F454755

General Info

Members Datasets Scaffolds Average Seq Length
495 251 990 266

Family's Representative Sequence

Representative Sequence 3300041997|Ga0439431_0005524|Ga0439431_0005524_1808_2779
Length 323
Sequence MHRVLHPVGAPGQVWRDEAVDPVGMGCRAGRPVGLLQDDHRMRLRRGPPDRLKPVRICRFTTGEDPLYGVVTGEVDQFGQPDEDSVIVALAGDPLYVGIKLLEQEHKLADVRLLAPVLPRSKVVGIGRNYAAHAAEMGNELPDEPLMFLKPNTSVVGPGDPIFYPRQTQELHFEGELAVVIGRICRDVPKEKATDVIHGYTIANDVTARDLQRKDGQFTRAKGFDSFCPLGPWIETDLDPQAFVDGVALQTHLNGDLKQDGSTKDMVFDVPSLVAHITSVMTLLPGDVILTGTPEGVGPMNPGDEVEVSIAGIGTLTNKVALR

Samples

Sample ID Description Type Environment
1 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
104 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
117 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
124 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
125 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
126 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
127 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
128 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
129 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
130 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
219 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
220 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 2643221561 Nocardioides sp. Root151 Isolate Unclassified
225 2643221576 Nocardioides sp. Root614 Isolate Unclassified
226 2643221590 Nocardioides sp. Root682 Isolate Unclassified
227 2643221604 Nocardioides sp. Root190 Isolate Unclassified
228 2643221615 Nocardioides sp. Root224 Isolate Unclassified
229 2643221617 Nocardioides sp. Root79 Isolate Unclassified
230 2643221620 Nocardioides sp. Root240 Isolate Unclassified
231 2643221641 Nocardioides sp. Root122 Isolate Unclassified
232 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
233 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
234 2643221696 Nocardioides sp. Root140 Isolate Unclassified
235 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
236 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
237 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
238 2738541305 Nocardioides sp. CF167 Isolate Unclassified
239 2739367898 Nocardioides sp. CF479 Isolate Unclassified
240 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
241 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
242 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
243 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
244 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
245 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
246 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
247 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
248 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
249 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
250 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
251 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.94
Metatranscriptomes 0.4
Isolates 5.66

