F454604

General Info

Members Datasets Scaffolds Average Seq Length
494 290 494 211

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1089434|Ga0436364_1089434_327_1022
Length 231
Sequence MARWLEAAHAQSGEDDMKVGILGSGDVAKALAAGFVKHGHQVTLGTRDTGKLKDFLAQHQGAQAASFAEAAKFGEVVVLAVKGNVAHDALKATGAANLSGKPVIDATNPIADAPPTNGVLKFFTYLDQSLMEQLQSAFPDAHFVKAYNSVGNARMINPEFPGGAKPTMFICGNDDKAKAVVRGINDQFGWETADMGKAEAARAIEPLCMLWCILGFTKNEWTHAFKLLHQA

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
141 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
142 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
143 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
146 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
147 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
158 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
159 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
182 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
183 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
218 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
283 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
286 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
287 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
288 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0
Rhizoplane 1.82
Rhizosphere 96.56
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1001163 3300002705 Bacteria 11713
2 rootH1_10012424 3300003316 Bacteria 16855
3 Ga0058863_11092087 3300004799 Unclassified 1015
4 Ga0065712_10348092 3300005290 Unclassified 791
5 Ga0065707_10103056 3300005295 Bacteria 2770
6 Ga0070658_10094802 3300005327 Bacteria 2463
7 Ga0070683_100032985 3300005329 Bacteria 4719
8 Ga0070683_100240705 3300005329 Bacteria 1721
9 Ga0070690_100000575 3300005330 Bacteria 18554
10 Ga0070690_100163015 3300005330 Bacteria 1529
11 Ga0070690_100233176 3300005330 Bacteria 1295
12 Ga0070670_101054593 3300005331 Unclassified 740
13 Ga0068869_100001102 3300005334 Bacteria 15741
14 Ga0068869_100208441 3300005334 Bacteria 1544
15 Ga0070666_10198773 3300005335 Bacteria 1410
16 Ga0070666_10465528 3300005335 Bacteria 914
17 Ga0070680_100024246 3300005336 Bacteria 4843
18 Ga0070680_100492952 3300005336 Unclassified 1048
19 Ga0070682_100005071 3300005337 Bacteria 7320
20 Ga0068868_100021926 3300005338 Bacteria 4815
21 Ga0068868_100531993 3300005338 Bacteria 1033
22 Ga0068868_100551003 3300005338 Bacteria 1016
23 Ga0070689_100000814 3300005340 Bacteria 19254
24 Ga0070689_100779427 3300005340 Bacteria 840
25 Ga0070687_100000171 3300005343 Bacteria 22395
26 Ga0070692_10002591 3300005345 Bacteria 7050
27 Ga0070692_10138073 3300005345 Bacteria 1377
28 Ga0070669_100072368 3300005353 Bacteria 2552
29 Ga0070675_101142694 3300005354 Bacteria 716
30 Ga0070671_100431679 3300005355 Bacteria 1129
31 Ga0070673_100141774 3300005364 Bacteria 2028
32 Ga0070673_100727504 3300005364 Bacteria 913
33 Ga0070688_100666436 3300005365 Bacteria 803
34 Ga0070659_100426577 3300005366 Bacteria 1122
35 Ga0070703_10015642 3300005406 Bacteria 2173
36 Ga0070703_10020760 3300005406 Bacteria 1914
37 Ga0070703_10133650 3300005406 Bacteria 914
38 Ga0070713_100076875 3300005436 Bacteria 2837
39 Ga0070713_100532687 3300005436 Bacteria 1111
40 Ga0070713_101150198 3300005436 Unclassified 751
41 Ga0070701_10000376 3300005438 Bacteria 14969
42 Ga0070701_10455238 3300005438 Bacteria 822
43 Ga0070711_100107323 3300005439 Unclassified 2043
44 Ga0070705_100000270 3300005440 Bacteria 31405
45 Ga0070700_100002521 3300005441 Bacteria 9338
46 Ga0070694_100000941 3300005444 Bacteria 16440
47 Ga0070694_100849625 3300005444 Bacteria 751
48 Ga0070708_100204035 3300005445 Bacteria 1852
49 Ga0070662_100033739 3300005457 Unclassified 3606
50 Ga0070681_10046516 3300005458 Bacteria 4338
51 Ga0070681_10049411 3300005458 Bacteria 4200
52 Ga0070681_10721441 3300005458 Bacteria 913
53 Ga0068867_100000947 3300005459 Bacteria 19763
54 Ga0070707_100039874 3300005468 Bacteria 4491
55 Ga0070698_100156887 3300005471 Bacteria 2222
56 Ga0070699_100006690 3300005518 Bacteria 10026
57 Ga0070699_100192247 3300005518 Unclassified 1813
58 Ga0070679_100004354 3300005530 Bacteria 13078
59 Ga0070679_100263424 3300005530 Bacteria 1679
60 Ga0070684_100267973 3300005535 Bacteria 1563
61 Ga0070697_100117970 3300005536 Bacteria 2217
62 Ga0070697_100126144 3300005536 Unclassified 2144
63 Ga0068853_100081521 3300005539 Bacteria 2833
64 Ga0068853_101070345 3300005539 Unclassified 777
65 Ga0070686_100000516 3300005544 Bacteria 23132
66 Ga0070686_100136201 3300005544 Bacteria 1704
