F454679

General Info

Members Datasets Scaffolds Average Seq Length
495 229 990 135

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100978767|Ga0070670_1009787671
Length 145
Sequence MLREFKEFIARGNVVDLAVAVVIGAAFGRIVTAFVEGIIMPPLGLLLGKADFSNLFIDISGQTPPPVSLADAQLRGLPVIAYGSFLNTIVNFLIIGFAVFMVVKAVNRVRAQPXXXXNTKDCPYCLTAIPVAATRCAACCSEVAA

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
141 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
164 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
165 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
166 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
167 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
168 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
169 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
170 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
171 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
172 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
173 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
174 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
185 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
193 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
194 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
195 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
196 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
197 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
198 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
199 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
200 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
201 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
202 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
203 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
204 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
205 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
206 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
207 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
208 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
209 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
210 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
211 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
212 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
213 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
214 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
215 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 1.62
Rhizosphere 97.78
Stem 0
Stem Tuber 0
Unclassified 18.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100978767 3300005331 Unclassified 769
2 CNAas_1001737 3300000532 Bacteria 1728
3 Ga0065715_10021677 3300005293 Unclassified 1556
4 Ga0065715_10094950 3300005293 Bacteria 4205
5 Ga0065715_10108854 3300005293 Bacteria 2698
6 Ga0065707_10003641 3300005295 Bacteria 9562
7 Ga0065707_10200088 3300005295 Bacteria 1304
8 Ga0065707_10457199 3300005295 Unclassified 795
9 Ga0070676_10251566 3300005328 Bacteria 1179
10 Ga0070683_100402629 3300005329 Bacteria 1305
11 Ga0070690_100000630 3300005330 Bacteria 17884
12 Ga0070670_100117015 3300005331 Bacteria 2298
13 Ga0070670_100145065 3300005331 Bacteria 2053
14 Ga0070670_100151117 3300005331 Unclassified 2009
15 Ga0070670_100705379 3300005331 Bacteria 907
16 Ga0070677_10074768 3300005333 Bacteria 1434
17 Ga0068869_100513459 3300005334 Unclassified 1002
18 Ga0068869_100655674 3300005334 Unclassified 891
19 Ga0068869_101253122 3300005334 Bacteria 653
20 Ga0068869_101418886 3300005334 Bacteria 615
21 Ga0070680_100000444 3300005336 Bacteria 28198
22 Ga0070680_100878822 3300005336 Bacteria 773
23 Ga0070680_101321724 3300005336 Unclassified 624
24 Ga0070682_100000149 3300005337 Bacteria 55271
25 Ga0068868_100932980 3300005338 Unclassified 790
26 Ga0068868_101148920 3300005338 Bacteria 716
27 Ga0070689_100001296 3300005340 Bacteria 15930
28 Ga0070689_100006325 3300005340 Bacteria 8181
29 Ga0070689_100320696 3300005340 Bacteria 1294
30 Ga0070689_100625424 3300005340 Unclassified 935
31 Ga0070689_101869950 3300005340 Unclassified 548
32 Ga0070687_100041791 3300005343 Bacteria 2319
33 Ga0070687_100772181 3300005343 Bacteria 678
34 Ga0070692_10017570 3300005345 Bacteria 3423
35 Ga0070692_10129254 3300005345 Bacteria 1418
36 Ga0070692_10319969 3300005345 Bacteria 953
37 Ga0070692_10669812 3300005345 Unclassified 695
38 Ga0070669_100004663 3300005353 Bacteria 9893
39 Ga0070669_100013349 3300005353 Bacteria 5839
40 Ga0070669_100136635 3300005353 Bacteria 1886
41 Ga0070669_100214663 3300005353 Bacteria 1519
42 Ga0070671_100352959 3300005355 Bacteria 1255
43 Ga0070671_100467673 3300005355 Bacteria 1083
44 Ga0070671_100850667 3300005355 Unclassified 796
45 Ga0070673_100120316 3300005364 Bacteria 2190
46 Ga0070673_101086370 3300005364 Bacteria 747