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 9.9
Nodule 0.2
Rhizoplane 9.9
Rhizosphere 71.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439431_0005524 3300041997 Bacteria 2789
2 LJQas_1008971 3300000549 Bacteria 1208
3 JGI24739J22299_10007132 3300001989 Bacteria 4207
4 JGI24744J21845_10013636 3300002077 Bacteria 1637
5 JGI25406J46586_10020252 3300003203 Bacteria 2694
6 Ga0007423J48922_100590 3300003285 Bacteria 4390
7 JGI25407J50210_10011396 3300003373 Bacteria 2272
8 Ga0070683_100098282 3300005329 Bacteria 2754
9 Ga0070683_100336963 3300005329 Bacteria 1436
10 Ga0070683_100457545 3300005329 Bacteria 1218
11 Ga0070682_100008664 3300005337 Bacteria 5740
12 Ga0070682_100189344 3300005337 Bacteria 1444
13 Ga0070682_100241157 3300005337 Bacteria 1298
14 Ga0068868_100246319 3300005338 Bacteria 1503
15 Ga0070687_100194004 3300005343 Bacteria 1226
16 Ga0070661_100433415 3300005344 Bacteria 1044
17 Ga0070692_10002316 3300005345 Bacteria 7341
18 Ga0070692_10098608 3300005345 Bacteria 1599
19 Ga0070668_100262730 3300005347 Bacteria 1436
20 Ga0070675_100314641 3300005354 Bacteria 1382
21 Ga0070674_100066459 3300005356 Bacteria 2534
22 Ga0070673_100165515 3300005364 Bacteria 1883
23 Ga0070659_100009437 3300005366 Bacteria 7166
24 Ga0070659_100038098 3300005366 Bacteria 3748
25 Ga0070659_100171402 3300005366 Bacteria 1778
26 Ga0070701_10039688 3300005438 Bacteria 2390
27 Ga0070700_100127224 3300005441 Bacteria 1714
28 Ga0070663_100142241 3300005455 Bacteria 1833
29 Ga0070663_100203878 3300005455 Bacteria 1545
30 Ga0070663_100244479 3300005455 Bacteria 1418
31 Ga0070663_100303882 3300005455 Bacteria 1278
32 Ga0070684_100001431 3300005535 Bacteria 17200
33 Ga0070684_100064649 3300005535 Bacteria 3210
34 Ga0070672_100003863 3300005543 Bacteria 9752
35 Ga0070672_100283127 3300005543 Bacteria 1402
36 Ga0070672_100453494 3300005543 Bacteria 1105
37 Ga0070686_100174401 3300005544 Bacteria 1523
38 Ga0070693_100047812 3300005547 Bacteria 2435
39 Ga0070693_100076363 3300005547 Bacteria 1986
40 Ga0070665_100211781 3300005548 Bacteria 1939
41 Ga0070665_100685390 3300005548 Bacteria 1038
42 Ga0070664_100011923 3300005564 Bacteria 7057
43 Ga0068857_100260462 3300005577 Bacteria 1591
44 Ga0068857_100291948 3300005577 Bacteria 1501
45 Ga0068854_100032957 3300005578 Bacteria 3609
46 Ga0068856_100430906 3300005614 Bacteria 1339
47 Ga0070702_100026194 3300005615 Bacteria 3131
48 Ga0070702_100037607 3300005615 Bacteria 2688
49 Ga0068852_100151248 3300005616 Bacteria 2158
50 Ga0068852_100397836 3300005616 Bacteria 1354
51 Ga0068864_100209657 3300005618 Bacteria 1794
52 Ga0068864_100239295 3300005618 Bacteria 1681
53 Ga0068866_10174695 3300005718 Bacteria 1264
54 Ga0068866_10231130 3300005718 Bacteria 1121
55 Ga0068861_100036216 3300005719 Bacteria 3660
56 Ga0068861_100110537 3300005719 Bacteria 2201
57 Ga0068851_10064563 3300005834 Bacteria 1882
58 Ga0068851_10144301 3300005834 Bacteria 1297
59 Ga0068860_100085182 3300005843 Bacteria 3007
60 Ga0081455_10001927 3300005937 Bacteria 24929
61 Ga0081455_10041913 3300005937 Bacteria 4021
62 Ga0081455_10056638 3300005937 Bacteria 3327
63 Ga0081538_10000520 3300005981 Bacteria 43003
64 Ga0081538_10024225 3300005981 Bacteria 4329
65 Ga0081539_10000100 3300005985 Bacteria 199516
66 Ga0081539_10107085 3300005985 Bacteria 1414
67 Ga0075365_10003586 3300006038 Bacteria 8029
68 Ga0075365_10020134 3300006038 Bacteria 4131
69 Ga0075365_10031235 3300006038 Bacteria 3416
70 Ga0075365_10072355 3300006038 Bacteria 2322
71 Ga0075365_10143608 3300006038 Bacteria 1657
72 Ga0075368_10005889 3300006042 Bacteria 4245
73 Ga0075368_10018737 3300006042 Bacteria 2605
74 Ga0075368_10023471 3300006042 Bacteria 2356
75 Ga0075363_100026170 3300006048 Bacteria 2982
76 Ga0075363_100045332 3300006048 Bacteria 2331
77 Ga0075363_100049487 3300006048 Bacteria 2238
78 Ga0075364_10029222 3300006051 Bacteria 3534
79 Ga0075364_10030562 3300006051 Bacteria 3458
80 Ga0075364_10066163 3300006051 Bacteria 2374
81 Ga0075364_10074456 3300006051 Bacteria 2239
82 Ga0075364_10315590 3300006051 Bacteria 1064
83 Ga0075364_10349461 3300006051 Bacteria 1008
84 Ga0075367_10012162 3300006178 Bacteria 4578
85 Ga0075367_10058818 3300006178 Bacteria 2287
86 Ga0075367_10101094 3300006178 Bacteria 1763
87 Ga0075370_10018757 3300006353 Bacteria 3757
88 Ga0075370_10260768 3300006353 Bacteria 1028
89 Ga0075428_100019073 3300006844 Bacteria 7585
90 Ga0075428_100457061 3300006844 Bacteria 1367
91 Ga0075428_100715182 3300006844 Bacteria 1067
92 Ga0075430_100008668 3300006846 Bacteria 8579
93 Ga0075430_100026972 3300006846 Bacteria 4885
94 Ga0075431_100000515 3300006847 Bacteria 32391
95 Ga0075431_100009390 3300006847 Bacteria 9820
96 Ga0075431_100090155 3300006847 Bacteria 3164
97 Ga0075433_10318090 3300006852 Bacteria 1377
98 Ga0075434_100146026 3300006871 Bacteria 2386
99 Ga0075429_100002611 3300006880 Bacteria 15189
100 Ga0075429_100299674 3300006880 Bacteria 1407
101 Ga0111539_10192062 3300009094 Bacteria 2382
102 Ga0105245_10010232 3300009098 Bacteria 8168
103 Ga0105245_10863737 3300009098 Bacteria 945
104 Ga0114129_10010877 3300009147 Bacteria 12962
105 Ga0114129_10022085 3300009147 Bacteria 9030
106 Ga0114129_10222069 3300009147 Bacteria 2548
107 Ga0105243_10113260 3300009148 Bacteria 2274
108 Ga0105242_10055203 3300009176 Bacteria 3250
109 Ga0105248_10106908 3300009177 Bacteria 3155
110 Ga0105238_10172626 3300009551 Bacteria 2138
111 Ga0105249_10038621 3300009553 Bacteria 4332
112 Ga0105239_10021614 3300010375 Bacteria 7094
113 Ga0105246_10005184 3300011119 Bacteria 7921
114 Ga0157369_10357953 3300013105 Bacteria 1515
115 Ga0163162_10043883 3300013306 Bacteria 4477
116 Ga0157372_10147570 3300013307 Bacteria 2712
117 Ga0157372_10152595 3300013307 Bacteria 2667
118 Ga0157372_10355077 3300013307 Bacteria 1708
119 Ga0157372_10849537 3300013307 Bacteria 1060