67 Ga0070695_100000162 3300005545 Bacteria 31870
68 Ga0070696_100001207 3300005546 Bacteria 16779
69 Ga0070696_100001426 3300005546 Bacteria 15634
70 Ga0070696_100002453 3300005546 Bacteria 12299
71 Ga0070696_100006184 3300005546 Bacteria 8003
72 Ga0070696_100155479 3300005546 Bacteria 1682
73 Ga0070693_100000071 3300005547 Bacteria 42071
74 Ga0070704_100001539 3300005549 Bacteria 12433
75 Ga0070704_100210879 3300005549 Bacteria 1574
76 Ga0068855_100004363 3300005563 Bacteria 17292
77 Ga0068855_100120314 3300005563 Unclassified 3005
78 Ga0068855_100260216 3300005563 Unclassified 1933
79 Ga0068854_100004587 3300005578 Bacteria 8712
80 Ga0068856_100006005 3300005614 Bacteria 11948
81 Ga0068856_100231269 3300005614 Bacteria 1864
82 Ga0070702_100000211 3300005615 Bacteria 19353
83 Ga0068852_100404194 3300005616 Bacteria 1344
84 Ga0068852_100636692 3300005616 Bacteria 1073
85 Ga0068859_100001726 3300005617 Bacteria 22275
86 Ga0068859_100131079 3300005617 Bacteria 2579
87 Ga0068859_100955216 3300005617 Unclassified 940
88 Ga0068861_100138348 3300005719 Bacteria 1984
89 Ga0068870_10002272 3300005840 Bacteria 7980
90 Ga0068863_100268894 3300005841 Unclassified 1650
91 Ga0068858_100001499 3300005842 Bacteria 24066
92 Ga0068858_100775325 3300005842 Bacteria 935
93 Ga0068860_100001892 3300005843 Bacteria 22244
94 Ga0068860_100340829 3300005843 Unclassified 1474
95 Ga0068862_100004151 3300005844 Bacteria 12275
96 Ga0068862_100620310 3300005844 Unclassified 1040
97 Ga0070717_10062554 3300006028 Bacteria 3087
98 Ga0075366_10158785 3300006195 Bacteria 1370
99 Ga0097621_100001372 3300006237 Bacteria 16751
100 Ga0068871_100001218 3300006358 Bacteria 17166
101 Ga0068871_100312456 3300006358 Bacteria 1382
102 Ga0075428_100002539 3300006844 Bacteria 19847
103 Ga0075428_100017442 3300006844 Bacteria 7936
104 Ga0075428_100108989 3300006844 Unclassified 3018
105 Ga0075430_100036869 3300006846 Bacteria 4144
106 Ga0075430_100059571 3300006846 Bacteria 3210
107 Ga0075430_100137138 3300006846 Bacteria 2038
108 Ga0075430_100150465 3300006846 Bacteria 1938
109 Ga0075431_100015650 3300006847 Bacteria 7689
110 Ga0075431_100667690 3300006847 Bacteria 1019
111 Ga0075433_10009944 3300006852 Bacteria 7621
112 Ga0075433_10045538 3300006852 Bacteria 3814
113 Ga0075433_10231962 3300006852 Unclassified 1639
114 Ga0075433_10280195 3300006852 Unclassified 1477
115 Ga0075433_10886946 3300006852 Unclassified 778
116 Ga0075433_10956674 3300006852 Unclassified 746
117 Ga0075434_100001831 3300006871 Bacteria 18346
118 Ga0075434_100025766 3300006871 Bacteria 5757
119 Ga0075434_100336546 3300006871 Bacteria 1530
120 Ga0075434_100495130 3300006871 Unclassified 1243
121 Ga0075429_100005800 3300006880 Bacteria 10655
122 Ga0068865_100000407 3300006881 Bacteria 23897
123 Ga0075436_100009289 3300006914 Bacteria 6728
124 Ga0075436_100173322 3300006914 Bacteria 1523
125 Ga0097620_100001726 3300006931 Bacteria 22275
126 Ga0097620_100131079 3300006931 Bacteria 2579
127 Ga0097620_100955446 3300006931 Unclassified 940
128 Ga0075435_100008379 3300007076 Bacteria 7414
129 Ga0075435_100153002 3300007076 Bacteria 1940
130 Ga0105240_10103152 3300009093 Bacteria 3466
131 Ga0105240_10508208 3300009093 Unclassified 1339
132 Ga0105240_10537942 3300009093 Unclassified 1294
133 Ga0105240_10937698 3300009093 Bacteria 929
134 Ga0111539_10013487 3300009094 Bacteria 10213
135 Ga0111539_10034696 3300009094 Bacteria 6113
136 Ga0111539_10386804 3300009094 Bacteria 1629
137 Ga0105245_10003506 3300009098 Bacteria 14041
138 Ga0105245_10010072 3300009098 Bacteria 8236
139 Ga0105245_10016870 3300009098 Bacteria 6375
140 Ga0114129_10002308 3300009147 Bacteria 26441
141 Ga0114129_10006698 3300009147 Bacteria 16362
142 Ga0114129_10037806 3300009147 Bacteria 6813
143 Ga0114129_10223362 3300009147 Unclassified 2540
144 Ga0114129_10530866 3300009147 Bacteria 1533
145 Ga0114129_11600472 3300009147 Bacteria 798
146 Ga0105243_10000583 3300009148 Bacteria 36624
147 Ga0105241_10059707 3300009174 Unclassified 2933
148 Ga0105242_10003882 3300009176 Bacteria 11615
149 Ga0105248_10012840 3300009177 Bacteria 9239
150 Ga0105248_10041798 3300009177 Bacteria 5141
151 Ga0105248_10539172 3300009177 Bacteria 1316
152 Ga0105237_10137006 3300009545 Bacteria 2442
153 Ga0105249_10195820 3300009553 Bacteria 1975
154 Ga0105249_10259769 3300009553 Bacteria 1725
155 Ga0105239_10614660 3300010375 Unclassified 1240
156 Ga0105239_10769853 3300010375 Bacteria 1102
157 Ga0105246_10029011 3300011119 Bacteria 3639
158 Ga0157371_10427135 3300013102 Bacteria 972
