322
168 3300049742 Ga0501080_0001801 Ga0501080_0001801_11897_12877 322
169 3300049743 Ga0501081_0000002 Ga0501081_0000002_79248_80228 322
170 3300049744 Ga0501083_0000160 Ga0501083_0000160_28271_29251 322
171 3300049822 Ga0501035_0000568 Ga0501035_0000568_3271_4251 322
172 3300049823 Ga0501044_0096298 Ga0501044_0096298_49_1029 322
173 3300049824 Ga0501045_0000049 Ga0501045_0000049_45468_46448 322
174 3300050507 nmdc:mga05p37_3073_c1 nmdc:mga05p37_3073_c1_17964_18947 322
175 3300050507 nmdc:mga05p37_93680_c1 nmdc:mga05p37_93680_c1_428_1414 322
176 3300050508 nmdc:mga09592_15147_c1 nmdc:mga09592_15147_c1_4225_5208 322
177 3300050509 nmdc:mga0qj67_9614_c1 nmdc:mga0qj67_9614_c1_2008_2991 322
178 3300054114 Ga0501084_0004621 Ga0501084_0004621_706_1686 322
179 3300060353 Ga0501082_0000717 Ga0501082_0000717_20811_21791 322
180 3300061734 Ga0530510_0000049 Ga0530510_0000049_54151_55131 322
181 3300005459 Ga0068867_100000294 Ga0068867_1000002946 323
182 3300006163 Ga0070715_10000001 Ga0070715_1000000154 323
183 3300025905 Ga0207685_10000011 Ga0207685_1000001155 323
184 3300026089 Ga0207648_10004975 Ga0207648_1000497513 323
185 3300053078 Ga0495612_0001420 Ga0495612_0001420_3265_4236 323
186 3300002074 JGI24748J21848_1000423 JGI24748J21848_10004232 324
187 3300002239 JGI24034J26672_10000194 JGI24034J26672_100001949 324
188 3300005341 Ga0070691_10001179 Ga0070691_1000117911 324
189 3300006852 Ga0075433_10000597 Ga0075433_1000059719 324
190 3300046455 Ga0495603_0000005 Ga0495603_0000005_49422_50396 324
191 3300046689 Ga0495613_0050419 Ga0495613_0050419_980_1954 324
192 3300047317 Ga0495604_0000055 Ga0495604_0000055_93100_94074 324
193 3300049743 Ga0501081_0149296 Ga0501081_0149296_395_1369 324
194 3300050515 nmdc:mga0a205_6_c1 nmdc:mga0a205_6_c1_91425_92399 324
195 3300005457 Ga0070662_100000007 Ga0070662_10000000795 325
196 3300025933 Ga0207706_10000018 Ga0207706_1000001891 325
197 3300026142 Ga0207698_10067244 Ga0207698_100672442 325
198 3300036401 Ga0373937_0085726 Ga0373937_0085726_50_1027 325
199 3300046536 Ga0495587_0033218 Ga0495587_0033218_502_1479 325
200 3300048913 Ga0496110_0053359 Ga0496110_0053359_1016_1993 325
201 3300048916 Ga0496113_0300927 Ga0496113_0300927_178_1155 325
202 3300006847 Ga0075431_100197760 Ga0075431_1001977603 326
203 3300046529 Ga0495652_0209827 Ga0495652_0209827_58_1038 326
204 3300046691 Ga0495670_0002313 Ga0495670_0002313_2565_3602 326
205 3300050510 nmdc:mga06r32_154192_c1 nmdc:mga06r32_154192_c1_304_1284 326
206 3300053078 Ga0495612_0000073 Ga0495612_0000073_11846_12826 326
207 3300053085 Ga0495619_0000438 Ga0495619_0000438_7000_7980 326
208 3300037466 Ga0395898_0054957 Ga0395898_0054957_2689_3678 327
209 3300037471 Ga0395905_0150948 Ga0395905_0150948_713_1702 327
210 3300046463 Ga0495653_0008533 Ga0495653_0008533_6255_7238 327
211 3300050507 nmdc:mga05p37_28282_c1 nmdc:mga05p37_28282_c1_530_1519 327
212 3300013104 Ga0157370_10002517 Ga0157370_100025174 329
213 3300046523 Ga0495644_0000995 Ga0495644_0000995_5818_6858 329
214 3300046642 Ga0495634_0000193 Ga0495634_0000193_54657_55697 329
215 3300048911 Ga0496108_0000133 Ga0496108_0000133_32750_33790 329
216 3300048912 Ga0496109_0000021 Ga0496109_0000021_145296_146336 329