47 Ga0070673_101237855 3300005364 Unclassified 700
48 Ga0070659_100075129 3300005366 Bacteria 2693
49 Ga0070659_100198202 3300005366 Bacteria 1652
50 Ga0070703_10104930 3300005406 Bacteria 1002
51 Ga0070701_10123317 3300005438 Bacteria 1463
52 Ga0070701_10508947 3300005438 Unclassified 783
53 Ga0070705_100021445 3300005440 Bacteria 3437
54 Ga0070705_101351848 3300005440 Bacteria 592
55 Ga0070700_100009005 3300005441 Bacteria 5466
56 Ga0070700_100019955 3300005441 Bacteria 3875
57 Ga0070700_100047512 3300005441 Bacteria 2656
58 Ga0070700_100092237 3300005441 Unclassified 1979
59 Ga0070700_100200868 3300005441 Unclassified 1400
60 Ga0070700_101484029 3300005441 Bacteria 576
61 Ga0070694_100002224 3300005444 Bacteria 11475
62 Ga0070694_100051567 3300005444 Bacteria 2778
63 Ga0070694_100080030 3300005444 Bacteria 2269
64 Ga0070694_100085465 3300005444 Bacteria 2203
65 Ga0070694_100645503 3300005444 Bacteria 856
66 Ga0070708_100174332 3300005445 Bacteria 2009
67 Ga0070708_101574048 3300005445 Bacteria 612
68 Ga0070662_100851207 3300005457 Bacteria 776
69 Ga0070681_10000237 3300005458 Bacteria 43349
70 Ga0070681_10100993 3300005458 Bacteria 2830
71 Ga0068867_100012038 3300005459 Bacteria 6109
72 Ga0068867_100220096 3300005459 Bacteria 1529
73 Ga0068867_100564204 3300005459 Bacteria 988
74 Ga0070685_10169330 3300005466 Bacteria 1399
75 Ga0070706_100000015 3300005467 Bacteria 188425
76 Ga0070706_100075528 3300005467 Bacteria 3119
77 Ga0070707_100290771 3300005468 Bacteria 1588
78 Ga0070698_100056784 3300005471 Bacteria 3964
79 Ga0070698_100111434 3300005471 Bacteria 2701
80 Ga0070699_100337432 3300005518 Unclassified 1356
81 Ga0070699_100514204 3300005518 Unclassified 1088
82 Ga0070699_100747035 3300005518 Bacteria 895
83 Ga0070699_100922940 3300005518 Unclassified 800
84 Ga0070679_100000054 3300005530 Bacteria 84639
85 Ga0070697_100092815 3300005536 Bacteria 2498
86 Ga0070697_100298933 3300005536 Bacteria 1383
87 Ga0070697_100476370 3300005536 Unclassified 1090
88 Ga0070697_100821489 3300005536 Unclassified 823
89 Ga0068853_100036778 3300005539 Bacteria 4164
90 Ga0068853_100042865 3300005539 Bacteria 3871
91 Ga0068853_100402076 3300005539 Bacteria 1282
92 Ga0068853_100441440 3300005539 Bacteria 1223
93 Ga0070672_100057849 3300005543 Bacteria 3045
94 Ga0070686_100004136 3300005544 Bacteria 7984
95 Ga0070686_101254141 3300005544 Bacteria 617
96 Ga0070695_100019359 3300005545 Bacteria 4145
97 Ga0070695_100114377 3300005545 Bacteria 1837
98 Ga0070695_100147968 3300005545 Bacteria 1636
99 Ga0070695_100289369 3300005545 Unclassified 1207
100 Ga0070695_100358384 3300005545 Bacteria 1094
101 Ga0070695_100429118 3300005545 Unclassified 1008
102 Ga0070695_101434659 3300005545 Bacteria 573
103 Ga0070696_100006849 3300005546 Bacteria 7607
104 Ga0070696_100292839 3300005546 Unclassified 1244
105 Ga0070696_100491727 3300005546 Bacteria 975
106 Ga0070696_101459682 3300005546 Bacteria 584
107 Ga0070693_100499276 3300005547 Bacteria 863
108 Ga0070704_100032643 3300005549 Bacteria 3514
109 Ga0070704_100046835 3300005549 Bacteria 3018
110 Ga0070704_100129454 3300005549 Bacteria 1953
111 Ga0070704_100275688 3300005549 Unclassified 1391
112 Ga0070704_101045657 3300005549 Bacteria 740
113 Ga0070704_101210283 3300005549 Unclassified 689
114 Ga0070704_101263845 3300005549 Bacteria 675
115 Ga0068855_101425847 3300005563 Unclassified 713
116 Ga0070664_100545597 3300005564 Bacteria 1072
117 Ga0068857_100340382 3300005577 Bacteria 1388
118 Ga0068857_100950949 3300005577 Bacteria 825
119 Ga0068857_100993613 3300005577 Bacteria 807
120 Ga0068857_101682700 3300005577 Bacteria 620
121 Ga0068857_101853289 3300005577 Unclassified 591
122 Ga0068854_100079566 3300005578 Bacteria 2416
123 Ga0068854_100192910 3300005578 Bacteria 1597
124 Ga0068854_100779285 3300005578 Unclassified 832
125 Ga0068856_100060643 3300005614 Bacteria 3737
126 Ga0070702_100035085 3300005615 Bacteria 2769
127 Ga0070702_100062230 3300005615 Bacteria 2175
128 Ga0070702_100108195 3300005615 Bacteria 1718
129 Ga0070702_100127810 3300005615 Bacteria 1601
130 Ga0070702_101393221 3300005615 Unclassified 573
131 Ga0068859_100001811 3300005617 Bacteria 21762
132 Ga0068859_100193756 3300005617 Unclassified 2117
133 Ga0068859_100215697 3300005617 Bacteria 2006
134 Ga0068859_100241781 3300005617 Bacteria 1894
135 Ga0068859_100336232 3300005617 Bacteria 1604
136 Ga0068859_100620983 3300005617 Bacteria 1173
137 Ga0068859_101895794 3300005617 Unclassified 658
138 Ga0068859_102508821 3300005617 Bacteria 568
139 Ga0068864_100024714 3300005618 Bacteria 5054
140 Ga0068864_100059061 3300005618 Bacteria 3317
141 Ga0068864_100104762 3300005618 Bacteria 2513
142 Ga0068864_100109562 3300005618 Bacteria 2458
143 Ga0068864_101268239 3300005618 Bacteria 737
144 Ga0068861_100236720 3300005719 Bacteria 1551