159 Ga0157370_10086832 3300013104 Bacteria 2938
160 Ga0157370_10294498 3300013104 Bacteria 1499
161 Ga0157369_10469733 3300013105 Bacteria 1302
162 Ga0157374_10235234 3300013296 Bacteria 1800
163 Ga0157378_10002943 3300013297 Bacteria 15146
164 Ga0157378_10149320 3300013297 Unclassified 2177
165 Ga0157378_10167866 3300013297 Unclassified 2057
166 Ga0157378_10999597 3300013297 Unclassified 871
167 Ga0163162_10023911 3300013306 Bacteria 6029
168 Ga0157375_10075762 3300013308 Bacteria 3389
169 Ga0163163_10037746 3300014325 Unclassified 4701
170 Ga0163163_10059219 3300014325 Bacteria 3787
171 Ga0163163_10134436 3300014325 Bacteria 2513
172 Ga0157380_10188852 3300014326 Bacteria 1817
173 Ga0157380_10255045 3300014326 Bacteria 1590
174 Ga0157379_10059470 3300014968 Bacteria 3417
175 Ga0157379_10143233 3300014968 Bacteria 2155
176 Ga0157376_10001972 3300014969 Bacteria 13728
177 Ga0157376_10413954 3300014969 Bacteria 1306
178 Ga0163161_10504538 3300017792 Bacteria 986
179 Ga0207688_10112226 3300025901 Bacteria 1584
180 Ga0207643_10007956 3300025908 Bacteria 5689
181 Ga0207684_10219127 3300025910 Bacteria 1642
182 Ga0207654_10291887 3300025911 Bacteria 1106
183 Ga0207707_10094747 3300025912 Bacteria 2609
184 Ga0207695_10367379 3300025913 Bacteria 1325
185 Ga0207695_10667298 3300025913 Bacteria 920
186 Ga0207693_10483370 3300025915 Bacteria 967
187 Ga0207663_10053592 3300025916 Unclassified 2521
188 Ga0207660_10002021 3300025917 Bacteria 13487
189 Ga0207660_10123594 3300025917 Bacteria 1963
190 Ga0207662_10000050 3300025918 Bacteria 51610
191 Ga0207652_10104896 3300025921 Bacteria 2501
192 Ga0207652_10249761 3300025921 Bacteria 1600
193 Ga0207646_10031789 3300025922 Bacteria 4778
194 Ga0207681_10510662 3300025923 Unclassified 985
195 Ga0207687_10002282 3300025927 Bacteria 13054
196 Ga0207687_10005719 3300025927 Bacteria 8226
197 Ga0207700_10084709 3300025928 Bacteria 2486
198 Ga0207664_10450903 3300025929 Bacteria 1148
199 Ga0207644_10718154 3300025931 Bacteria 834
200 Ga0207690_10358947 3300025932 Bacteria 1154
201 Ga0207706_10039571 3300025933 Unclassified 4180
202 Ga0207709_10001116 3300025935 Bacteria 19677
203 Ga0207670_10005774 3300025936 Bacteria 6831
204 Ga0207704_10000431 3300025938 Bacteria 18723
205 Ga0207665_10240954 3300025939 Bacteria 1332
206 Ga0207711_10026049 3300025941 Bacteria 4905
207 Ga0207711_10238400 3300025941 Bacteria 1667
208 Ga0207689_10002662 3300025942 Bacteria 16515
209 Ga0207689_10321695 3300025942 Bacteria 1284
210 Ga0207661_10400799 3300025944 Bacteria 1244
211 Ga0207667_10106016 3300025949 Unclassified 2900
212 Ga0207667_10212501 3300025949 Unclassified 1983
213 Ga0207667_10672856 3300025949 Bacteria 1039
214 Ga0207651_10167719 3300025960 Bacteria 1728
215 Ga0207651_10648493 3300025960 Bacteria 927
216 Ga0207712_10002625 3300025961 Bacteria 11514
217 Ga0207640_10035267 3300025981 Bacteria 3129
218 Ga0207677_11054670 3300026023 Bacteria 739
219 Ga0207703_10600159 3300026035 Bacteria 1041
220 Ga0207639_10035656 3300026041 Bacteria 3682
221 Ga0207639_10205227 3300026041 Bacteria 1693
222 Ga0207708_10000375 3300026075 Bacteria 34939
223 Ga0207708_10388217 3300026075 Bacteria 1152
224 Ga0207702_10004664 3300026078 Bacteria 12107
225 Ga0207702_10357172 3300026078 Bacteria 1400
226 Ga0207702_10423683 3300026078 Bacteria 1287
227 Ga0207641_10165657 3300026088 Bacteria 2013
228 Ga0207641_10746170 3300026088 Bacteria 966
229 Ga0207648_10000663 3300026089 Bacteria 38545
230 Ga0207675_100000454 3300026118 Bacteria 39739
231 Ga0207675_101150102 3300026118 Bacteria 796
232 Ga0207428_10003019 3300027907 Bacteria 16581
233 Ga0207428_10011324 3300027907 Bacteria 7889
234 Ga0207428_10120703 3300027907 Unclassified 2010
235 Ga0207428_10203701 3300027907 Bacteria 1488
236 Ga0268265_10001189 3300028380 Bacteria 22690
237 Ga0268264_10002258 3300028381 Bacteria 17067
238 Ga0265337_1056358 3300028556 Bacteria 1096
239 Ga0265334_10008611 3300028573 Bacteria 4332
240 Ga0265334_10040985 3300028573 Bacteria 1811
241 Ga0265334_10077648 3300028573 Unclassified 1228
242 Ga0265318_10000007 3300028577 Bacteria 280699
243 Ga0265323_10014730 3300028653 Bacteria 3086
244 Ga0265322_10072800 3300028654 Bacteria 975
245 Ga0265336_10001353 3300028666 Bacteria 11359
246 Ga0265336_10018355 3300028666 Unclassified 2267
247 Ga0265338_10024630 3300028800 Bacteria 6141
248 Ga0265338_10058799 3300028800 Bacteria 3390
249 Ga0265338_10078097 3300028800 Bacteria 2794
250 Ga0265338_10391399 3300028800 Bacteria 992
251 Ga0265324_10000006 3300029957 Bacteria 267048