120 Ga0157375_10007260 3300013308 Bacteria 9694
121 Ga0157375_10591644 3300013308 Bacteria 1269
122 Ga0163163_10442034 3300014325 Bacteria 1360
123 Ga0157380_10670634 3300014326 Bacteria 1037
124 Ga0157379_10051288 3300014968 Bacteria 3685
125 Ga0163161_10281009 3300017792 Bacteria 1306
126 Ga0163161_10362440 3300017792 Bacteria 1155
127 Ga0206353_11889805 3300020082 Bacteria 2626
128 Ga0207642_10184802 3300025899 Bacteria 1139
129 Ga0207688_10006447 3300025901 Bacteria 6391
130 Ga0207647_10007381 3300025904 Bacteria 7948
131 Ga0207657_10015235 3300025919 Bacteria 7458
132 Ga0207657_10164980 3300025919 Bacteria 1797
133 Ga0207652_10189539 3300025921 Bacteria 1850
134 Ga0207652_10611879 3300025921 Bacteria 976
135 Ga0207687_10056907 3300025927 Bacteria 2744
136 Ga0207687_10126093 3300025927 Bacteria 1922
137 Ga0207690_10033114 3300025932 Bacteria 3321
138 Ga0207709_10374265 3300025935 Bacteria 1082
139 Ga0207669_10067114 3300025937 Bacteria 2234
140 Ga0207669_10196983 3300025937 Bacteria 1459
141 Ga0207704_10029652 3300025938 Bacteria 3055
142 Ga0207691_10006136 3300025940 Bacteria 11618
143 Ga0207691_10151810 3300025940 Bacteria 2036
144 Ga0207661_10027898 3300025944 Bacteria 4318
145 Ga0207661_10081565 3300025944 Bacteria 2672
146 Ga0207661_10149314 3300025944 Bacteria 2019
147 Ga0207661_10204294 3300025944 Bacteria 1738
148 Ga0207661_10206203 3300025944 Bacteria 1731
149 Ga0207679_10129641 3300025945 Bacteria 2021
150 Ga0207667_10612065 3300025949 Bacteria 1097
151 Ga0207712_10121862 3300025961 Bacteria 1974
152 Ga0207712_10257679 3300025961 Bacteria 1413
153 Ga0207668_10046882 3300025972 Bacteria 2956
154 Ga0207668_10163838 3300025972 Bacteria 1736
155 Ga0207640_10127651 3300025981 Bacteria 1833
156 Ga0207677_10388043 3300026023 Bacteria 1180
157 Ga0207678_10090611 3300026067 Bacteria 2613
158 Ga0207678_10233299 3300026067 Bacteria 1576
159 Ga0207708_10000645 3300026075 Bacteria 26768
160 Ga0207708_10133691 3300026075 Bacteria 1941
161 Ga0207708_10323441 3300026075 Bacteria 1259
162 Ga0207702_10214221 3300026078 Bacteria 1792
163 Ga0207648_10010652 3300026089 Bacteria 8691
164 Ga0207676_10163197 3300026095 Bacteria 1933
165 Ga0207676_10196225 3300026095 Bacteria 1780
166 Ga0207674_10032020 3300026116 Bacteria 5518
167 Ga0207675_100015679 3300026118 Bacteria 7068
168 Ga0207683_10148852 3300026121 Bacteria 2112
169 Ga0207683_10215611 3300026121 Bacteria 1748
170 Ga0207683_10759957 3300026121 Bacteria 899
171 Ga0207698_10717973 3300026142 Bacteria 996
172 Ga0209813_10003410 3300027866 Bacteria 3719
173 Ga0209813_10037252 3300027866 Bacteria 1465
174 Ga0207428_10018281 3300027907 Bacteria 5990
175 Ga0268266_10004964 3300028379 Bacteria 12591
176 Ga0268264_10067464 3300028381 Bacteria 3020
177 Ga0307512_10267818 3300030522 Bacteria 831
178 Ga0316182_1400940 3300030745 Bacteria 1310
179 Ga0307513_10409244 3300031456 Bacteria 1089
180 Ga0307508_10257148 3300031616 Bacteria 1342
181 Ga0316576_10001620 3300031727 Bacteria 12291
182 Ga0316578_10039382 3300031728 Bacteria 2730
183 Ga0307413_10217898 3300031824 Bacteria 1392
184 Ga0307413_10270048 3300031824 Bacteria 1273
185 Ga0307518_10066956 3300031838 Bacteria 2605
186 Ga0307410_10195069 3300031852 Bacteria 1542
187 Ga0307407_10088638 3300031903 Bacteria 1891
188 Ga0307407_10331109 3300031903 Bacteria 1072
189 Ga0307412_10287038 3300031911 Bacteria 1294
190 Ga0307409_100050463 3300031995 Bacteria 3178
191 Ga0307409_100078283 3300031995 Bacteria 2659
192 Ga0307409_100219991 3300031995 Bacteria 1714
193 Ga0307409_100660320 3300031995 Bacteria 1041
194 Ga0307411_10084293 3300032005 Bacteria 2198
195 Ga0316574_0001374 3300035398 Bacteria 11469
196 Ga0316584_0008584 3300036712 Bacteria 7047
197 Ga0395899_0015711 3300037312 Bacteria 5772
198 Ga0395899_0101901 3300037312 Bacteria 2071
199 Ga0395900_0047329 3300037418 Bacteria 4428
200 Ga0395900_0186282 3300037418 Bacteria 2107
201 Ga0395898_0018046 3300037466 Bacteria 7199
202 Ga0395898_0055425 3300037466 Bacteria 3866
203 Ga0395898_0319061 3300037466 Bacteria 1482
204 Ga0395905_0057882 3300037471 Bacteria 3625
205 Ga0395901_0013113 3300038443 Bacteria 8411
206 Ga0395901_0028796 3300038443 Bacteria 5714
207 Ga0395901_0103195 3300038443 Bacteria 2992
208 Ga0395901_0350917 3300038443 Bacteria 1522
209 Ga0395901_0540380 3300038443 Bacteria 1182
210 Ga0451789_1304324 3300041443 Bacteria 1037
211 Ga0451791_1056838 3300041451 Bacteria 2923
212 Ga0451797_0491081 3300041453 Bacteria 2147
213 Ga0451833_0320848 3300041491 Bacteria 8124
214 Ga0451843_1326602 3300041509 Bacteria 2915
215 Ga0439442_044409 3300042002 Bacteria 936
216 Ga0439457_034584 3300042014 Bacteria 1123
217 Ga0439446_0054699 3300042156 Bacteria 1197
218 Ga0466972_0027194 3300044658 Bacteria 2831
219 Ga0466972_0038715 3300044658 Bacteria 2329
220 Ga0466972_0082675 3300044658 Bacteria 1528
221 Ga0466965_0101940 3300044683 Bacteria 1468
222 Ga0466966_0032285 3300044684 Bacteria 3394
223 Ga0466966_0218427 3300044684 Bacteria 1151
224 Ga0466961_0021399 3300044693 Bacteria 4163
225 Ga0466961_0027546 3300044693 Bacteria 3655
226 Ga0466961_0032098 3300044693 Bacteria 3375
227 Ga0466961_0052004 3300044693 Bacteria 2615
228 Ga0466963_0004722 3300044694 Bacteria 7955
229 Ga0466963_0062779 3300044694 Bacteria 2485
230 Ga0466963_0154915 3300044694 Bacteria 1592
231 Ga0466963_0258496 3300044694 Bacteria 1222
232 Ga0466963_0315544 3300044694 Bacteria 1100
233 Ga0466964_0015592 3300044706 Bacteria 2893
234 Ga0466971_0005413 3300044719 Bacteria 5536
235 Ga0466971_0037621 3300044719 Bacteria 2170
236 Ga0466971_0140924 3300044719 Bacteria 1122
237 Ga0466968_0050216 3300044735 Bacteria 1779
238 Ga0466970_0005621 3300044765 Bacteria 6227
239 Ga0466970_0006666 3300044765 Bacteria 5775
240 Ga0466970_0039416 3300044765 Bacteria 2507
241 Ga0466970_0042125 3300044765 Bacteria 2428