217 3300046516 Ga0495628_0229163 Ga0495628_0229163_237_1277 330
218 3300046517 Ga0495630_0002335 Ga0495630_0002335_3163_4203 330
219 3300053077 Ga0495601_0273212 Ga0495601_0273212_27_1067 330
220 3300046559 Ga0495667_0000018 Ga0495667_0000018_28461_29477 331
221 3300014326 Ga0157380_10000487 Ga0157380_1000048715 332
222 3300044694 Ga0466963_0074972 Ga0466963_0074972_1103_2101 332
223 3300045976 Ga0466967_0211855 Ga0466967_0211855_256_1254 332
224 3300005983 Ga0081540_1066433 Ga0081540_10664332 333
225 3300026041 Ga0207639_10131956 Ga0207639_101319562 333
226 3300001977 JGI24746J21847_1000010 JGI24746J21847_10000107 334
227 3300005333 Ga0070677_10000001 Ga0070677_1000000189 334
228 3300005337 Ga0070682_100000028 Ga0070682_10000002881 334
229 3300005337 Ga0070682_100000049 Ga0070682_100000049112 334
230 3300005338 Ga0068868_100000261 Ga0068868_1000002616 334
231 3300005338 Ga0068868_100004032 Ga0068868_1000040329 334
232 3300005341 Ga0070691_10000001 Ga0070691_1000000194 334
233 3300005344 Ga0070661_100000226 Ga0070661_10000022642 334
234 3300005345 Ga0070692_10033529 Ga0070692_100335294 334
235 3300005356 Ga0070674_100000001 Ga0070674_100000001256 334
236 3300005356 Ga0070674_100000022 Ga0070674_10000002215 334
237 3300005356 Ga0070674_100091805 Ga0070674_1000918053 334
238 3300005365 Ga0070688_100000124 Ga0070688_1000001244 334
239 3300005365 Ga0070688_100000345 Ga0070688_1000003456 334
240 3300005365 Ga0070688_100165978 Ga0070688_1001659782 334
241 3300005435 Ga0070714_100035519 Ga0070714_1000355193 334
242 3300005436 Ga0070713_100061024 Ga0070713_1000610242 334
243 3300005439 Ga0070711_100014451 Ga0070711_1000144512 334
244 3300005441 Ga0070700_100007408 Ga0070700_1000074082 334
245 3300005466 Ga0070685_10000025 Ga0070685_10000025101 334
246 3300005466 Ga0070685_10000249 Ga0070685_100002494 334
247 3300005539 Ga0068853_100002403 Ga0068853_10000240313 334
248 3300005543 Ga0070672_100000087 Ga0070672_1000000875 334
249 3300005544 Ga0070686_100013351 Ga0070686_1000133513 334
250 3300005548 Ga0070665_100000068 Ga0070665_100000068193 334
251 3300005548 Ga0070665_100000783 Ga0070665_10000078339 334
252 3300005563 Ga0068855_100116645 Ga0068855_1001166453 334
253 3300005578 Ga0068854_100000090 Ga0068854_10000009042 334
254 3300005614 Ga0068856_100005720 Ga0068856_10000572013 334
255 3300005614 Ga0068856_100019936 Ga0068856_1000199367 334
256 3300005615 Ga0070702_100119791 Ga0070702_1001197912 334
257 3300005616 Ga0068852_100000006 Ga0068852_10000000674 334
258 3300005618 Ga0068864_100000023 Ga0068864_100000023204 334
259 3300005718 Ga0068866_10000001 Ga0068866_1000000182 334
260 3300005718 Ga0068866_10000140 Ga0068866_1000014032 334
261 3300005718 Ga0068866_10010556 Ga0068866_100105563 334
262 3300005834 Ga0068851_10001723 Ga0068851_1000172312 334
263 3300005834 Ga0068851_10034037 Ga0068851_100340372 334
264 3300005841 Ga0068863_100001412 Ga0068863_1000014126 334
265 3300005841 Ga0068863_100494086 Ga0068863_1004940862 334
266 3300005842 Ga0068858_100000012 Ga0068858_10000001255 334
267 3300005842 Ga0068858_100000131 Ga0068858_10000013164 334
268 3300005843 Ga0068860_100238950 Ga0068860_1002389503 334