252 Ga0265324_10001274 3300029957 Bacteria 14809
253 Ga0265324_10014449 3300029957 Bacteria 2922
254 Ga0265330_10187845 3300031235 Bacteria 875
255 Ga0265328_10005997 3300031239 Bacteria 5175
256 Ga0265320_10040009 3300031240 Bacteria 2340
257 Ga0265325_10000767 3300031241 Bacteria 23240
258 Ga0265340_10122090 3300031247 Bacteria 1198
259 Ga0265331_10026866 3300031250 Bacteria 2890
260 Ga0265331_10094943 3300031250 Bacteria 1376
261 Ga0265316_10054216 3300031344 Unclassified 3140
262 Ga0307509_10403004 3300031507 Bacteria 1074
263 Ga0265313_10015730 3300031595 Bacteria 4386
264 Ga0265314_10000594 3300031711 Bacteria 45538
265 Ga0265314_10004530 3300031711 Bacteria 12844
266 Ga0265314_10197385 3300031711 Unclassified 1192
267 Ga0265314_10264023 3300031711 Bacteria 982
268 Ga0265342_10005610 3300031712 Bacteria 9512
269 Ga0265342_10009909 3300031712 Bacteria 6664
270 Ga0373930_0001188 3300034816 Bacteria 3821
271 Ga0373930_0028237 3300034816 Bacteria 1141
272 Ga0373959_0032979 3300034820 Bacteria 1055
273 Ga0373938_0003154 3300034957 Bacteria 2678
274 Ga0373934_0007838 3300035086 Bacteria 3970
275 Ga0373944_0015791 3300035089 Bacteria 2121
276 Ga0373932_0026808 3300035112 Bacteria 1571
277 Ga0373936_0021937 3300035113 Bacteria 2485
278 Ga0373945_0036345 3300035116 Bacteria 1764
279 Ga0373954_0003898 3300035118 Bacteria 6385
280 Ga0373956_0220660 3300035119 Unclassified 900
281 Ga0373957_0027242 3300035120 Bacteria 2075
282 Ga0373960_0032661 3300035121 Bacteria 1463
283 Ga0373946_0082710 3300035171 Bacteria 1409
284 Ga0373955_0014946 3300035172 Bacteria 3790
285 Ga0373955_0175439 3300035172 Bacteria 1270
286 Ga0373924_0020673 3300035410 Bacteria 2561
287 Ga0373931_0001986 3300035691 Bacteria 9001
288 Ga0373931_0004207 3300035691 Bacteria 6555
289 Ga0373935_0236273 3300035692 Bacteria 1274
290 Ga0373927_0045469 3300035695 Bacteria 2840
291 Ga0373927_0163508 3300035695 Bacteria 1458
292 Ga0373933_0000974 3300035724 Bacteria 17483
293 Ga0373933_0012850 3300035724 Bacteria 4630
294 Ga0373933_0052806 3300035724 Unclassified 2433
295 Ga0373933_0137047 3300035724 Bacteria 1543
296 Ga0373933_0212153 3300035724 Unclassified 1241
297 Ga0373947_0015528 3300035725 Bacteria 4373
298 Ga0373937_0000924 3300036401 Bacteria 24924
299 Ga0373937_0005804 3300036401 Bacteria 10612
300 Ga0373937_0021182 3300036401 Bacteria 5834
301 Ga0373937_0041786 3300036401 Unclassified 4183
302 Ga0373937_0221736 3300036401 Bacteria 1780
303 Ga0373937_0558530 3300036401 Bacteria 1087
304 Ga0373937_0598309 3300036401 Bacteria 1047
305 Ga0373925_0172213 3300037068 Bacteria 1709
306 Ga0395900_0560718 3300037418 Bacteria 1086
307 Ga0436364_1089434 3300037853 Bacteria 1081
308 Ga0436362_0187221 3300039453 Bacteria 736
309 Ga0451802_1021577 3300041460 Unclassified 718
310 Ga0439462_0021171 3300042015 Unclassified 1698
311 Ga0451577_0341339 3300042876 Bacteria 1358
312 Ga0451577_1271237 3300042876 Unclassified 655
313 Ga0453683_0012579 3300044673 Bacteria 5544
314 Ga0453683_0111262 3300044673 Bacteria 1722
315 Ga0453684_0121878 3300044712 Bacteria 3146
316 Ga0453684_0579852 3300044712 Unclassified 1232
317 Ga0451576_0001630 3300045051 Bacteria 37561
318 Ga0451576_0006369 3300045051 Bacteria 14494
319 Ga0451576_0116154 3300045051 Bacteria 2786
320 Ga0451576_0222538 3300045051 Bacteria 1970
321 Ga0451576_0450212 3300045051 Bacteria 1351
322 Ga0451576_0932945 3300045051 Unclassified 910
323 Ga0451576_1040521 3300045051 Bacteria 858
324 Ga0466967_0344392 3300045976 Bacteria 1442
325 Ga0495592_0039769 3300046454 Bacteria 3532
326 Ga0495603_0006754 3300046455 Bacteria 6885
327 Ga0495629_0002047 3300046459 Bacteria 15675
328 Ga0495629_0129217 3300046459 Bacteria 1760
329 Ga0495651_0000214 3300046462 Bacteria 44308
330 Ga0495653_0001647 3300046463 Bacteria 17541
331 Ga0495580_0005855 3300046472 Bacteria 10087
332 Ga0495580_0347653 3300046472 Bacteria 1005
333 Ga0495582_0039527 3300046473 Bacteria 2597
334 Ga0495662_0038562 3300046476 Bacteria 2309
335 Ga0495662_0053605 3300046476 Bacteria 1948
336 Ga0495664_0006909 3300046477 Bacteria 6282
337 Ga0495664_0011809 3300046477 Bacteria 4933
338 Ga0495594_0015299 3300046499 Bacteria 4028
339 Ga0495594_0274144 3300046499 Bacteria 961
340 Ga0495594_0376614 3300046499 Bacteria 808
341 Ga0495608_0009530 3300046511 Bacteria 6781
342 Ga0495618_0000537 3300046514 Bacteria 26842
343 Ga0495618_0001686 3300046514 Bacteria 14661
344 Ga0495618_0009614 3300046514 Bacteria 5839
345 Ga0495628_0030182 3300046516 Bacteria 4391
346 Ga0495630_0063234 3300046517 Bacteria 2780