242 Ga0466957_0078604 3300044842 Bacteria 2051
243 Ga0466957_0089933 3300044842 Bacteria 1922
244 Ga0466960_0019937 3300044901 Bacteria 2962
245 Ga0466960_0022499 3300044901 Bacteria 2819
246 Ga0466960_0026916 3300044901 Bacteria 2617
247 Ga0466960_0042106 3300044901 Bacteria 2167
248 Ga0466960_0057192 3300044901 Bacteria 1901
249 Ga0466960_0100594 3300044901 Bacteria 1488
250 Ga0466960_0122146 3300044901 Bacteria 1365
251 Ga0466960_0173719 3300044901 Bacteria 1164
252 Ga0466959_0065658 3300045049 Bacteria 2633
253 Ga0451576_0117576 3300045051 Bacteria 2768
254 Ga0466958_0010864 3300045836 Bacteria 5113
255 Ga0466958_0077609 3300045836 Bacteria 2040
256 Ga0466958_0218892 3300045836 Bacteria 1214
257 Ga0466967_0010411 3300045976 Bacteria 6977
258 Ga0466967_0024637 3300045976 Bacteria 4951
259 Ga0466967_0042183 3300045976 Bacteria 3941
260 Ga0466967_0100071 3300045976 Bacteria 2648
261 Ga0466967_0105440 3300045976 Bacteria 2582
262 Ga0466967_0122623 3300045976 Bacteria 2404
263 Ga0466967_0257032 3300045976 Bacteria 1670
264 Ga0466967_0268570 3300045976 Bacteria 1634
265 Ga0495627_011597 3300046453 Bacteria 3157
266 Ga0495603_0178857 3300046455 Bacteria 1228
267 Ga0495651_0290924 3300046462 Bacteria 1099
268 Ga0495585_0109032 3300046492 Bacteria 1474
269 Ga0495645_0189028 3300046543 Bacteria 1405
270 Ga0495625_0066694 3300046660 Bacteria 2535
271 Ga0495672_0191014 3300047320 Bacteria 1030
272 Ga0495676_0128061 3300047321 Bacteria 1837
273 Ga0496100_0048607 3300048903 Bacteria 2739
274 Ga0496100_0159207 3300048903 Bacteria 1617
275 Ga0496101_0064179 3300048904 Bacteria 2675
276 Ga0496101_0196949 3300048904 Bacteria 1556
277 Ga0496102_0004847 3300048905 Bacteria 11382
278 Ga0496102_0038188 3300048905 Bacteria 4333
279 Ga0496102_0092687 3300048905 Bacteria 2798
280 Ga0496103_0007376 3300048906 Bacteria 6554
281 Ga0496103_0077384 3300048906 Bacteria 2088
282 Ga0496104_0002731 3300048907 Bacteria 15184
283 Ga0496104_0139147 3300048907 Bacteria 2333
284 Ga0496104_0170084 3300048907 Bacteria 2090
285 Ga0496105_0001147 3300048908 Bacteria 18488
286 Ga0496106_0035347 3300048909 Bacteria 3736
287 Ga0496106_0244337 3300048909 Bacteria 1434
288 Ga0496107_0011920 3300048910 Bacteria 6070
289 Ga0496107_0114651 3300048910 Bacteria 1983
290 Ga0496108_0002735 3300048911 Bacteria 14104
291 Ga0496108_0125811 3300048911 Bacteria 2200
292 Ga0496109_0019916 3300048912 Bacteria 5922
293 Ga0496109_0021830 3300048912 Bacteria 5666
294 Ga0496109_0025990 3300048912 Bacteria 5218
295 Ga0496109_0027472 3300048912 Bacteria 5081
296 Ga0496109_0059017 3300048912 Bacteria 3505
297 Ga0496109_0094342 3300048912 Bacteria 2770
298 Ga0496109_0745391 3300048912 Bacteria 917
299 Ga0496110_0062348 3300048913 Bacteria 3293
300 Ga0496110_0075355 3300048913 Bacteria 2998
301 Ga0496110_0096748 3300048913 Bacteria 2645
302 Ga0496110_0272055 3300048913 Bacteria 1542
303 Ga0496110_0661993 3300048913 Bacteria 944
304 Ga0496111_0007915 3300048914 Bacteria 7008
305 Ga0496111_0115297 3300048914 Bacteria 1981
306 Ga0496111_0250675 3300048914 Bacteria 1314
307 Ga0496111_0299503 3300048914 Bacteria 1192
308 Ga0496112_0083833 3300048915 Bacteria 3153
309 Ga0496112_0202714 3300048915 Bacteria 1943
310 Ga0496114_0012051 3300048917 Bacteria 6917
311 Ga0496114_0022061 3300048917 Bacteria 5184
312 Ga0496114_0029815 3300048917 Bacteria 4485
313 Ga0496114_0113183 3300048917 Bacteria 2326
314 Ga0496114_0230740 3300048917 Bacteria 1626
315 Ga0496114_0294388 3300048917 Bacteria 1432
316 Ga0496114_0507702 3300048917 Bacteria 1066
317 Ga0496114_0710676 3300048917 Bacteria 881
318 Ga0496115_0007350 3300048918 Bacteria 8104
319 Ga0496118_0008873 3300048921 Bacteria 10276
320 Ga0496118_0030981 3300048921 Bacteria 4447
321 Ga0496122_0000891 3300048925 Bacteria 55619
322 Ga0496122_0086805 3300048925 Bacteria 2152
323 Ga0496123_0182142 3300048926 Bacteria 1096
324 Ga0496123_0190658 3300048926 Bacteria 1061
325 Ga0496124_0063458 3300048927 Bacteria 3086
326 Ga0496124_0184020 3300048927 Bacteria 1605
327 Ga0496125_0000075 3300048928 Bacteria 234414
328 Ga0496126_0300452 3300048929 Bacteria 1325
329 Ga0501031_0000193 3300049568 Bacteria 34407
330 Ga0501031_0041612 3300049568 Bacteria 2999
331 Ga0501031_0196532 3300049568 Bacteria 1316
332 Ga0501032_0000056 3300049569 Bacteria 98236
333 Ga0501032_0048307 3300049569 Bacteria 2873
334 Ga0501033_0000941 3300049570 Bacteria 26478
335 Ga0501033_0001634 3300049570 Bacteria 19675
336 Ga0501034_0001881 3300049571 Bacteria 26609
337 Ga0501034_0005938 3300049571 Bacteria 13232
338 Ga0501034_0081642 3300049571 Bacteria 3235
339 Ga0501034_0498021 3300049571 Bacteria 1132
340 Ga0501036_0000057 3300049572 Bacteria 72542
341 Ga0501036_0025044 3300049572 Bacteria 5032
342 Ga0501036_0126371 3300049572 Bacteria 2159
343 Ga0501037_0000361 3300049573 Bacteria 38179
344 Ga0501037_0018908 3300049573 Bacteria 5078
345 Ga0501037_0023452 3300049573 Bacteria 4562
346 Ga0501037_0128362 3300049573 Bacteria 1819
347 Ga0501038_0000391 3300049574 Bacteria 37957
348 Ga0501038_0004282 3300049574 Bacteria 13269
349 Ga0501038_0034364 3300049574 Bacteria 4458
350 Ga0501039_0000309 3300049575 Bacteria 34600
351 Ga0501039_0015430 3300049575 Bacteria 5848
352 Ga0501039_0021455 3300049575 Bacteria 4954
353 Ga0501039_0041680 3300049575 Bacteria 3547
354 Ga0501039_0277263 3300049575 Bacteria 1318
355 Ga0501039_0338313 3300049575 Bacteria 1183
356 Ga0501040_0131407 3300049576 Bacteria 1761
357 Ga0501042_0041648 3300049578 Bacteria 3267
358 Ga0501043_0000111 3300049579 Bacteria 76773
359 Ga0501043_0050851 3300049579 Bacteria 3257
360 Ga0501043_0083386 3300049579 Bacteria 2513
361 Ga0501046_0000701 3300049580 Bacteria 32353
362 Ga0501046_0002307 3300049580 Bacteria 17988
363 Ga0501046_0002990 3300049580 Bacteria 15625
364 Ga0501046_0032219 3300049580 Bacteria 4245