145 Ga0068861_100584220 3300005719 Bacteria 1023
146 Ga0068861_101138752 3300005719 Bacteria 752
147 Ga0068861_101265936 3300005719 Bacteria 716
148 Ga0068861_101551259 3300005719 Unclassified 651
149 Ga0068870_10008373 3300005840 Bacteria 4650
150 Ga0068863_100045288 3300005841 Bacteria 4175
151 Ga0068863_100120851 3300005841 Bacteria 2497
152 Ga0068863_100420197 3300005841 Bacteria 1310
153 Ga0068863_100913374 3300005841 Unclassified 879
154 Ga0068863_101070223 3300005841 Bacteria 810
155 Ga0068863_101929534 3300005841 Bacteria 600
156 Ga0068858_100035366 3300005842 Bacteria 4634
157 Ga0068858_100538842 3300005842 Bacteria 1130
158 Ga0068860_100015426 3300005843 Bacteria 7465
159 Ga0068860_100559387 3300005843 Bacteria 1146
160 Ga0068862_100120911 3300005844 Bacteria 2308
161 Ga0068862_100229775 3300005844 Unclassified 1682
162 Ga0068862_100517547 3300005844 Bacteria 1135
163 Ga0068862_100924553 3300005844 Bacteria 859
164 Ga0081539_10196769 3300005985 Unclassified 934
165 Ga0075432_10124204 3300006058 Bacteria 972
166 Ga0070716_100051376 3300006173 Bacteria 2343
167 Ga0097621_100001426 3300006237 Bacteria 16407
168 Ga0097621_100027793 3300006237 Bacteria 4452
169 Ga0068871_100003287 3300006358 Bacteria 11088
170 Ga0068871_100153834 3300006358 Bacteria 1963
171 Ga0075428_100118887 3300006844 Bacteria 2878
172 Ga0075428_100520762 3300006844 Bacteria 1272
173 Ga0075431_100685115 3300006847 Bacteria 1003
174 Ga0075431_102130829 3300006847 Bacteria 515
175 Ga0075433_10019267 3300006852 Bacteria 5682
176 Ga0075433_10075732 3300006852 Bacteria 2962
177 Ga0075433_10109415 3300006852 Bacteria 2452
178 Ga0075433_10175913 3300006852 Unclassified 1905
179 Ga0075433_10216283 3300006852 Bacteria 1703
180 Ga0075433_10408670 3300006852 Unclassified 1197
181 Ga0075433_10635899 3300006852 Unclassified 936
182 Ga0075433_10834625 3300006852 Unclassified 805
183 Ga0075434_100494826 3300006871 Unclassified 1243
184 Ga0075434_100745010 3300006871 Bacteria 997
185 Ga0075434_101185343 3300006871 Bacteria 776
186 Ga0075429_100020930 3300006880 Bacteria 5675
187 Ga0075429_100091409 3300006880 Bacteria 2655
188 Ga0068865_100661587 3300006881 Bacteria 889
189 Ga0097620_100001811 3300006931 Bacteria 21762
190 Ga0097620_100193751 3300006931 Unclassified 2117
191 Ga0097620_100215705 3300006931 Bacteria 2006
192 Ga0097620_100241779 3300006931 Bacteria 1894
193 Ga0097620_100336243 3300006931 Bacteria 1604
194 Ga0097620_100621000 3300006931 Bacteria 1173
195 Ga0097620_101896169 3300006931 Unclassified 658
196 Ga0105251_10126177 3300009011 Bacteria 1161
197 Ga0105250_10066779 3300009092 Bacteria 1451
198 Ga0111539_10021805 3300009094 Bacteria 7876
199 Ga0111539_10067528 3300009094 Bacteria 4223
200 Ga0111539_10368041 3300009094 Bacteria 1673
201 Ga0111539_10542842 3300009094 Unclassified 1354
202 Ga0111539_10576644 3300009094 Bacteria 1310
203 Ga0111539_10619091 3300009094 Bacteria 1261
204 Ga0111539_10628406 3300009094 Unclassified 1251
205 Ga0105245_11397368 3300009098 Bacteria 750
206 Ga0105247_10063021 3300009101 Bacteria 2301
207 Ga0105247_10229151 3300009101 Bacteria 1261
208 Ga0105247_10373800 3300009101 Bacteria 1009
209 Ga0105247_10738127 3300009101 Bacteria 745
210 Ga0114129_10014948 3300009147 Bacteria 11060
211 Ga0114129_10016522 3300009147 Bacteria 10508
212 Ga0114129_10026205 3300009147 Bacteria 8255
213 Ga0114129_10075461 3300009147 Bacteria 4694
214 Ga0114129_10134719 3300009147 Bacteria 3390
215 Ga0114129_10154007 3300009147 Bacteria 3145
216 Ga0114129_10343094 3300009147 Bacteria 1980
217 Ga0114129_10358601 3300009147 Bacteria 1929
218 Ga0114129_11334807 3300009147 Bacteria 887
219 Ga0114129_11587625 3300009147 Unclassified 801
220 Ga0114129_11797829 3300009147 Bacteria 745
221 Ga0105243_10340222 3300009148 Bacteria 1374
222 Ga0105243_10446805 3300009148 Bacteria 1212
223 Ga0105243_10506778 3300009148 Bacteria 1145
224 Ga0105243_10857823 3300009148 Bacteria 900
225 Ga0105241_10250020 3300009174 Bacteria 1503
226 Ga0105241_10649369 3300009174 Bacteria 958
227 Ga0105241_11292692 3300009174 Bacteria 694
228 Ga0105242_10915773 3300009176 Unclassified 878
229 Ga0105242_11045356 3300009176 Bacteria 827
230 Ga0105248_10034926 3300009177 Bacteria 5626
231 Ga0105248_10168584 3300009177 Bacteria 2468
232 Ga0105248_10308282 3300009177 Bacteria 1783
233 Ga0105237_10005907 3300009545 Bacteria 13724
234 Ga0105237_11082854 3300009545 Bacteria 808
235 Ga0105237_11090558 3300009545 Unclassified 805
236 Ga0105238_10081567 3300009551 Bacteria 3224
237 Ga0105249_10004360 3300009553 Bacteria 12240
238 Ga0105249_10021150 3300009553 Bacteria 5823
239 Ga0105249_11104084 3300009553 Unclassified 863
240 Ga0105249_12027158 3300009553 Bacteria 648
241 Ga0105239_10298978 3300010375 Bacteria 1812
242 Ga0105246_10125472 3300011119 Bacteria 1909