347 Ga0495630_0087008 3300046517 Bacteria 2360
348 Ga0495630_0408732 3300046517 Bacteria 1040
349 Ga0495630_0475063 3300046517 Bacteria 958
350 Ga0495666_0045798 3300046526 Bacteria 2109
351 Ga0495652_0002479 3300046529 Bacteria 18959
352 Ga0495665_0181629 3300046531 Bacteria 1093
353 Ga0495640_0007570 3300046533 Bacteria 8532
354 Ga0495640_0057472 3300046533 Bacteria 2655
355 Ga0495640_0169488 3300046533 Bacteria 1395
356 Ga0495586_0004334 3300046535 Bacteria 7580
357 Ga0495587_0000715 3300046536 Bacteria 22151
358 Ga0495645_0008358 3300046543 Bacteria 7226
359 Ga0495667_0047639 3300046559 Bacteria 2831
360 Ga0495634_0003492 3300046642 Bacteria 12596
361 Ga0495634_0029297 3300046642 Bacteria 3812
362 Ga0495634_0089664 3300046642 Bacteria 1998
363 Ga0495634_0271576 3300046642 Bacteria 1032
364 Ga0495635_0000562 3300046663 Bacteria 23704
365 Ga0495635_0367398 3300046663 Bacteria 958
366 Ga0495635_0592665 3300046663 Unclassified 724
367 Ga0495588_0070957 3300046674 Bacteria 1811
368 Ga0495657_0109018 3300046675 Bacteria 1756
369 Ga0495599_0008513 3300046678 Bacteria 6240
370 Ga0495623_0001280 3300046679 Bacteria 17075
371 Ga0495623_0064891 3300046679 Bacteria 2284
372 Ga0495646_0002811 3300046680 Bacteria 10773
373 Ga0495647_0005582 3300046681 Bacteria 4130
374 Ga0495658_0002156 3300046683 Bacteria 9965
375 Ga0495658_0013385 3300046683 Bacteria 4175
376 Ga0495658_0016587 3300046683 Bacteria 3791
377 Ga0495613_0012341 3300046689 Bacteria 6347
378 Ga0495613_0049700 3300046689 Bacteria 3094
379 Ga0495624_0210442 3300046690 Bacteria 1180
380 Ga0495624_0243983 3300046690 Bacteria 1087
381 Ga0495600_0013786 3300046809 Bacteria 5090
382 Ga0495600_0383198 3300046809 Bacteria 877
383 Ga0495581_0089301 3300047315 Bacteria 1787
384 Ga0495581_0178096 3300047315 Bacteria 1243
385 Ga0495604_0000382 3300047317 Bacteria 40024
386 Ga0495674_0003824 3300047319 Bacteria 14620
387 Ga0495674_0100098 3300047319 Bacteria 2467
388 Ga0495680_0001240 3300047322 Bacteria 27994
389 Ga0495680_0012581 3300047322 Bacteria 7436
390 Ga0495675_0001812 3300047444 Bacteria 12732
391 Ga0495684_0294040 3300047471 Bacteria 1168
392 Ga0495593_0057173 3300047673 Bacteria 2049
393 Ga0495602_0001751 3300048088 Bacteria 21661
394 Ga0495602_0321645 3300048088 Unclassified 1125
395 Ga0496100_0456019 3300048903 Bacteria 981
396 Ga0496106_0735135 3300048909 Bacteria 785
397 Ga0496107_0288316 3300048910 Bacteria 1222
398 Ga0496108_0416085 3300048911 Bacteria 1174
399 Ga0496109_0136610 3300048912 Bacteria 2291
400 Ga0496109_0877514 3300048912 Bacteria 835
401 Ga0496114_0035068 3300048917 Unclassified 4142
402 Ga0496115_0208839 3300048918 Bacteria 1613
403 Ga0501033_0005965 3300049570 Bacteria 9563
404 Ga0501033_0037825 3300049570 Bacteria 3611
405 Ga0501034_0495994 3300049571 Bacteria 1135
406 Ga0501036_0002300 3300049572 Bacteria 14940
407 Ga0501037_0011409 3300049573 Bacteria 6539
408 Ga0501037_0179566 3300049573 Bacteria 1502
409 Ga0501038_0016769 3300049574 Bacteria 6634
410 Ga0501039_0009384 3300049575 Bacteria 7458
411 Ga0501039_0753363 3300049575 Bacteria 760
412 Ga0501040_0009441 3300049576 Bacteria 6361
413 Ga0501040_0190712 3300049576 Bacteria 1454
414 Ga0501041_0001494 3300049577 Bacteria 12958
415 Ga0501041_0252075 3300049577 Bacteria 1109
416 Ga0501042_0001293 3300049578 Bacteria 14587
417 Ga0501043_0013889 3300049579 Bacteria 6301
418 Ga0501046_0005727 3300049580 Bacteria 11088
419 Ga0501047_0006762 3300049581 Bacteria 10774
420 Ga0501048_0055615 3300049582 Bacteria 2808
421 Ga0501068_0053576 3300049584 Bacteria 2443
422 Ga0501069_0041718 3300049585 Bacteria 2537
423 Ga0501070_0012341 3300049586 Bacteria 7208
424 Ga0501071_0007128 3300049587 Bacteria 7307
425 Ga0501071_0031340 3300049587 Bacteria 3768
426 Ga0501071_0344349 3300049587 Bacteria 1134
427 Ga0501072_0001780 3300049588 Bacteria 16027
428 Ga0501072_0261055 3300049588 Unclassified 1379
429 Ga0501073_0028416 3300049589 Bacteria 3996
430 Ga0501074_0006854 3300049590 Bacteria 8228
431 Ga0501074_0023638 3300049590 Bacteria 4467
432 Ga0501075_0039172 3300049591 Bacteria 3546
433 Ga0501076_0001146 3300049592 Bacteria 17555
434 Ga0501076_0297000 3300049592 Bacteria 1324
435 Ga0501077_0003582 3300049593 Bacteria 9330
436 Ga0501079_0002542 3300049741 Bacteria 13241
437 Ga0501079_0441980 3300049741 Bacteria 1021
438 Ga0501080_0236289 3300049742 Bacteria 1669
439 Ga0501081_0000579 3300049743 Bacteria 20804
440 Ga0501081_0012163 3300049743 Bacteria 5645
441 Ga0501081_0232471 3300049743 Bacteria 1343
442 Ga0501083_0369263 3300049744 Bacteria 933