365 Ga0501047_0000289 3300049581 Bacteria 57793
366 Ga0501047_0024327 3300049581 Bacteria 5813
367 Ga0501047_0186787 3300049581 Bacteria 1937
368 Ga0501048_0000298 3300049582 Bacteria 33825
369 Ga0501048_0001668 3300049582 Bacteria 16909
370 Ga0501048_0053818 3300049582 Bacteria 2860
371 Ga0501067_0004218 3300049583 Bacteria 7930
372 Ga0501067_0013753 3300049583 Bacteria 4481
373 Ga0501067_0015898 3300049583 Bacteria 4162
374 Ga0501067_0017309 3300049583 Bacteria 3983
375 Ga0501067_0037115 3300049583 Bacteria 2706
376 Ga0501067_0038576 3300049583 Bacteria 2652
377 Ga0501067_0128897 3300049583 Bacteria 1408
378 Ga0501068_0352399 3300049584 Bacteria 946
379 Ga0501069_0053045 3300049585 Bacteria 2258
380 Ga0501069_0121179 3300049585 Bacteria 1494
381 Ga0501070_0001132 3300049586 Bacteria 23911
382 Ga0501070_0047716 3300049586 Bacteria 3558
383 Ga0501070_0062780 3300049586 Bacteria 3077
384 Ga0501070_0077527 3300049586 Bacteria 2750
385 Ga0501070_0196957 3300049586 Bacteria 1654
386 Ga0501070_0356668 3300049586 Bacteria 1186
387 Ga0501070_0460562 3300049586 Bacteria 1024
388 Ga0501071_0162472 3300049587 Bacteria 1670
389 Ga0501071_0164858 3300049587 Bacteria 1658
390 Ga0501072_0004685 3300049588 Bacteria 10419
391 Ga0501072_0132186 3300049588 Bacteria 1989
392 Ga0501072_0159056 3300049588 Bacteria 1802
393 Ga0501073_0019582 3300049589 Bacteria 4882
394 Ga0501073_0021646 3300049589 Bacteria 4633
395 Ga0501073_0072433 3300049589 Bacteria 2400
396 Ga0501073_0083294 3300049589 Bacteria 2225
397 Ga0501073_0153105 3300049589 Bacteria 1598
398 Ga0501074_0000074 3300049590 Bacteria 48322
399 Ga0501074_0001568 3300049590 Bacteria 15458
400 Ga0501074_0043654 3300049590 Bacteria 3245
401 Ga0501075_0079684 3300049591 Bacteria 2478
402 Ga0501076_0074918 3300049592 Bacteria 2712
403 Ga0501076_0387202 3300049592 Bacteria 1149
404 Ga0501077_0047940 3300049593 Bacteria 2714
405 Ga0501077_0278448 3300049593 Bacteria 1064
406 Ga0501080_0000244 3300049742 Bacteria 40757
407 Ga0501080_0004040 3300049742 Bacteria 12996
408 Ga0501080_0059650 3300049742 Bacteria 3550
409 Ga0501080_0125678 3300049742 Bacteria 2375
410 Ga0501080_0370802 3300049742 Bacteria 1291
411 Ga0501081_0318090 3300049743 Bacteria 1143
412 Ga0501083_0033258 3300049744 Bacteria 3532
413 Ga0501035_0000262 3300049822 Bacteria 62472
414 Ga0501035_0006844 3300049822 Bacteria 10653
415 Ga0501035_0128066 3300049822 Bacteria 2215
416 Ga0501035_0171576 3300049822 Bacteria 1873
417 Ga0501035_0277992 3300049822 Bacteria 1416
418 Ga0501044_0000312 3300049823 Bacteria 61322
419 Ga0501044_0016806 3300049823 Bacteria 7852
420 Ga0501044_0234645 3300049823 Bacteria 1780
421 Ga0501044_0411821 3300049823 Bacteria 1263
422 Ga0501044_0542478 3300049823 Bacteria 1061
423 Ga0501045_0073800 3300049824 Bacteria 2513
424 nmdc:mga03n38_104140_c1 3300050490 Bacteria 1373
425 nmdc:mga03n38_30919_c1 3300050490 Bacteria 2255
426 nmdc:mga03n38_53964_c1 3300050490 Bacteria 1805
427 nmdc:mga00v17_109631_c1 3300050491 Bacteria 1750
428 nmdc:mga00v17_1298_c1 3300050491 Bacteria 13098
429 nmdc:mga00v17_16513_c1 3300050491 Bacteria 4159
430 nmdc:mga00v17_24277_c1 3300050491 Bacteria 2754
431 nmdc:mga00v17_27028_c1 3300050491 Bacteria 3347
432 nmdc:mga00v17_30988_c1 3300050491 Bacteria 3151
433 nmdc:mga00v17_60484_c1 3300050491 Bacteria 2326
434 nmdc:mga00v17_61437_c1 3300050491 Bacteria 2310
435 nmdc:mga0yw44_101874_c1 3300050492 Bacteria 1830
436 nmdc:mga0yw44_13137_c1 3300050492 Bacteria 4348
437 nmdc:mga0yw44_141850_c1 3300050492 Bacteria 1562
438 nmdc:mga0yw44_1958_c2 3300050492 Bacteria 4311
439 nmdc:mga0yw44_241844_c1 3300050492 Bacteria 1200
440 nmdc:mga0yw44_260894_c1 3300050492 Bacteria 1155
441 nmdc:mga0yw44_36644_c1 3300050492 Bacteria 2891
442 nmdc:mga06z11_106592_c1 3300050494 Bacteria 1545
443 nmdc:mga06z11_213759_c1 3300050494 Bacteria 1125
444 nmdc:mga06z11_56139_c1 3300050494 Bacteria 2036
445 nmdc:mga04h51_40008_c1 3300050495 Bacteria 1526
446 nmdc:mga07m45_182887_c1 3300050496 Bacteria 1219
447 nmdc:mga05p37_1229_c1 3300050507 Bacteria 29692
448 nmdc:mga05p37_500679_c1 3300050507 Bacteria 1394
449 nmdc:mga05p37_92669_c1 3300050507 Bacteria 3723
450 nmdc:mga09592_329704_c1 3300050508 Bacteria 1322
451 nmdc:mga09592_555_c1 3300050508 Bacteria 28350
452 nmdc:mga06r32_1106_c1 3300050510 Bacteria 24182
453 nmdc:mga06r32_761_c1 3300050510 Bacteria 28397
454 nmdc:mga08y16_168816_c1 3300050511 Bacteria 2273
455 nmdc:mga08y16_17310_c1 3300050511 Bacteria 7587
456 nmdc:mga0n895_183617_c1 3300050512 Bacteria 2123
457 nmdc:mga0a205_88408_c1 3300050515 Bacteria 2994
458 Ga0495655_0011025 3300053083 Bacteria 1803
459 Ga0500556_0000671 3300053104 Bacteria 21241
460 Ga0500573_0003030 3300053140 Bacteria 8605
461 Ga0501084_0002359 3300054114 Bacteria 15195
462 Ga0501084_0277749 3300054114 Bacteria 1414
463 Ga0501082_0031102 3300060353 Bacteria 4601
464 Ga0501082_0032577 3300060353 Bacteria 4495
465 Ga0501082_0080914 3300060353 Bacteria 2803
466 Ga0501082_0179163 3300060353 Bacteria 1843
467 Ga0466962_0135277 3300061719 Bacteria 1192
468 2643825318 2643221561 Bacteria 4984412
469 2643893191 2643221576 Bacteria 5214352
470 2643961750 2643221590 Bacteria 5214697
471 2644034080 2643221604 Bacteria 5014917
472 2644089890 2643221615 Bacteria 5487866
473 2644102550 2643221617 Bacteria 5139111
474 2644118213 2643221620 Bacteria 5134593
475 2644231415 2643221641 Bacteria 4490190
476 2644319735 2643221657 Bacteria 5490246
477 2644456489 2643221681 Bacteria 3707866
478 2644531311 2643221696 Bacteria 5431823
479 2644537020 2643221697 Bacteria 3575694
480 2645723092 2643221961 Bacteria 3919167
481 2645726039 2643221962 Bacteria 3874254
482 2738871286 2738541305 Bacteria 4910150
483 2740166734 2739367898 Bacteria 4367674
484 2774393686 2773857762 Bacteria 5971770
485 2809195431 2808606439 Bacteria 5952208