269 3300005937 Ga0081455_10010784 Ga0081455_100107847 334
270 3300005985 Ga0081539_10024590 Ga0081539_100245902 334
271 3300006358 Ga0068871_100292947 Ga0068871_1002929471 334
272 3300006881 Ga0068865_100000023 Ga0068865_10000002316 334
273 3300006914 Ga0075436_100246004 Ga0075436_1002460042 334
274 3300009098 Ga0105245_10000662 Ga0105245_1000066223 334
275 3300009098 Ga0105245_10006750 Ga0105245_100067506 334
276 3300009148 Ga0105243_10095392 Ga0105243_100953922 334
277 3300009176 Ga0105242_10000051 Ga0105242_1000005130 334
278 3300009176 Ga0105242_10024571 Ga0105242_100245715 334
279 3300009177 Ga0105248_10000008 Ga0105248_10000008237 334
280 3300009551 Ga0105238_10000023 Ga0105238_1000002377 334
281 3300009553 Ga0105249_10000074 Ga0105249_1000007445 334
282 3300010375 Ga0105239_10124159 Ga0105239_101241591 334
283 3300013102 Ga0157371_10013444 Ga0157371_100134446 334
284 3300013104 Ga0157370_10083236 Ga0157370_100832364 334
285 3300013104 Ga0157370_10356390 Ga0157370_103563901 334
286 3300013105 Ga0157369_10000020 Ga0157369_10000020112 334
287 3300013297 Ga0157378_10024717 Ga0157378_100247172 334
288 3300013307 Ga0157372_10000253 Ga0157372_1000025327 334
289 3300013308 Ga0157375_10000109 Ga0157375_1000010910 334
290 3300013308 Ga0157375_10007058 Ga0157375_100070585 334
291 3300014325 Ga0163163_10133411 Ga0163163_101334112 334
292 3300014326 Ga0157380_10000037 Ga0157380_1000003724 334
293 3300014969 Ga0157376_10009684 Ga0157376_100096847 334
294 3300017792 Ga0163161_10000013 Ga0163161_1000001331 334
295 3300025321 Ga0207656_10001124 Ga0207656_100011242 334
296 3300025321 Ga0207656_10011067 Ga0207656_100110675 334
297 3300025893 Ga0207682_10000034 Ga0207682_1000003441 334
298 3300025899 Ga0207642_10000006 Ga0207642_1000000685 334
299 3300025899 Ga0207642_10000007 Ga0207642_10000007150 334
300 3300025899 Ga0207642_10002435 Ga0207642_100024352 334
301 3300025899 Ga0207642_10003589 Ga0207642_100035895 334
302 3300025911 Ga0207654_10018008 Ga0207654_100180081 334
303 3300025916 Ga0207663_10001227 Ga0207663_100012277 334
304 3300025920 Ga0207649_10000009 Ga0207649_10000009136 334
305 3300025924 Ga0207694_10000004 Ga0207694_10000004765 334
306 3300025926 Ga0207659_10000033 Ga0207659_10000033116 334
307 3300025927 Ga0207687_10000007 Ga0207687_10000007506 334
308 3300025927 Ga0207687_10000026 Ga0207687_1000002651 334
309 3300025927 Ga0207687_10002371 Ga0207687_1000237111 334
310 3300025928 Ga0207700_10045579 Ga0207700_100455792 334
311 3300025932 Ga0207690_10001511 Ga0207690_1000151114 334
312 3300025934 Ga0207686_10000083 Ga0207686_1000008361 334
313 3300025934 Ga0207686_10007376 Ga0207686_100073766 334
314 3300025934 Ga0207686_10029784 Ga0207686_100297843 334
315 3300025935 Ga0207709_10129308 Ga0207709_101293082 334
316 3300025936 Ga0207670_10050657 Ga0207670_100506572 334
317 3300025937 Ga0207669_10000002 Ga0207669_1000000294 334
318 3300025937 Ga0207669_10000009 Ga0207669_1000000981 334
319 3300025938 Ga0207704_10000068 Ga0207704_1000006860 334
320 3300025940 Ga0207691_10000382 Ga0207691_1000038247 334
321 3300025941 Ga0207711_10000006 Ga0207711_10000006631 334
322 3300025944 Ga0207661_10000056 Ga0207661_1000005622 334