243 Ga0105246_10164491 3300011119 Bacteria 1693
244 Ga0105246_10180991 3300011119 Bacteria 1623
245 Ga0105246_10397346 3300011119 Bacteria 1144
246 Ga0105246_11297664 3300011119 Bacteria 674
247 Ga0157373_10063612 3300013100 Bacteria 2612
248 Ga0157373_10975198 3300013100 Unclassified 632
249 Ga0157378_10012768 3300013297 Bacteria 7353
250 Ga0157378_10204308 3300013297 Bacteria 1870
251 Ga0157378_10238693 3300013297 Bacteria 1736
252 Ga0157378_10535812 3300013297 Unclassified 1174
253 Ga0157378_10864847 3300013297 Bacteria 933
254 Ga0157378_11384345 3300013297 Unclassified 746
255 Ga0163162_10033300 3300013306 Bacteria 5120
256 Ga0163162_10128405 3300013306 Bacteria 2643
257 Ga0163162_10159878 3300013306 Bacteria 2374
258 Ga0163162_10193549 3300013306 Bacteria 2161
259 Ga0163162_10333352 3300013306 Bacteria 1650
260 Ga0157375_10172372 3300013308 Bacteria 2312
261 Ga0157375_10457916 3300013308 Bacteria 1441
262 Ga0157375_11510964 3300013308 Unclassified 793
263 Ga0163163_10051392 3300014325 Bacteria 4064
264 Ga0157380_10004227 3300014326 Bacteria 9932
265 Ga0157380_10013455 3300014326 Bacteria 5965
266 Ga0157380_10321821 3300014326 Unclassified 1434
267 Ga0157380_10618380 3300014326 Unclassified 1075
268 Ga0157377_10215770 3300014745 Unclassified 1226
269 Ga0157379_10297270 3300014968 Bacteria 1471
270 Ga0163161_10053788 3300017792 Bacteria 2920
271 Ga0207697_10343743 3300025315 Bacteria 663
272 Ga0207713_1121719 3300025735 Bacteria 874
273 Ga0207710_10074056 3300025900 Bacteria 1567
274 Ga0207710_10367722 3300025900 Bacteria 734
275 Ga0207647_10030155 3300025904 Unclassified 3502
276 Ga0207647_10100051 3300025904 Bacteria 1721
277 Ga0207647_10509779 3300025904 Unclassified 670
278 Ga0207645_10237822 3300025907 Bacteria 1203
279 Ga0207643_10009806 3300025908 Bacteria 5144
280 Ga0207684_10000083 3300025910 Bacteria 176092
281 Ga0207654_10062178 3300025911 Bacteria 2186
282 Ga0207707_10000025 3300025912 Bacteria 175152
283 Ga0207671_10007451 3300025914 Bacteria 9496
284 Ga0207671_10616563 3300025914 Unclassified 864
285 Ga0207671_11153312 3300025914 Bacteria 607
286 Ga0207660_10005824 3300025917 Bacteria 7997
287 Ga0207660_10083505 3300025917 Unclassified 2352
288 Ga0207662_10025624 3300025918 Bacteria 3397
289 Ga0207662_10270806 3300025918 Unclassified 1121
290 Ga0207652_10000392 3300025921 Bacteria 45607
291 Ga0207646_10764144 3300025922 Unclassified 862
292 Ga0207681_10001722 3300025923 Bacteria 14068
293 Ga0207681_10144442 3300025923 Bacteria 1776
294 Ga0207694_10108634 3300025924 Bacteria 2204
295 Ga0207650_10001828 3300025925 Bacteria 15043
296 Ga0207650_10118975 3300025925 Bacteria 2054
297 Ga0207650_10362832 3300025925 Bacteria 1194
298 Ga0207650_10633154 3300025925 Bacteria 901
299 Ga0207650_11192716 3300025925 Unclassified 648
300 Ga0207644_10621211 3300025931 Bacteria 898
301 Ga0207690_10041690 3300025932 Bacteria 3010
302 Ga0207690_10359479 3300025932 Bacteria 1153
303 Ga0207706_10103542 3300025933 Bacteria 2504
304 Ga0207706_10218930 3300025933 Bacteria 1667
305 Ga0207709_10053506 3300025935 Bacteria 2484
306 Ga0207709_10609416 3300025935 Unclassified 865
307 Ga0207670_10000390 3300025936 Bacteria 25211
308 Ga0207670_10120981 3300025936 Bacteria 1903
309 Ga0207704_10356543 3300025938 Bacteria 1140
310 Ga0207665_10155249 3300025939 Bacteria 1642
311 Ga0207691_10186458 3300025940 Bacteria 1811
312 Ga0207691_10921827 3300025940 Bacteria 731
313 Ga0207711_10100207 3300025941 Bacteria 2562
314 Ga0207711_10189563 3300025941 Bacteria 1873
315 Ga0207711_10787627 3300025941 Bacteria 886
316 Ga0207689_10091585 3300025942 Bacteria 2498
317 Ga0207689_10122200 3300025942 Unclassified 2141
318 Ga0207689_10173305 3300025942 Unclassified 1779
319 Ga0207689_10646614 3300025942 Unclassified 891
320 Ga0207689_11494016 3300025942 Bacteria 564
321 Ga0207661_11553879 3300025944 Bacteria 606
322 Ga0207679_10098312 3300025945 Bacteria 2282
323 Ga0207679_10345544 3300025945 Bacteria 1295
324 Ga0207651_10092785 3300025960 Bacteria 2215
325 Ga0207651_10113145 3300025960 Bacteria 2042
326 Ga0207651_11071046 3300025960 Bacteria 722
327 Ga0207712_10019137 3300025961 Bacteria 4468
328 Ga0207712_10119571 3300025961 Bacteria 1991
329 Ga0207640_10280797 3300025981 Bacteria 1308
330 Ga0207640_10406991 3300025981 Unclassified 1109
331 Ga0207640_10679112 3300025981 Unclassified 881
332 Ga0207640_11115677 3300025981 Bacteria 698
333 Ga0207677_10811874 3300026023 Bacteria 838
334 Ga0207677_11141512 3300026023 Unclassified 712
335 Ga0207703_10251650 3300026035 Unclassified 1593
336 Ga0207703_10353411 3300026035 Bacteria 1354
337 Ga0207639_10026467 3300026041 Bacteria 4215
338 Ga0207639_11201681 3300026041 Bacteria 712
339 Ga0207639_12233585 3300026041 Bacteria 508
340 Ga0207708_10004334 3300026075 Bacteria 10449