486 2812350311 2811994878 Bacteria 5992952
487 2855387569 2855386786 Bacteria 4752232
488 2857484094 2857481737 Bacteria 4761446
489 2883825166 2883821847 Bacteria 5121194
490 2891972068 2891968417 Bacteria 5821697
491 2946005073 2946003308 Bacteria 3857229
492 2966923986 2966921586 Bacteria 3092803
493 2984577110 2984576629 Bacteria 4248407
494 2990258857 2990256926 Bacteria 4252839
495 8054612459 8054609563 Bacteria 5170090
496 Ga0439431_0005524
497 LJQas_1008971
498 JGI24739J22299_10007132
499 JGI24744J21845_10013636
500 JGI25406J46586_10020252
501 Ga0007423J48922_100590
502 JGI25407J50210_10011396
503 Ga0070683_100098282
504 Ga0070683_100336963
505 Ga0070683_100457545
506 Ga0070682_100008664
507 Ga0070682_100189344
508 Ga0070682_100241157
509 Ga0068868_100246319
510 Ga0070687_100194004
511 Ga0070661_100433415
512 Ga0070692_10002316
513 Ga0070692_10098608
514 Ga0070668_100262730
515 Ga0070675_100314641
516 Ga0070674_100066459
517 Ga0070673_100165515
518 Ga0070659_100009437
519 Ga0070659_100038098
520 Ga0070659_100171402
521 Ga0070701_10039688
522 Ga0070700_100127224
523 Ga0070663_100142241
524 Ga0070663_100203878
525 Ga0070663_100244479
526 Ga0070663_100303882
527 Ga0070684_100001431
528 Ga0070684_100064649
529 Ga0070672_100003863
530 Ga0070672_100283127
531 Ga0070672_100453494
532 Ga0070686_100174401
533 Ga0070693_100047812
534 Ga0070693_100076363
535 Ga0070665_100211781
536 Ga0070665_100685390
537 Ga0070664_100011923
538 Ga0068857_100260462
539 Ga0068857_100291948
540 Ga0068854_100032957
541 Ga0068856_100430906
542 Ga0070702_100026194
543 Ga0070702_100037607
544 Ga0068852_100151248
545 Ga0068852_100397836
546 Ga0068864_100209657
547 Ga0068864_100239295
548 Ga0068866_10174695
549 Ga0068866_10231130
550 Ga0068861_100036216
551 Ga0068861_100110537
552 Ga0068851_10064563
553 Ga0068851_10144301
554 Ga0068860_100085182
555 Ga0081455_10001927
556 Ga0081455_10041913
557 Ga0081455_10056638
558 Ga0081538_10000520
559 Ga0081538_10024225
560 Ga0081539_10000100
561 Ga0081539_10107085
562 Ga0075365_10003586
563 Ga0075365_10020134
564 Ga0075365_10031235
565 Ga0075365_10072355
566 Ga0075365_10143608
567 Ga0075368_10005889
568 Ga0075368_10018737
569 Ga0075368_10023471
570 Ga0075363_100026170
571 Ga0075363_100045332
572 Ga0075363_100049487
573 Ga0075364_10029222
574 Ga0075364_10030562
575 Ga0075364_10066163
576 Ga0075364_10074456
577 Ga0075364_10315590
578 Ga0075364_10349461
579 Ga0075367_10012162
580 Ga0075367_10058818
581 Ga0075367_10101094
582 Ga0075370_10018757
583 Ga0075370_10260768
584 Ga0075428_100019073
585 Ga0075428_100457061
586 Ga0075428_100715182
587 Ga0075430_100008668
588 Ga0075430_100026972
589 Ga0075431_100000515
590 Ga0075431_100009390
591 Ga0075431_100090155
592 Ga0075433_10318090
593 Ga0075434_100146026
594 Ga0075429_100002611
595 Ga0075429_100299674
596 Ga0111539_10192062
597 Ga0105245_10010232
598 Ga0105245_10863737
599 Ga0114129_10010877
600 Ga0114129_10022085
601 Ga0114129_10222069
602 Ga0105243_10113260
603 Ga0105242_10055203
604 Ga0105248_10106908
605 Ga0105238_10172626
606 Ga0105249_10038621
607 Ga0105239_10021614
608 Ga0105246_10005184
609 Ga0157369_10357953
610 Ga0163162_10043883
611 Ga0157372_10147570
612 Ga0157372_10152595
613 Ga0157372_10355077
614 Ga0157372_10849537
615 Ga0157375_10007260
616 Ga0157375_10591644
617 Ga0163163_10442034
618 Ga0157380_10670634
619 Ga0157379_10051288
620 Ga0163161_10281009
621 Ga0163161_10362440
622 Ga0206353_11889805
623 Ga0207642_10184802
624 Ga0207688_10006447
625 Ga0207647_10007381
626 Ga0207657_10015235
627 Ga0207657_10164980
628 Ga0207652_10189539
629 Ga0207652_10611879
630 Ga0207687_10056907
631 Ga0207687_10126093
632 Ga0207690_10033114
633 Ga0207709_10374265
634 Ga0207669_10067114
635 Ga0207669_10196983
636 Ga0207704_10029652
637 Ga0207691_10006136
638 Ga0207691_10151810
639 Ga0207661_10027898
640 Ga0207661_10081565
641 Ga0207661_10149314
642 Ga0207661_10204294
643 Ga0207661_10206203
644 Ga0207679_10129641
645 Ga0207667_10612065
646 Ga0207712_10121862
647 Ga0207712_10257679
648 Ga0207668_10046882
649 Ga0207668_10163838
650 Ga0207640_10127651
651 Ga0207677_10388043
652 Ga0207678_10090611
653 Ga0207678_10233299
654 Ga0207708_10000645
655 Ga0207708_10133691
656 Ga0207708_10323441
657 Ga0207702_10214221
658 Ga0207648_10010652
659 Ga0207676_10163197
660 Ga0207676_10196225
661 Ga0207674_10032020
662 Ga0207675_100015679
663 Ga0207683_10148852
664 Ga0207683_10215611
665 Ga0207683_10759957
666 Ga0207698_10717973
667 Ga0209813_10003410
668 Ga0209813_10037252
669 Ga0207428_10018281
670 Ga0268266_10004964
671 Ga0268264_10067464
672 Ga0307512_10267818
673 Ga0316182_1400940
674 Ga0307513_10409244
675 Ga0307508_10257148
676 Ga0316576_10001620
677 Ga0316578_10039382
678 Ga0307413_10217898
679 Ga0307413_10270048
680 Ga0307518_10066956
681 Ga0307410_10195069
682 Ga0307407_10088638
683 Ga0307407_10331109
684 Ga0307412_10287038
685 Ga0307409_100050463
686 Ga0307409_100078283
687 Ga0307409_100219991
688 Ga0307409_100660320
689 Ga0307411_10084293
690 Ga0316574_0001374
691 Ga0316584_0008584
692 Ga0395899_0015711
693 Ga0395899_0101901
694 Ga0395900_0047329
695 Ga0395900_0186282
696 Ga0395898_0018046
697 Ga0395898_0055425
698 Ga0395898_0319061
699 Ga0395905_0057882
700 Ga0395901_0013113
701 Ga0395901_0028796
702 Ga0395901_0103195
703 Ga0395901_0350917
704 Ga0395901_0540380
705 Ga0451789_1304324
706 Ga0451791_1056838
707 Ga0451797_0491081
708 Ga0451833_0320848
709 Ga0451843_1326602
710 Ga0439442_044409
711 Ga0439457_034584
712 Ga0439446_0054699
713 Ga0466972_0027194
714 Ga0466972_0038715
715 Ga0466972_0082675
716 Ga0466965_0101940
717 Ga0466966_0032285
718 Ga0466966_0218427
719 Ga0466961_0021399
720 Ga0466961_0027546
721 Ga0466961_0032098
722 Ga0466961_0052004
723 Ga0466963_0004722
724 Ga0466963_0062779
725 Ga0466963_0154915
726 Ga0466963_0258496
727 Ga0466963_0315544