323 3300025944 Ga0207661_10002003 Ga0207661_100020037 334
324 3300025945 Ga0207679_10062460 Ga0207679_100624603 334
325 3300025961 Ga0207712_10000007 Ga0207712_1000000747 334
326 3300025981 Ga0207640_10000178 Ga0207640_1000017824 334
327 3300026023 Ga0207677_10000046 Ga0207677_1000004645 334
328 3300026023 Ga0207677_10001380 Ga0207677_1000138013 334
329 3300026035 Ga0207703_10000111 Ga0207703_1000011114 334
330 3300026035 Ga0207703_10000310 Ga0207703_1000031031 334
331 3300026041 Ga0207639_10004273 Ga0207639_100042739 334
332 3300026078 Ga0207702_10002069 Ga0207702_1000206913 334
333 3300026078 Ga0207702_10015866 Ga0207702_100158662 334
334 3300026088 Ga0207641_10000170 Ga0207641_1000017020 334
335 3300026088 Ga0207641_10001999 Ga0207641_1000199911 334
336 3300026095 Ga0207676_10000025 Ga0207676_1000002576 334
337 3300026121 Ga0207683_10006812 Ga0207683_100068126 334
338 3300026142 Ga0207698_10000013 Ga0207698_10000013115 334
339 3300028379 Ga0268266_10000020 Ga0268266_10000020212 334
340 3300028381 Ga0268264_10010337 Ga0268264_100103373 334
341 3300028556 Ga0265337_1000011 Ga0265337_100001172 334
342 3300028558 Ga0265326_10000063 Ga0265326_1000006337 334
343 3300028563 Ga0265319_1000020 Ga0265319_100002063 334
344 3300028573 Ga0265334_10027990 Ga0265334_100279903 334
345 3300028654 Ga0265322_10000001 Ga0265322_10000001420 334
346 3300028666 Ga0265336_10004194 Ga0265336_100041946 334
347 3300028800 Ga0265338_10000222 Ga0265338_1000022253 334
348 3300029957 Ga0265324_10001878 Ga0265324_100018787 334
349 3300031240 Ga0265320_10000002 Ga0265320_10000002419 334
350 3300031241 Ga0265325_10021261 Ga0265325_100212611 334
351 3300031242 Ga0265329_10006318 Ga0265329_100063184 334
352 3300031250 Ga0265331_10001337 Ga0265331_1000133723 334
353 3300031251 Ga0265327_10000011 Ga0265327_10000011419 334
354 3300031595 Ga0265313_10027368 Ga0265313_100273682 334
355 3300031711 Ga0265314_10000062 Ga0265314_10000062153 334
356 3300031731 Ga0307405_10068525 Ga0307405_100685252 334
357 3300032126 Ga0307415_100008149 Ga0307415_1000081493 334
358 3300044842 Ga0466957_0069941 Ga0466957_0069941_862_1896 334
359 3300045976 Ga0466967_0287017 Ga0466967_0287017_287_1330 334
360 3300046454 Ga0495592_0004272 Ga0495592_0004272_8870_9910 334
361 3300046455 Ga0495603_0015523 Ga0495603_0015523_3094_4134 334
362 3300046459 Ga0495629_0000919 Ga0495629_0000919_6465_7502 334
363 3300046459 Ga0495629_0212431 Ga0495629_0212431_88_1128 334
364 3300046461 Ga0495641_0000003 Ga0495641_0000003_60058_61095 334
365 3300046463 Ga0495653_0038009 Ga0495653_0038009_2179_3219 334
366 3300046476 Ga0495662_0000036 Ga0495662_0000036_11468_12508 334
367 3300046476 Ga0495662_0015833 Ga0495662_0015833_723_1760 334
368 3300046499 Ga0495594_0000107 Ga0495594_0000107_10425_11462 334
369 3300046507 Ga0495606_0000072 Ga0495606_0000072_76353_77387 334
370 3300046511 Ga0495608_0000060 Ga0495608_0000060_46287_47324 334
371 3300046511 Ga0495608_0001623 Ga0495608_0001623_14576_15616 334
372 3300046514 Ga0495618_0000053 Ga0495618_0000053_33981_35021 334
373 3300046516 Ga0495628_0001375 Ga0495628_0001375_16126_17166 334
374 3300046516 Ga0495628_0010707 Ga0495628_0010707_1723_2760 334