341 Ga0207708_10009308 3300026075 Bacteria 7271
342 Ga0207708_10168125 3300026075 Bacteria 1735
343 Ga0207708_10208079 3300026075 Bacteria 1563
344 Ga0207702_10045139 3300026078 Bacteria 3707
345 Ga0207641_10416591 3300026088 Unclassified 1292
346 Ga0207641_10487777 3300026088 Bacteria 1195
347 Ga0207641_10704993 3300026088 Bacteria 994
348 Ga0207641_11704135 3300026088 Unclassified 632
349 Ga0207641_11793648 3300026088 Bacteria 615
350 Ga0207648_10185037 3300026089 Bacteria 1845
351 Ga0207648_10563192 3300026089 Bacteria 1048
352 Ga0207648_10862242 3300026089 Bacteria 845
353 Ga0207676_10075282 3300026095 Bacteria 2722
354 Ga0207676_10131925 3300026095 Bacteria 2125
355 Ga0207676_10368494 3300026095 Bacteria 1333
356 Ga0207676_11141326 3300026095 Bacteria 771
357 Ga0207676_11717211 3300026095 Bacteria 626
358 Ga0207674_10370142 3300026116 Bacteria 1385
359 Ga0207674_11210516 3300026116 Bacteria 725
360 Ga0207674_11399413 3300026116 Bacteria 669
361 Ga0207675_100053606 3300026118 Bacteria 3763
362 Ga0207675_100084759 3300026118 Bacteria 2974
363 Ga0207675_100301674 3300026118 Bacteria 1560
364 Ga0207675_100482325 3300026118 Bacteria 1232
365 Ga0207675_100809507 3300026118 Unclassified 950
366 Ga0207675_100983996 3300026118 Bacteria 862
367 Ga0207698_11864413 3300026142 Bacteria 616
368 Ga0207428_10016413 3300027907 Bacteria 6371
369 Ga0207428_10352977 3300027907 Unclassified 1082
370 Ga0207428_10433078 3300027907 Unclassified 960
371 Ga0207428_10447214 3300027907 Bacteria 942
372 Ga0207428_10572881 3300027907 Bacteria 815
373 Ga0268266_10686302 3300028379 Unclassified 987
374 Ga0268265_10581170 3300028380 Unclassified 1068
375 Ga0268264_10036600 3300028381 Bacteria 4044
376 Ga0268264_10696711 3300028381 Bacteria 1009
377 Ga0314311_1181264 3300030733 Bacteria 1645
378 Ga0316181_1123300 3300030744 Bacteria 669
379 Ga0307408_100003979 3300031548 Bacteria 10068
380 Ga0307408_101667734 3300031548 Bacteria 607
381 Ga0307405_10009046 3300031731 Bacteria 5088
382 Ga0316577_10051551 3300031733 Bacteria 2296
383 Ga0307413_10220180 3300031824 Bacteria 1386
384 Ga0307410_10004927 3300031852 Bacteria 6995
385 Ga0307406_10010187 3300031901 Bacteria 5296
386 Ga0307407_10025116 3300031903 Bacteria 3136
387 Ga0307412_10003326 3300031911 Bacteria 8932
388 Ga0307412_12119122 3300031911 Bacteria 522
389 Ga0307416_100064575 3300032002 Bacteria 3004
390 Ga0307416_100194095 3300032002 Bacteria 1919
391 Ga0307416_100699343 3300032002 Bacteria 1103
392 Ga0307416_101802372 3300032002 Bacteria 716
393 Ga0307414_10015105 3300032004 Bacteria 4653
394 Ga0307411_10009619 3300032005 Bacteria 5098
395 Ga0307415_100006102 3300032126 Bacteria 6463
396 Ga0373941_0020008 3300035115 Bacteria 1871
397 Ga0373962_0225361 3300035242 Bacteria 643
398 Ga0373931_0116684 3300035691 Bacteria 1521
399 Ga0373937_0723017 3300036401 Bacteria 943
400 Ga0316584_0294367 3300036712 Bacteria 1177
401 Ga0395900_0053130 3300037418 Bacteria 4170
402 Ga0395900_0252883 3300037418 Bacteria 1763
403 Ga0395898_0232436 3300037466 Bacteria 1758
404 Ga0395898_1531551 3300037466 Unclassified 592
405 Ga0395905_1574205 3300037471 Unclassified 562
406 Ga0395901_0220477 3300038443 Bacteria 1983
407 Ga0395901_0352298 3300038443 Bacteria 1519
408 Ga0439465_0107370 3300041413 Bacteria 969
409 Ga0439431_0039853 3300041997 Bacteria 1193
410 Ga0439437_005567 3300042000 Bacteria 1386
411 Ga0439448_0079116 3300042005 Bacteria 1102
412 Ga0439452_027740 3300042010 Bacteria 1419
413 Ga0439455_0027084 3300042012 Bacteria 1403
414 Ga0439457_027136 3300042014 Unclassified 1268
415 Ga0439462_0018074 3300042015 Bacteria 1830
416 Ga0439458_0005554 3300042157 Bacteria 2834
417 Ga0439434_0026637 3300042435 Bacteria 1746
418 Ga0439434_0029546 3300042435 Bacteria 1662
419 Ga0495598_0137962 3300046537 Bacteria 842
420 Ga0495621_0078463 3300046539 Bacteria 1228
421 Ga0495668_0462892 3300046616 Bacteria 698
422 Ga0495672_0350512 3300047320 Unclassified 686
423 Ga0495684_0349158 3300047471 Bacteria 1051
424 Ga0496102_0093926 3300048905 Bacteria 2779
425 Ga0496103_0133610 3300048906 Bacteria 1585
426 Ga0496104_0014201 3300048907 Bacteria 7186
427 Ga0496104_0364813 3300048907 Bacteria 1357
428 Ga0496110_0616411 3300048913 Bacteria 984
429 Ga0496112_0961296 3300048915 Bacteria 775
430 Ga0496112_1449712 3300048915 Bacteria 601
431 Ga0496113_0343759 3300048916 Bacteria 1197
432 Ga0501292_057068 3300049515 Bacteria 702
433 Ga0501298_002474 3300049521 Bacteria 2795
434 Ga0501040_0592517 3300049576 Bacteria 801
435 Ga0501046_0171840 3300049580 Bacteria 1626
436 Ga0501047_0132490 3300049581 Bacteria 2373
437 Ga0501069_0409943 3300049585 Bacteria 802
438 Ga0501076_1049842 3300049592 Bacteria 671
439 Ga0501077_0806375 3300049593 Bacteria 604
440 Ga0501198_004572 3300049649 Bacteria 1923
441 Ga0501202_120313 3300049652 Bacteria 659