443 Ga0501035_0081117 3300049822 Bacteria 2863
444 Ga0501035_0082106 3300049822 Bacteria 2844
445 Ga0501044_0015384 3300049823 Bacteria 8240
446 Ga0501045_0284596 3300049824 Unclassified 1231
447 nmdc:mga0k408_108228_c1 3300050493 Bacteria 1642
448 nmdc:mga05p37_1129375_c1 3300050507 Unclassified 817
449 nmdc:mga05p37_138229_c1 3300050507 Bacteria 2986
450 nmdc:mga05p37_1657_c2 3300050507 Bacteria 25223
451 nmdc:mga05p37_3701_c1 3300050507 Bacteria 17881
452 nmdc:mga05p37_450319_c1 3300050507 Unclassified 1490
453 nmdc:mga05p37_912149_c1 3300050507 Bacteria 946
454 nmdc:mga09592_199016_c1 3300050508 Unclassified 1735
455 nmdc:mga09592_2089_c1 3300050508 Bacteria 16115
456 nmdc:mga0qj67_164083_c1 3300050509 Bacteria 1803
457 nmdc:mga0qj67_51159_c1 3300050509 Bacteria 3266
458 nmdc:mga06r32_254234_c1 3300050510 Unclassified 1745
459 nmdc:mga06r32_27446_c1 3300050510 Bacteria 5318
460 nmdc:mga06r32_840285_c1 3300050510 Bacteria 877
461 nmdc:mga08y16_235687_c1 3300050511 Bacteria 1893
462 nmdc:mga08y16_309225_c1 3300050511 Bacteria 1628
463 nmdc:mga08y16_59357_c1 3300050511 Unclassified 3996
464 nmdc:mga0n895_1877_c1 3300050512 Bacteria 16061
465 nmdc:mga0n895_205287_c1 3300050512 Unclassified 2001
466 nmdc:mga0n895_388879_c1 3300050512 Unclassified 1411
467 nmdc:mga0n895_43173_c2 3300050512 Bacteria 1410
468 nmdc:mga0n895_93081_c1 3300050512 Bacteria 3018
469 nmdc:mga0rr50_231521_c1 3300050513 Bacteria 1529
470 nmdc:mga0rr50_82541_c1 3300050513 Bacteria 2483
471 nmdc:mga08x19_2511_c1 3300050514 Bacteria 11151
472 nmdc:mga08x19_405939_c1 3300050514 Bacteria 956
473 nmdc:mga0a205_239550_c1 3300050515 Unclassified 1695
474 nmdc:mga0a205_24210_c1 3300050515 Bacteria 5768
475 nmdc:mga0a205_29218_c1 3300050515 Bacteria 5276
476 nmdc:mga0a205_413836_c1 3300050515 Bacteria 1211
477 nmdc:mga0a205_760677_c1 3300050515 Bacteria 817
478 nmdc:mga0a205_98374_c1 3300050515 Unclassified 2824
479 Ga0495601_0026105 3300053077 Unclassified 3605
480 Ga0495612_0001450 3300053078 Bacteria 9771
481 Ga0495595_0003038 3300053084 Bacteria 6636
482 Ga0495595_0255860 3300053084 Unclassified 877
483 Ga0495619_0003346 3300053085 Bacteria 10364
484 Ga0500559_0189046 3300053136 Bacteria 971
485 Ga0500552_030087 3300053733 Bacteria 831
486 Ga0501084_0015970 3300054114 Bacteria 6231
487 Ga0501084_0218208 3300054114 Bacteria 1609
488 Ga0590071_000266 3300059421 Bacteria 15231
489 Ga0590074_000639 3300059423 Bacteria 5279
490 Ga0590075_000189 3300059424 Bacteria 17095
491 Ga0590077_000037 3300059426 Bacteria 30721
492 Ga0501082_0018016 3300060353 Bacteria 6082
493 Ga0530510_0016366 3300061734 Bacteria 5248
494 Ga0530510_0106335 3300061734 Bacteria 2054

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035113 Ga0373936_0021937 Ga0373936_0021937_566_1210 178
2 3300035116 Ga0373945_0036345 Ga0373945_0036345_677_1321 178
3 3300035171 Ga0373946_0082710 Ga0373946_0082710_635_1279 178
4 3300035695 Ga0373927_0163508 Ga0373927_0163508_346_990 178
5 3300035725 Ga0373947_0015528 Ga0373947_0015528_448_1092 178
6 3300037068 Ga0373925_0172213 Ga0373925_0172213_497_1141 178
7 3300046455 Ga0495603_0006754 Ga0495603_0006754_4055_4699 178
8 3300046472 Ga0495580_0005855 Ga0495580_0005855_6182_6826 178
9 3300046473 Ga0495582_0039527 Ga0495582_0039527_1940_2584 178
10 3300046517 Ga0495630_0087008 Ga0495630_0087008_1649_2293 178
11 3300046526 Ga0495666_0045798 Ga0495666_0045798_345_989 178
12 3300046531 Ga0495665_0181629 Ga0495665_0181629_334_978 178
13 3300046535 Ga0495586_0004334 Ga0495586_0004334_6105_6749 178
14 3300046674 Ga0495588_0070957 Ga0495588_0070957_25_669 178
15 3300046683 Ga0495658_0002156 Ga0495658_0002156_3037_3681 178
16 3300005338 Ga0068868_100551003 Ga0068868_1005510031 184
17 3300014325 Ga0163163_10059219 Ga0163163_100592191 184
18 3300042876 Ga0451577_1271237 Ga0451577_1271237_81_641 184
19 3300006871 Ga0075434_100001831 Ga0075434_10000183119 185
20 3300036401 Ga0373937_0558530 Ga0373937_0558530_203_847 185
21 3300046499 Ga0495594_0274144 Ga0495594_0274144_28_588 185
22 3300050512 nmdc:mga0n895_1877_c1 nmdc:mga0n895_1877_c1_9901_10464 185
23 3300050514 nmdc:mga08x19_405939_c1 nmdc:mga08x19_405939_c1_379_939 185
24 3300036401 Ga0373937_0221736 Ga0373937_0221736_622_1260 190
25 3300044712 Ga0453684_0121878 Ga0453684_0121878_2234_2815 192
26 3300035118 Ga0373954_0003898 Ga0373954_0003898_4422_5060 193
27 3300035119 Ga0373956_0220660 Ga0373956_0220660_14_652 193
28 3300035724 Ga0373933_0012850 Ga0373933_0012850_3718_4356 193
29 3300036401 Ga0373937_0021182 Ga0373937_0021182_111_749 193