375 3300046516 Ga0495628_0178817 Ga0495628_0178817_461_1498 334
376 3300046517 Ga0495630_0000560 Ga0495630_0000560_403_1443 334
377 3300046529 Ga0495652_0000171 Ga0495652_0000171_25049_26086 334
378 3300046529 Ga0495652_0003006 Ga0495652_0003006_3089_4126 334
379 3300046533 Ga0495640_0004258 Ga0495640_0004258_8872_9912 334
380 3300046533 Ga0495640_0014786 Ga0495640_0014786_4421_5458 334
381 3300046536 Ga0495587_0000574 Ga0495587_0000574_19979_21013 334
382 3300046539 Ga0495621_0042048 Ga0495621_0042048_556_1593 334
383 3300046543 Ga0495645_0016051 Ga0495645_0016051_2615_3658 334
384 3300046543 Ga0495645_0038005 Ga0495645_0038005_1101_2138 334
385 3300046557 Ga0495622_0000259 Ga0495622_0000259_28188_29225 334
386 3300046615 Ga0495656_0000290 Ga0495656_0000290_12243_13283 334
387 3300046642 Ga0495634_0001330 Ga0495634_0001330_20874_21917 334
388 3300046642 Ga0495634_0025203 Ga0495634_0025203_2379_3416 334
389 3300046663 Ga0495635_0000042 Ga0495635_0000042_76711_77751 334
390 3300046674 Ga0495588_0000134 Ga0495588_0000134_76028_77065 334
391 3300046675 Ga0495657_0000004 Ga0495657_0000004_224563_225600 334
392 3300046675 Ga0495657_0004865 Ga0495657_0004865_479_1519 334
393 3300046681 Ga0495647_0000019 Ga0495647_0000019_45090_46130 334
394 3300046683 Ga0495658_0006767 Ga0495658_0006767_68_1102 334
395 3300046684 Ga0495669_0001196 Ga0495669_0001196_3007_4044 334
396 3300046689 Ga0495613_0000042 Ga0495613_0000042_66573_67613 334
397 3300046689 Ga0495613_0000197 Ga0495613_0000197_37093_38133 334
398 3300046690 Ga0495624_0000030 Ga0495624_0000030_59444_60484 334
399 3300046694 Ga0495649_0085529 Ga0495649_0085529_208_1245 334
400 3300046809 Ga0495600_0000282 Ga0495600_0000282_26395_27435 334
401 3300046809 Ga0495600_0014415 Ga0495600_0014415_1901_2938 334
402 3300047317 Ga0495604_0000155 Ga0495604_0000155_13323_14360 334
403 3300047317 Ga0495604_0068840 Ga0495604_0068840_1519_2556 334
404 3300047319 Ga0495674_0000029 Ga0495674_0000029_66481_67518 334
405 3300047321 Ga0495676_0000903 Ga0495676_0000903_11889_12926 334
406 3300047321 Ga0495676_0013738 Ga0495676_0013738_6181_7218 334
407 3300047322 Ga0495680_0000094 Ga0495680_0000094_534_1574 334
408 3300047322 Ga0495680_0000352 Ga0495680_0000352_440_1477 334
409 3300047322 Ga0495680_0179663 Ga0495680_0179663_446_1486 334
410 3300047444 Ga0495675_0000040 Ga0495675_0000040_44383_45420 334
411 3300047444 Ga0495675_0140960 Ga0495675_0140960_43_1080 334
412 3300047447 Ga0495685_051098 Ga0495685_051098_347_1387 334
413 3300047673 Ga0495593_0023569 Ga0495593_0023569_378_1412 334
414 3300048088 Ga0495602_0000070 Ga0495602_0000070_51260_52297 334
415 3300048088 Ga0495602_0000533 Ga0495602_0000533_22147_23184 334
416 3300048088 Ga0495602_0036615 Ga0495602_0036615_254_1288 334
417 3300048903 Ga0496100_0000005 Ga0496100_0000005_223161_224198 334
418 3300048903 Ga0496100_0000007 Ga0496100_0000007_9687_10724 334
419 3300048904 Ga0496101_0000013 Ga0496101_0000013_9687_10724 334
420 3300048904 Ga0496101_0000022 Ga0496101_0000022_17488_18525 334
421 3300048907 Ga0496104_0000013 Ga0496104_0000013_277610_278647 334
422 3300048907 Ga0496104_0000190 Ga0496104_0000190_14811_15851 334
423 3300048908 Ga0496105_0000006 Ga0496105_0000006_118517_119554 334