442 Ga0501206_097891 3300049653 Unclassified 528
443 Ga0501207_002241 3300049654 Bacteria 2484
444 Ga0501207_108664 3300049654 Bacteria 564
445 Ga0501208_017696 3300049655 Bacteria 1126
446 Ga0501216_143097 3300049660 Bacteria 563
447 Ga0501217_000142 3300049661 Bacteria 9744
448 Ga0501223_021523 3300049663 Bacteria 1261
449 Ga0501224_002379 3300049664 Bacteria 2553
450 Ga0501235_000998 3300049669 Bacteria 5863
451 Ga0501236_023915 3300049670 Bacteria 923
452 Ga0501240_003738 3300049673 Bacteria 1723
453 Ga0501243_026903 3300049675 Bacteria 969
454 Ga0501247_088099 3300049677 Unclassified 509
455 Ga0501257_150040 3300049686 Bacteria 642
456 Ga0501259_041062 3300049688 Bacteria 909
457 Ga0501225_0003145 3300049705 Bacteria 5042
458 Ga0501225_0015309 3300049705 Bacteria 2137
459 Ga0501229_000730 3300049706 Bacteria 3711
460 Ga0501229_005853 3300049706 Bacteria 1515
461 Ga0501234_003385 3300049707 Bacteria 2508
462 Ga0501245_020576 3300049708 Bacteria 1030
463 Ga0501241_125867 3300049758 Bacteria 573
464 Ga0501268_096374 3300049765 Unclassified 629
465 Ga0501271_012292 3300049768 Bacteria 926
466 Ga0501275_037878 3300049772 Bacteria 665
467 Ga0501035_1132572 3300049822 Bacteria 610
468 Ga0501044_0001520 3300049823 Bacteria 27213
469 Ga0501226_001123 3300049853 Bacteria 3468
470 nmdc:mga00v17_698319_c1 3300050491 Bacteria 650
471 nmdc:mga0yw44_455611_c1 3300050492 Bacteria 867
472 nmdc:mga06z11_414644_c1 3300050494 Bacteria 811
473 nmdc:mga05p37_32750_c1 3300050507 Bacteria 6359
474 nmdc:mga05p37_417318_c1 3300050507 Bacteria 1563
475 nmdc:mga05p37_64085_c1 3300050507 Bacteria 4522
476 nmdc:mga05p37_91892_c1 3300050507 Bacteria 3739
477 nmdc:mga05p37_96954_c1 3300050507 Bacteria 3633
478 nmdc:mga09592_45017_c1 3300050508 Bacteria 3716
479 nmdc:mga09592_938913_c1 3300050508 Bacteria 726
480 nmdc:mga06r32_241856_c1 3300050510 Unclassified 1792
481 nmdc:mga06r32_36006_c2 3300050510 Bacteria 1006
482 nmdc:mga08y16_1124313_c1 3300050511 Unclassified 760
483 nmdc:mga08y16_1674244_c1 3300050511 Unclassified 592
484 nmdc:mga08y16_21229_c1 3300050511 Bacteria 6857
485 nmdc:mga08y16_438465_c1 3300050511 Bacteria 1333
486 nmdc:mga08y16_66133_c1 3300050511 Bacteria 3773
487 nmdc:mga08y16_82327_c1 3300050511 Bacteria 3355
488 nmdc:mga0n895_324755_c1 3300050512 Bacteria 1559
489 nmdc:mga0n895_55348_c1 3300050512 Bacteria 3904
490 nmdc:mga0rr50_258924_c1 3300050513 Bacteria 1447
491 nmdc:mga0a205_1008122_c1 3300050515 Unclassified 680
492 nmdc:mga0a205_106654_c1 3300050515 Bacteria 2699
493 nmdc:mga0a205_213237_c1 3300050515 Bacteria 1146
494 nmdc:mga0a205_23476_c1 3300050515 Bacteria 5851
495 Ga0501084_0340695 3300054114 Unclassified 1266
496 Ga0070670_100978767
497 CNAas_1001737
498 Ga0065715_10021677
499 Ga0065715_10094950
500 Ga0065715_10108854
501 Ga0065707_10003641
502 Ga0065707_10200088
503 Ga0065707_10457199
504 Ga0070676_10251566
505 Ga0070683_100402629
506 Ga0070690_100000630
507 Ga0070670_100117015
508 Ga0070670_100145065
509 Ga0070670_100151117
510 Ga0070670_100705379
511 Ga0070677_10074768
512 Ga0068869_100513459
513 Ga0068869_100655674
514 Ga0068869_101253122
515 Ga0068869_101418886
516 Ga0070680_100000444
517 Ga0070680_100878822
518 Ga0070680_101321724
519 Ga0070682_100000149
520 Ga0068868_100932980
521 Ga0068868_101148920
522 Ga0070689_100001296
523 Ga0070689_100006325
524 Ga0070689_100320696
525 Ga0070689_100625424
526 Ga0070689_101869950
527 Ga0070687_100041791
528 Ga0070687_100772181
529 Ga0070692_10017570
530 Ga0070692_10129254
531 Ga0070692_10319969
532 Ga0070692_10669812
533 Ga0070669_100004663
534 Ga0070669_100013349
535 Ga0070669_100136635
536 Ga0070669_100214663
537 Ga0070671_100352959
538 Ga0070671_100467673
539 Ga0070671_100850667
540 Ga0070673_100120316
541 Ga0070673_101086370
542 Ga0070673_101237855
543 Ga0070659_100075129
544 Ga0070659_100198202
545 Ga0070703_10104930
546 Ga0070701_10123317
547 Ga0070701_10508947
548 Ga0070705_100021445
549 Ga0070705_101351848
550 Ga0070700_100009005
551 Ga0070700_100019955
552 Ga0070700_100047512
553 Ga0070700_100092237
554 Ga0070700_100200868
555 Ga0070700_101484029
556 Ga0070694_100002224
557 Ga0070694_100051567
558 Ga0070694_100080030
559 Ga0070694_100085465
560 Ga0070694_100645503
561 Ga0070708_100174332
562 Ga0070708_101574048
563 Ga0070662_100851207
564 Ga0070681_10000237
565 Ga0070681_10100993
566 Ga0068867_100012038
567 Ga0068867_100220096
568 Ga0068867_100564204
569 Ga0070685_10169330
570 Ga0070706_100000015
571 Ga0070706_100075528
572 Ga0070707_100290771
573 Ga0070698_100056784
574 Ga0070698_100111434
575 Ga0070699_100337432
576 Ga0070699_100514204
577 Ga0070699_100747035
578 Ga0070699_100922940
579 Ga0070679_100000054
580 Ga0070697_100092815
581 Ga0070697_100298933
582 Ga0070697_100476370
583 Ga0070697_100821489
584 Ga0068853_100036778