728 Ga0466964_0015592
729 Ga0466971_0005413
730 Ga0466971_0037621
731 Ga0466971_0140924
732 Ga0466968_0050216
733 Ga0466970_0005621
734 Ga0466970_0006666
735 Ga0466970_0039416
736 Ga0466970_0042125
737 Ga0466957_0078604
738 Ga0466957_0089933
739 Ga0466960_0019937
740 Ga0466960_0022499
741 Ga0466960_0026916
742 Ga0466960_0042106
743 Ga0466960_0057192
744 Ga0466960_0100594
745 Ga0466960_0122146
746 Ga0466960_0173719
747 Ga0466959_0065658
748 Ga0451576_0117576
749 Ga0466958_0010864
750 Ga0466958_0077609
751 Ga0466958_0218892
752 Ga0466967_0010411
753 Ga0466967_0024637
754 Ga0466967_0042183
755 Ga0466967_0100071
756 Ga0466967_0105440
757 Ga0466967_0122623
758 Ga0466967_0257032
759 Ga0466967_0268570
760 Ga0495627_011597
761 Ga0495603_0178857
762 Ga0495651_0290924
763 Ga0495585_0109032
764 Ga0495645_0189028
765 Ga0495625_0066694
766 Ga0495672_0191014
767 Ga0495676_0128061
768 Ga0496100_0048607
769 Ga0496100_0159207
770 Ga0496101_0064179
771 Ga0496101_0196949
772 Ga0496102_0004847
773 Ga0496102_0038188
774 Ga0496102_0092687
775 Ga0496103_0007376
776 Ga0496103_0077384
777 Ga0496104_0002731
778 Ga0496104_0139147
779 Ga0496104_0170084
780 Ga0496105_0001147
781 Ga0496106_0035347
782 Ga0496106_0244337
783 Ga0496107_0011920
784 Ga0496107_0114651
785 Ga0496108_0002735
786 Ga0496108_0125811
787 Ga0496109_0019916
788 Ga0496109_0021830
789 Ga0496109_0025990
790 Ga0496109_0027472
791 Ga0496109_0059017
792 Ga0496109_0094342
793 Ga0496109_0745391
794 Ga0496110_0062348
795 Ga0496110_0075355
796 Ga0496110_0096748
797 Ga0496110_0272055
798 Ga0496110_0661993
799 Ga0496111_0007915
800 Ga0496111_0115297
801 Ga0496111_0250675
802 Ga0496111_0299503
803 Ga0496112_0083833
804 Ga0496112_0202714
805 Ga0496114_0012051
806 Ga0496114_0022061
807 Ga0496114_0029815
808 Ga0496114_0113183
809 Ga0496114_0230740
810 Ga0496114_0294388
811 Ga0496114_0507702
812 Ga0496114_0710676
813 Ga0496115_0007350
814 Ga0496118_0008873
815 Ga0496118_0030981
816 Ga0496122_0000891
817 Ga0496122_0086805
818 Ga0496123_0182142
819 Ga0496123_0190658
820 Ga0496124_0063458
821 Ga0496124_0184020
822 Ga0496125_0000075
823 Ga0496126_0300452
824 Ga0501031_0000193
825 Ga0501031_0041612
826 Ga0501031_0196532
827 Ga0501032_0000056
828 Ga0501032_0048307
829 Ga0501033_0000941
830 Ga0501033_0001634
831 Ga0501034_0001881
832 Ga0501034_0005938
833 Ga0501034_0081642
834 Ga0501034_0498021
835 Ga0501036_0000057
836 Ga0501036_0025044
837 Ga0501036_0126371
838 Ga0501037_0000361
839 Ga0501037_0018908
840 Ga0501037_0023452
841 Ga0501037_0128362
842 Ga0501038_0000391
843 Ga0501038_0004282
844 Ga0501038_0034364
845 Ga0501039_0000309
846 Ga0501039_0015430
847 Ga0501039_0021455
848 Ga0501039_0041680
849 Ga0501039_0277263
850 Ga0501039_0338313
851 Ga0501040_0131407
852 Ga0501042_0041648
853 Ga0501043_0000111
854 Ga0501043_0050851
855 Ga0501043_0083386
856 Ga0501046_0000701
857 Ga0501046_0002307
858 Ga0501046_0002990
859 Ga0501046_0032219
860 Ga0501047_0000289
861 Ga0501047_0024327
862 Ga0501047_0186787
863 Ga0501048_0000298
864 Ga0501048_0001668
865 Ga0501048_0053818
866 Ga0501067_0004218
867 Ga0501067_0013753
868 Ga0501067_0015898
869 Ga0501067_0017309
870 Ga0501067_0037115
871 Ga0501067_0038576
872 Ga0501067_0128897
873 Ga0501068_0352399
874 Ga0501069_0053045
875 Ga0501069_0121179
876 Ga0501070_0001132
877 Ga0501070_0047716
878 Ga0501070_0062780
879 Ga0501070_0077527
880 Ga0501070_0196957
881 Ga0501070_0356668
882 Ga0501070_0460562
883 Ga0501071_0162472
884 Ga0501071_0164858
885 Ga0501072_0004685
886 Ga0501072_0132186
887 Ga0501072_0159056
888 Ga0501073_0019582
889 Ga0501073_0021646
890 Ga0501073_0072433
891 Ga0501073_0083294
892 Ga0501073_0153105
893 Ga0501074_0000074
894 Ga0501074_0001568
895 Ga0501074_0043654
896 Ga0501075_0079684
897 Ga0501076_0074918
898 Ga0501076_0387202
899 Ga0501077_0047940
900 Ga0501077_0278448
901 Ga0501080_0000244
902 Ga0501080_0004040
903 Ga0501080_0059650
904 Ga0501080_0125678
905 Ga0501080_0370802
906 Ga0501081_0318090
907 Ga0501083_0033258
908 Ga0501035_0000262
909 Ga0501035_0006844
910 Ga0501035_0128066
911 Ga0501035_0171576
912 Ga0501035_0277992
913 Ga0501044_0000312
914 Ga0501044_0016806
915 Ga0501044_0234645
916 Ga0501044_0411821
917 Ga0501044_0542478
918 Ga0501045_0073800
919 nmdc:mga03n38_104140_c1
920 nmdc:mga03n38_30919_c1
921 nmdc:mga03n38_53964_c1
922 nmdc:mga00v17_109631_c1
923 nmdc:mga00v17_1298_c1
924 nmdc:mga00v17_16513_c1
925 nmdc:mga00v17_24277_c1
926 nmdc:mga00v17_27028_c1
927 nmdc:mga00v17_30988_c1
928 nmdc:mga00v17_60484_c1
929 nmdc:mga00v17_61437_c1
930 nmdc:mga0yw44_101874_c1
931 nmdc:mga0yw44_13137_c1
932 nmdc:mga0yw44_141850_c1
933 nmdc:mga0yw44_1958_c2
934 nmdc:mga0yw44_241844_c1
935 nmdc:mga0yw44_260894_c1
936 nmdc:mga0yw44_36644_c1
937 nmdc:mga06z11_106592_c1
938 nmdc:mga06z11_213759_c1
939 nmdc:mga06z11_56139_c1
940 nmdc:mga04h51_40008_c1
941 nmdc:mga07m45_182887_c1
942 nmdc:mga05p37_1229_c1
943 nmdc:mga05p37_500679_c1
944 nmdc:mga05p37_92669_c1
945 nmdc:mga09592_329704_c1
946 nmdc:mga09592_555_c1
947 nmdc:mga06r32_1106_c1
948 nmdc:mga06r32_761_c1
949 nmdc:mga08y16_168816_c1
950 nmdc:mga08y16_17310_c1
951 nmdc:mga0n895_183617_c1
952 nmdc:mga0a205_88408_c1
953 Ga0495655_0011025
954 Ga0500556_0000671
955 Ga0500573_0003030
956 Ga0501084_0002359
957 Ga0501084_0277749
958 Ga0501082_0031102
959 Ga0501082_0032577
960 Ga0501082_0080914
961 Ga0501082_0179163
962 Ga0466962_0135277
963 2643825318
964 2643893191
965 2643961750
966 2644034080
967 2644089890
968 2644102550
969 2644118213
970 2644231415
971 2644319735
972 2644456489
973 2644531311
974 2644537020
975 2645723092
976 2645726039
977 2738871286
978 2740166734
979 2774393686
980 2809195431
981 2812350311
982 2855387569
983 2857484094
984 2883825166
985 2891972068
986 2946005073
987 2966923986
988 2984577110
989 2990258857
990 8054612459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