30 3300046459 Ga0495629_0129217 Ga0495629_0129217_284_922 193
31 3300046514 Ga0495618_0001686 Ga0495618_0001686_8782_9420 193
32 3300046517 Ga0495630_0408732 Ga0495630_0408732_238_876 193
33 3300046533 Ga0495640_0057472 Ga0495640_0057472_679_1317 193
34 3300046642 Ga0495634_0029297 Ga0495634_0029297_2905_3543 193
35 3300046663 Ga0495635_0367398 Ga0495635_0367398_197_835 193
36 3300046689 Ga0495613_0012341 Ga0495613_0012341_4173_4811 193
37 3300047322 Ga0495680_0012581 Ga0495680_0012581_1742_2380 193
38 3300047471 Ga0495684_0294040 Ga0495684_0294040_371_1009 193
39 3300053136 Ga0500559_0189046 Ga0500559_0189046_127_771 193
40 3300009093 Ga0105240_10103152 Ga0105240_101031524 195
41 3300009093 Ga0105240_10508208 Ga0105240_105082082 195
42 3300027907 Ga0207428_10203701 Ga0207428_102037012 195
43 3300009094 Ga0111539_10386804 Ga0111539_103868042 196
44 3300050511 nmdc:mga08y16_309225_c1 nmdc:mga08y16_309225_c1_478_1119 196
45 3300026075 Ga0207708_10388217 Ga0207708_103882172 197
46 3300031240 Ga0265320_10040009 Ga0265320_100400094 197
47 3300031250 Ga0265331_10094943 Ga0265331_100949431 197
48 3300005338 Ga0068868_100531993 Ga0068868_1005319931 198
49 3300025960 Ga0207651_10648493 Ga0207651_106484932 198
50 3300041460 Ga0451802_1021577 Ga0451802_1021577_10_618 199
51 3300050512 nmdc:mga0n895_388879_c1 nmdc:mga0n895_388879_c1_443_1054 200
52 3300046663 Ga0495635_0592665 Ga0495635_0592665_22_630 201
53 3300049576 Ga0501040_0190712 Ga0501040_0190712_563_1177 201
54 3300049577 Ga0501041_0252075 Ga0501041_0252075_24_638 201
55 3300049743 Ga0501081_0012163 Ga0501081_0012163_3104_3718 201
56 3300049824 Ga0501045_0284596 Ga0501045_0284596_58_672 201
57 3300061734 Ga0530510_0106335 Ga0530510_0106335_1296_1910 201
58 3300045976 Ga0466967_0344392 Ga0466967_0344392_289_915 203
59 3300028573 Ga0265334_10008611 Ga0265334_100086114 204
60 3300028577 Ga0265318_10000007 Ga0265318_10000007153 204
61 3300029957 Ga0265324_10014449 Ga0265324_100144493 204
62 3300031595 Ga0265313_10015730 Ga0265313_100157305 204
63 3300031711 Ga0265314_10000594 Ga0265314_1000059424 204
64 3300049744 Ga0501083_0369263 Ga0501083_0369263_110_733 204
65 3300034820 Ga0373959_0032979 Ga0373959_0032979_268_906 206
66 3300003316 rootH1_10012424 rootH1_1001242414 208
67 3300049743 Ga0501081_0232471 Ga0501081_0232471_493_1137 209
68 3300005457 Ga0070662_100033739 Ga0070662_1000337393 210
69 3300006871 Ga0075434_100495130 Ga0075434_1004951302 210
70 3300013297 Ga0157378_10149320 Ga0157378_101493202 210
71 3300025933 Ga0207706_10039571 Ga0207706_100395713 210
72 3300026023 Ga0207677_11054670 Ga0207677_110546701 210
73 3300037418 Ga0395900_0560718 Ga0395900_0560718_37_702 210
74 3300042015 Ga0439462_0021171 Ga0439462_0021171_698_1342 210
75 3300044712 Ga0453684_0579852 Ga0453684_0579852_400_1041 210
76 3300002705 JGI25156J39149_1001163 JGI25156J39149_10011637 211
77 3300004799 Ga0058863_11092087 Ga0058863_110920872 211
78 3300005290 Ga0065712_10348092 Ga0065712_103480921 211
79 3300005295 Ga0065707_10103056 Ga0065707_101030562 211
80 3300005327 Ga0070658_10094802 Ga0070658_100948023 211
81 3300005329 Ga0070683_100032985 Ga0070683_1000329856 211
82 3300005329 Ga0070683_100240705 Ga0070683_1002407051 211
83 3300005330 Ga0070690_100000575 Ga0070690_1000005751 211
84 3300005330 Ga0070690_100163015 Ga0070690_1001630151 211
85 3300005330 Ga0070690_100233176 Ga0070690_1002331762 211
86 3300005331 Ga0070670_101054593 Ga0070670_1010545931 211
87 3300005334 Ga0068869_100001102 Ga0068869_1000011026 211
88 3300005334 Ga0068869_100208441 Ga0068869_1002084412 211
89 3300005335 Ga0070666_10198773 Ga0070666_101987732 211
90 3300005335 Ga0070666_10465528 Ga0070666_104655281 211
91 3300005336 Ga0070680_100024246 Ga0070680_1000242463 211
92 3300005336 Ga0070680_100492952 Ga0070680_1004929521 211
93 3300005337 Ga0070682_100005071 Ga0070682_1000050716 211
94 3300005338 Ga0068868_100021926 Ga0068868_1000219264 211
95 3300005340 Ga0070689_100000814 Ga0070689_10000081411 211
96 3300005340 Ga0070689_100779427 Ga0070689_1007794271 211
97 3300005343 Ga0070687_100000171 Ga0070687_1000001718 211
98 3300005345 Ga0070692_10002591 Ga0070692_100025912 211
99 3300005345 Ga0070692_10138073 Ga0070692_101380732 211
100 3300005353 Ga0070669_100072368 Ga0070669_1000723681 211
101 3300005354 Ga0070675_101142694 Ga0070675_1011426941 211
102 3300005355 Ga0070671_100431679 Ga0070671_1004316792 211
103 3300005364 Ga0070673_100141774 Ga0070673_1001417742 211
104 3300005364 Ga0070673_100727504 Ga0070673_1007275041 211
105 3300005365 Ga0070688_100666436 Ga0070688_1006664361 211