424 3300048908 Ga0496105_0000197 Ga0496105_0000197_27067_28107 334
425 3300048908 Ga0496105_0079460 Ga0496105_0079460_1604_2641 334
426 3300048909 Ga0496106_0000006 Ga0496106_0000006_3826_4863 334
427 3300048909 Ga0496106_0000333 Ga0496106_0000333_10531_11568 334
428 3300048910 Ga0496107_0000007 Ga0496107_0000007_3828_4865 334
429 3300048910 Ga0496107_0000011 Ga0496107_0000011_87685_88722 334
430 3300048910 Ga0496107_0339628 Ga0496107_0339628_33_1073 334
431 3300048911 Ga0496108_0000001 Ga0496108_0000001_320642_321679 334
432 3300048911 Ga0496108_0000146 Ga0496108_0000146_5054_6088 334
433 3300048911 Ga0496108_0011508 Ga0496108_0011508_2364_3401 334
434 3300048911 Ga0496108_0050659 Ga0496108_0050659_324_1361 334
435 3300048912 Ga0496109_0000006 Ga0496109_0000006_320642_321679 334
436 3300048912 Ga0496109_0000060 Ga0496109_0000060_103589_104623 334
437 3300048912 Ga0496109_0000075 Ga0496109_0000075_94276_95313 334
438 3300048913 Ga0496110_0000287 Ga0496110_0000287_10228_11265 334
439 3300048913 Ga0496110_0010923 Ga0496110_0010923_5672_6709 334
440 3300048914 Ga0496111_0000077 Ga0496111_0000077_5315_6352 334
441 3300048915 Ga0496112_0000006 Ga0496112_0000006_244365_245405 334
442 3300048915 Ga0496112_0012069 Ga0496112_0012069_3851_4888 334
443 3300048916 Ga0496113_0000054 Ga0496113_0000054_46160_47197 334
444 3300048917 Ga0496114_0000088 Ga0496114_0000088_62077_63114 334
445 3300048917 Ga0496114_0071595 Ga0496114_0071595_866_1903 334
446 3300048918 Ga0496115_0000003 Ga0496115_0000003_52689_53726 334
447 3300048918 Ga0496115_0000119 Ga0496115_0000119_8597_9634 334
448 3300048920 Ga0496117_0025669 Ga0496117_0025669_3056_4093 334
449 3300048921 Ga0496118_0005040 Ga0496118_0005040_515_1552 334
450 3300048922 Ga0496119_0078935 Ga0496119_0078935_660_1697 334
451 3300048923 Ga0496120_0001894 Ga0496120_0001894_682_1719 334
452 3300048924 Ga0496121_0032823 Ga0496121_0032823_3258_4295 334
453 3300049568 Ga0501031_0000058 Ga0501031_0000058_55106_56143 334
454 3300049569 Ga0501032_0002722 Ga0501032_0002722_3096_4133 334
455 3300049570 Ga0501033_0015135 Ga0501033_0015135_3103_4140 334
456 3300049571 Ga0501034_0017696 Ga0501034_0017696_3108_4145 334
457 3300049571 Ga0501034_0213834 Ga0501034_0213834_554_1591 334
458 3300049572 Ga0501036_0002950 Ga0501036_0002950_10510_11547 334
459 3300049573 Ga0501037_0002322 Ga0501037_0002322_3089_4126 334
460 3300049574 Ga0501038_0000485 Ga0501038_0000485_30816_31853 334
461 3300049575 Ga0501039_0039291 Ga0501039_0039291_1606_2643 334
462 3300049576 Ga0501040_0031592 Ga0501040_0031592_1138_2175 334
463 3300049579 Ga0501043_0002786 Ga0501043_0002786_10460_11497 334
464 3300049580 Ga0501046_0003436 Ga0501046_0003436_2982_4019 334
465 3300049581 Ga0501047_0000647 Ga0501047_0000647_3100_4137 334
466 3300049581 Ga0501047_0108495 Ga0501047_0108495_691_1728 334
467 3300049581 Ga0501047_0157707 Ga0501047_0157707_661_1698 334
468 3300049582 Ga0501048_0002614 Ga0501048_0002614_3108_4145 334
469 3300049583 Ga0501067_0062069 Ga0501067_0062069_407_1444 334
470 3300049586 Ga0501070_0000309 Ga0501070_0000309_3108_4145 334
471 3300049586 Ga0501070_0166630 Ga0501070_0166630_616_1653 334