585 Ga0068853_100042865
586 Ga0068853_100402076
587 Ga0068853_100441440
588 Ga0070672_100057849
589 Ga0070686_100004136
590 Ga0070686_101254141
591 Ga0070695_100019359
592 Ga0070695_100114377
593 Ga0070695_100147968
594 Ga0070695_100289369
595 Ga0070695_100358384
596 Ga0070695_100429118
597 Ga0070695_101434659
598 Ga0070696_100006849
599 Ga0070696_100292839
600 Ga0070696_100491727
601 Ga0070696_101459682
602 Ga0070693_100499276
603 Ga0070704_100032643
604 Ga0070704_100046835
605 Ga0070704_100129454
606 Ga0070704_100275688
607 Ga0070704_101045657
608 Ga0070704_101210283
609 Ga0070704_101263845
610 Ga0068855_101425847
611 Ga0070664_100545597
612 Ga0068857_100340382
613 Ga0068857_100950949
614 Ga0068857_100993613
615 Ga0068857_101682700
616 Ga0068857_101853289
617 Ga0068854_100079566
618 Ga0068854_100192910
619 Ga0068854_100779285
620 Ga0068856_100060643
621 Ga0070702_100035085
622 Ga0070702_100062230
623 Ga0070702_100108195
624 Ga0070702_100127810
625 Ga0070702_101393221
626 Ga0068859_100001811
627 Ga0068859_100193756
628 Ga0068859_100215697
629 Ga0068859_100241781
630 Ga0068859_100336232
631 Ga0068859_100620983
632 Ga0068859_101895794
633 Ga0068859_102508821
634 Ga0068864_100024714
635 Ga0068864_100059061
636 Ga0068864_100104762
637 Ga0068864_100109562
638 Ga0068864_101268239
639 Ga0068861_100236720
640 Ga0068861_100584220
641 Ga0068861_101138752
642 Ga0068861_101265936
643 Ga0068861_101551259
644 Ga0068870_10008373
645 Ga0068863_100045288
646 Ga0068863_100120851
647 Ga0068863_100420197
648 Ga0068863_100913374
649 Ga0068863_101070223
650 Ga0068863_101929534
651 Ga0068858_100035366
652 Ga0068858_100538842
653 Ga0068860_100015426
654 Ga0068860_100559387
655 Ga0068862_100120911
656 Ga0068862_100229775
657 Ga0068862_100517547
658 Ga0068862_100924553
659 Ga0081539_10196769
660 Ga0075432_10124204
661 Ga0070716_100051376
662 Ga0097621_100001426
663 Ga0097621_100027793
664 Ga0068871_100003287
665 Ga0068871_100153834
666 Ga0075428_100118887
667 Ga0075428_100520762
668 Ga0075431_100685115
669 Ga0075431_102130829
670 Ga0075433_10019267
671 Ga0075433_10075732
672 Ga0075433_10109415
673 Ga0075433_10175913
674 Ga0075433_10216283
675 Ga0075433_10408670
676 Ga0075433_10635899
677 Ga0075433_10834625
678 Ga0075434_100494826
679 Ga0075434_100745010
680 Ga0075434_101185343
681 Ga0075429_100020930
682 Ga0075429_100091409
683 Ga0068865_100661587
684 Ga0097620_100001811
685 Ga0097620_100193751
686 Ga0097620_100215705
687 Ga0097620_100241779
688 Ga0097620_100336243
689 Ga0097620_100621000
690 Ga0097620_101896169
691 Ga0105251_10126177
692 Ga0105250_10066779
693 Ga0111539_10021805
694 Ga0111539_10067528
695 Ga0111539_10368041
696 Ga0111539_10542842
697 Ga0111539_10576644
698 Ga0111539_10619091
699 Ga0111539_10628406
700 Ga0105245_11397368
701 Ga0105247_10063021
702 Ga0105247_10229151
703 Ga0105247_10373800
704 Ga0105247_10738127
705 Ga0114129_10014948
706 Ga0114129_10016522
707 Ga0114129_10026205
708 Ga0114129_10075461
709 Ga0114129_10134719
710 Ga0114129_10154007
711 Ga0114129_10343094
712 Ga0114129_10358601
713 Ga0114129_11334807
714 Ga0114129_11587625
715 Ga0114129_11797829
716 Ga0105243_10340222
717 Ga0105243_10446805
718 Ga0105243_10506778
719 Ga0105243_10857823
720 Ga0105241_10250020
721 Ga0105241_10649369
722 Ga0105241_11292692
723 Ga0105242_10915773
724 Ga0105242_11045356
725 Ga0105248_10034926
726 Ga0105248_10168584
727 Ga0105248_10308282
728 Ga0105237_10005907
729 Ga0105237_11082854
730 Ga0105237_11090558
731 Ga0105238_10081567
732 Ga0105249_10004360
733 Ga0105249_10021150
734 Ga0105249_11104084
735 Ga0105249_12027158
736 Ga0105239_10298978
737 Ga0105246_10125472
738 Ga0105246_10164491
739 Ga0105246_10180991
740 Ga0105246_10397346
741 Ga0105246_11297664
742 Ga0157373_10063612
743 Ga0157373_10975198
744 Ga0157378_10012768
745 Ga0157378_10204308
746 Ga0157378_10238693
747 Ga0157378_10535812
748 Ga0157378_10864847
749 Ga0157378_11384345
750 Ga0163162_10033300
751 Ga0163162_10128405
752 Ga0163162_10159878
753 Ga0163162_10193549
754 Ga0163162_10333352
755 Ga0157375_10172372
756 Ga0157375_10457916
757 Ga0157375_11510964
758 Ga0163163_10051392
759 Ga0157380_10004227
760 Ga0157380_10013455
761 Ga0157380_10321821
762 Ga0157380_10618380
763 Ga0157377_10215770
764 Ga0157379_10297270
765 Ga0163161_10053788
766 Ga0207697_10343743
767 Ga0207713_1121719
768 Ga0207710_10074056
769 Ga0207710_10367722
770 Ga0207647_10030155
771 Ga0207647_10100051
772 Ga0207647_10509779
773 Ga0207645_10237822
774 Ga0207643_10009806
775 Ga0207684_10000083
776 Ga0207654_10062178
777 Ga0207707_10000025
778 Ga0207671_10007451
779 Ga0207671_10616563
780 Ga0207671_11153312
781 Ga0207660_10005824
782 Ga0207660_10083505
783 Ga0207662_10025624
784 Ga0207662_10270806
785 Ga0207652_10000392
786 Ga0207646_10764144
787 Ga0207681_10001722
788 Ga0207681_10144442