122

321

0.98

PF10370

Rv2993c-like_N

Rv2993c-like, N-terminal

55

116

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pfz-assembly1.cif.gz_A x-ray crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase from mycobacterium smegmatis 0.9581 1 272
3qdf-assembly1.cif.gz_A crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum 0.9578 2 272
4pfz-assembly1.cif.gz_A x-ray crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase from mycobacterium smegmatis 0.9544 1 272
4dbf-assembly1.cif.gz_A crystal structures of cg1458 0.9415 2 272
4pfz-assembly1.cif.gz_B x-ray crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase from mycobacterium smegmatis 0.9402 1 272
ID Description Score Start End Superfamily
af_A0A0R4IWE1_56_289_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9396 54 270 3.90.850.10
6jvvA02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9328 63 272 3.90.850.10
4dbfB02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9315 64 272 3.90.850.10
af_Q2FZT4_90_300_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9304 65 271 3.90.850.10
af_Q54BF3_56_305_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9287 49 269 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A499VNZ3-F1-model_v4 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase 0.9891 58 272 GO:0016853
GO:0018773
GO:0046872
AF-A0A2V7YHJ3-F1-model_v4 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase 0.9879 63 270 GO:0016853
GO:0018773
GO:0046872
AF-A0A1G3V2Y2-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.9853 54 271 GO:0018773
GO:0046872
AF-A0A7Z9GAJ7-F1-model_v4 FAA hydrolase family protein 0.9849 48 272 GO:0018773
GO:0046872
AF-A0A838HYP8-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9829 1 272 GO:0018773
GO:0046872

Map