472 3300049588 Ga0501072_0008083 Ga0501072_0008083_3619_4734 334
473 3300049589 Ga0501073_0028488 Ga0501073_0028488_1334_2371 334
474 3300049590 Ga0501074_0019790 Ga0501074_0019790_1134_2171 334
475 3300049590 Ga0501074_0033990 Ga0501074_0033990_2194_3231 334
476 3300049591 Ga0501075_0010829 Ga0501075_0010829_2534_3574 334
477 3300049744 Ga0501083_0009824 Ga0501083_0009824_2282_3319 334
478 3300049822 Ga0501035_0020800 Ga0501035_0020800_1588_2625 334
479 3300049823 Ga0501044_0001651 Ga0501044_0001651_3128_4165 334
480 3300053077 Ga0495601_0000032 Ga0495601_0000032_29222_30259 334
481 3300053077 Ga0495601_0000045 Ga0495601_0000045_13021_14058 334
482 3300053077 Ga0495601_0041266 Ga0495601_0041266_1468_2508 334
483 3300053078 Ga0495612_0019153 Ga0495612_0019153_1692_2729 334
484 3300053084 Ga0495595_0000003 Ga0495595_0000003_224563_225600 334
485 3300053084 Ga0495595_0000066 Ga0495595_0000066_566_1606 334
486 3300053084 Ga0495595_0011247 Ga0495595_0011247_1915_2952 334
487 3300053085 Ga0495619_0000032 Ga0495619_0000032_85796_86836 334
488 3300053085 Ga0495619_0000137 Ga0495619_0000137_12578_13615 334
489 3300053085 Ga0495619_0000404 Ga0495619_0000404_22739_23776 334
490 3300053085 Ga0495619_0001777 Ga0495619_0001777_6402_7442 334
491 3300053085 Ga0495619_0015423 Ga0495619_0015423_572_1612 334
492 3300053085 Ga0495619_0154375 Ga0495619_0154375_101_1141 334
493 3300053094 Ga0500566_0003977 Ga0500566_0003977_3935_4972 334
494 3300053119 Ga0500595_039671 Ga0500595_039671_133_1170 334
495 3300053123 Ga0500614_000116 Ga0500614_000116_12503_13540 334
496 3300060353 Ga0501082_0013634 Ga0501082_0013634_2878_3915 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

28

163

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9532 1 233
1reo-assembly1.cif.gz_A l-amino acid oxidase from agkistrodon halys pallas 0.9443 262 289
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9438 3 225
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9434 2 216
6g2p-assembly1.cif.gz_A crystal structure of l-tryptophan oxidase vioa from chromobacterium violaceum in complex with l-tryptophan 0.9418 262 289
ID Description Score Start End Superfamily
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9709 3 234 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.968 2 216 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9676 3 234 3.40.50.300
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9673 3 232 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9667 3 215 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A349H0M9-F1-model_v4 Spermidine/putrescine ABC transporter ATP-binding protein 0.9817 2 144 GO:0005524
GO:0016887
AF-A0A1V4RJG8-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9791 3 146 GO:0005524
GO:0016887
GO:0055052
AF-A0A3D0PSJ0-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9754 3 140 GO:0005524
GO:0016887
GO:0055052
AF-A0A0P9DFL4-F1-model_v4 ABC transporter domain-containing protein 0.9732 2 158 GO:0005524
GO:0016887
AF-A0A2V9R859-F1-model_v4 ABC transporter domain-containing protein 0.9704 1 151 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
87.92 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map