789 Ga0207694_10108634
790 Ga0207650_10001828
791 Ga0207650_10118975
792 Ga0207650_10362832
793 Ga0207650_10633154
794 Ga0207650_11192716
795 Ga0207644_10621211
796 Ga0207690_10041690
797 Ga0207690_10359479
798 Ga0207706_10103542
799 Ga0207706_10218930
800 Ga0207709_10053506
801 Ga0207709_10609416
802 Ga0207670_10000390
803 Ga0207670_10120981
804 Ga0207704_10356543
805 Ga0207665_10155249
806 Ga0207691_10186458
807 Ga0207691_10921827
808 Ga0207711_10100207
809 Ga0207711_10189563
810 Ga0207711_10787627
811 Ga0207689_10091585
812 Ga0207689_10122200
813 Ga0207689_10173305
814 Ga0207689_10646614
815 Ga0207689_11494016
816 Ga0207661_11553879
817 Ga0207679_10098312
818 Ga0207679_10345544
819 Ga0207651_10092785
820 Ga0207651_10113145
821 Ga0207651_11071046
822 Ga0207712_10019137
823 Ga0207712_10119571
824 Ga0207640_10280797
825 Ga0207640_10406991
826 Ga0207640_10679112
827 Ga0207640_11115677
828 Ga0207677_10811874
829 Ga0207677_11141512
830 Ga0207703_10251650
831 Ga0207703_10353411
832 Ga0207639_10026467
833 Ga0207639_11201681
834 Ga0207639_12233585
835 Ga0207708_10004334
836 Ga0207708_10009308
837 Ga0207708_10168125
838 Ga0207708_10208079
839 Ga0207702_10045139
840 Ga0207641_10416591
841 Ga0207641_10487777
842 Ga0207641_10704993
843 Ga0207641_11704135
844 Ga0207641_11793648
845 Ga0207648_10185037
846 Ga0207648_10563192
847 Ga0207648_10862242
848 Ga0207676_10075282
849 Ga0207676_10131925
850 Ga0207676_10368494
851 Ga0207676_11141326
852 Ga0207676_11717211
853 Ga0207674_10370142
854 Ga0207674_11210516
855 Ga0207674_11399413
856 Ga0207675_100053606
857 Ga0207675_100084759
858 Ga0207675_100301674
859 Ga0207675_100482325
860 Ga0207675_100809507
861 Ga0207675_100983996
862 Ga0207698_11864413
863 Ga0207428_10016413
864 Ga0207428_10352977
865 Ga0207428_10433078
866 Ga0207428_10447214
867 Ga0207428_10572881
868 Ga0268266_10686302
869 Ga0268265_10581170
870 Ga0268264_10036600
871 Ga0268264_10696711
872 Ga0314311_1181264
873 Ga0316181_1123300
874 Ga0307408_100003979
875 Ga0307408_101667734
876 Ga0307405_10009046
877 Ga0316577_10051551
878 Ga0307413_10220180
879 Ga0307410_10004927
880 Ga0307406_10010187
881 Ga0307407_10025116
882 Ga0307412_10003326
883 Ga0307412_12119122
884 Ga0307416_100064575
885 Ga0307416_100194095
886 Ga0307416_100699343
887 Ga0307416_101802372
888 Ga0307414_10015105
889 Ga0307411_10009619
890 Ga0307415_100006102
891 Ga0373941_0020008
892 Ga0373962_0225361
893 Ga0373931_0116684
894 Ga0373937_0723017
895 Ga0316584_0294367
896 Ga0395900_0053130
897 Ga0395900_0252883
898 Ga0395898_0232436
899 Ga0395898_1531551
900 Ga0395905_1574205
901 Ga0395901_0220477
902 Ga0395901_0352298
903 Ga0439465_0107370
904 Ga0439431_0039853
905 Ga0439437_005567
906 Ga0439448_0079116
907 Ga0439452_027740
908 Ga0439455_0027084
909 Ga0439457_027136
910 Ga0439462_0018074
911 Ga0439458_0005554
912 Ga0439434_0026637
913 Ga0439434_0029546
914 Ga0495598_0137962
915 Ga0495621_0078463
916 Ga0495668_0462892
917 Ga0495672_0350512
918 Ga0495684_0349158
919 Ga0496102_0093926
920 Ga0496103_0133610
921 Ga0496104_0014201
922 Ga0496104_0364813
923 Ga0496110_0616411
924 Ga0496112_0961296
925 Ga0496112_1449712
926 Ga0496113_0343759
927 Ga0501292_057068
928 Ga0501298_002474
929 Ga0501040_0592517
930 Ga0501046_0171840
931 Ga0501047_0132490
932 Ga0501069_0409943
933 Ga0501076_1049842
934 Ga0501077_0806375
935 Ga0501198_004572
936 Ga0501202_120313
937 Ga0501206_097891
938 Ga0501207_002241
939 Ga0501207_108664
940 Ga0501208_017696
941 Ga0501216_143097
942 Ga0501217_000142
943 Ga0501223_021523
944 Ga0501224_002379
945 Ga0501235_000998
946 Ga0501236_023915
947 Ga0501240_003738
948 Ga0501243_026903
949 Ga0501247_088099
950 Ga0501257_150040
951 Ga0501259_041062
952 Ga0501225_0003145
953 Ga0501225_0015309
954 Ga0501229_000730
955 Ga0501229_005853
956 Ga0501234_003385
957 Ga0501245_020576
958 Ga0501241_125867
959 Ga0501268_096374
960 Ga0501271_012292
961 Ga0501275_037878
962 Ga0501035_1132572
963 Ga0501044_0001520
964 Ga0501226_001123
965 nmdc:mga00v17_698319_c1
966 nmdc:mga0yw44_455611_c1
967 nmdc:mga06z11_414644_c1
968 nmdc:mga05p37_32750_c1
969 nmdc:mga05p37_417318_c1
970 nmdc:mga05p37_64085_c1
971 nmdc:mga05p37_91892_c1
972 nmdc:mga05p37_96954_c1
973 nmdc:mga09592_45017_c1
974 nmdc:mga09592_938913_c1
975 nmdc:mga06r32_241856_c1
976 nmdc:mga06r32_36006_c2
977 nmdc:mga08y16_1124313_c1
978 nmdc:mga08y16_1674244_c1
979 nmdc:mga08y16_21229_c1
980 nmdc:mga08y16_438465_c1
981 nmdc:mga08y16_66133_c1
982 nmdc:mga08y16_82327_c1
983 nmdc:mga0n895_324755_c1
984 nmdc:mga0n895_55348_c1
985 nmdc:mga0rr50_258924_c1
986 nmdc:mga0a205_1008122_c1
987 nmdc:mga0a205_106654_c1
988 nmdc:mga0a205_213237_c1
989 nmdc:mga0a205_23476_c1
990 Ga0501084_0340695

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01741

MscL

Large-conductance mechanosensitive channel, MscL

1

133

0.92

Map