106 3300005366 Ga0070659_100426577 Ga0070659_1004265771 211
107 3300005406 Ga0070703_10015642 Ga0070703_100156422 211
108 3300005406 Ga0070703_10020760 Ga0070703_100207602 211
109 3300005406 Ga0070703_10133650 Ga0070703_101336502 211
110 3300005436 Ga0070713_100076875 Ga0070713_1000768754 211
111 3300005436 Ga0070713_100532687 Ga0070713_1005326872 211
112 3300005436 Ga0070713_101150198 Ga0070713_1011501981 211
113 3300005438 Ga0070701_10000376 Ga0070701_1000037612 211
114 3300005438 Ga0070701_10455238 Ga0070701_104552381 211
115 3300005439 Ga0070711_100107323 Ga0070711_1001073233 211
116 3300005440 Ga0070705_100000270 Ga0070705_10000027013 211
117 3300005441 Ga0070700_100002521 Ga0070700_1000025214 211
118 3300005444 Ga0070694_100000941 Ga0070694_10000094113 211
119 3300005444 Ga0070694_100849625 Ga0070694_1008496251 211
120 3300005445 Ga0070708_100204035 Ga0070708_1002040352 211
121 3300005458 Ga0070681_10046516 Ga0070681_100465165 211
122 3300005458 Ga0070681_10049411 Ga0070681_100494112 211
123 3300005458 Ga0070681_10721441 Ga0070681_107214412 211
124 3300005459 Ga0068867_100000947 Ga0068867_10000094710 211
125 3300005468 Ga0070707_100039874 Ga0070707_1000398742 211
126 3300005471 Ga0070698_100156887 Ga0070698_1001568873 211
127 3300005518 Ga0070699_100006690 Ga0070699_1000066903 211
128 3300005518 Ga0070699_100192247 Ga0070699_1001922472 211
129 3300005530 Ga0070679_100004354 Ga0070679_10000435412 211
130 3300005530 Ga0070679_100263424 Ga0070679_1002634242 211
131 3300005535 Ga0070684_100267973 Ga0070684_1002679732 211
132 3300005536 Ga0070697_100117970 Ga0070697_1001179702 211
133 3300005536 Ga0070697_100126144 Ga0070697_1001261442 211
134 3300005539 Ga0068853_100081521 Ga0068853_1000815213 211
135 3300005539 Ga0068853_101070345 Ga0068853_1010703451 211
136 3300005544 Ga0070686_100000516 Ga0070686_1000005164 211
137 3300005544 Ga0070686_100136201 Ga0070686_1001362012 211
138 3300005545 Ga0070695_100000162 Ga0070695_10000016214 211
139 3300005546 Ga0070696_100001207 Ga0070696_1000012076 211
140 3300005546 Ga0070696_100001426 Ga0070696_10000142614 211
141 3300005546 Ga0070696_100002453 Ga0070696_10000245314 211
142 3300005546 Ga0070696_100006184 Ga0070696_1000061844 211
143 3300005546 Ga0070696_100155479 Ga0070696_1001554792 211
144 3300005547 Ga0070693_100000071 Ga0070693_10000007123 211
145 3300005549 Ga0070704_100001539 Ga0070704_1000015394 211
146 3300005549 Ga0070704_100210879 Ga0070704_1002108792 211
147 3300005563 Ga0068855_100004363 Ga0068855_1000043632 211
148 3300005563 Ga0068855_100120314 Ga0068855_1001203144 211
149 3300005563 Ga0068855_100260216 Ga0068855_1002602162 211
150 3300005578 Ga0068854_100004587 Ga0068854_1000045878 211
151 3300005614 Ga0068856_100006005 Ga0068856_10000600513 211
152 3300005614 Ga0068856_100231269 Ga0068856_1002312691 211
153 3300005615 Ga0070702_100000211 Ga0070702_1000002112 211
154 3300005616 Ga0068852_100404194 Ga0068852_1004041942 211
155 3300005616 Ga0068852_100636692 Ga0068852_1006366921 211
156 3300005617 Ga0068859_100001726 Ga0068859_10000172614 211
157 3300005617 Ga0068859_100131079 Ga0068859_1001310793 211
158 3300005617 Ga0068859_100955216 Ga0068859_1009552162 211
159 3300005719 Ga0068861_100138348 Ga0068861_1001383484 211
160 3300005840 Ga0068870_10002272 Ga0068870_100022725 211
161 3300005841 Ga0068863_100268894 Ga0068863_1002688941 211
162 3300005842 Ga0068858_100001499 Ga0068858_10000149913 211
163 3300005842 Ga0068858_100775325 Ga0068858_1007753252 211
164 3300005843 Ga0068860_100001892 Ga0068860_10000189214 211
165 3300005843 Ga0068860_100340829 Ga0068860_1003408292 211
166 3300005844 Ga0068862_100004151 Ga0068862_1000041514 211
167 3300005844 Ga0068862_100620310 Ga0068862_1006203101 211
168 3300006028 Ga0070717_10062554 Ga0070717_100625541 211
169 3300006195 Ga0075366_10158785 Ga0075366_101587852 211
170 3300006237 Ga0097621_100001372 Ga0097621_10000137213 211
171 3300006358 Ga0068871_100001218 Ga0068871_10000121813 211
172 3300006358 Ga0068871_100312456 Ga0068871_1003124561 211
173 3300006844 Ga0075428_100002539 Ga0075428_1000025398 211
174 3300006844 Ga0075428_100017442 Ga0075428_1000174425 211
175 3300006844 Ga0075428_100108989 Ga0075428_1001089894 211
176 3300006846 Ga0075430_100036869 Ga0075430_1000368694 211
177 3300006846 Ga0075430_100059571 Ga0075430_1000595713 211
178 3300006846 Ga0075430_100137138 Ga0075430_1001371382 211
179 3300006846 Ga0075430_100150465 Ga0075430_1001504653 211
180 3300006847 Ga0075431_100015650 Ga0075431_1000156507 211
181 3300006847 Ga0075431_100667690 Ga0075431_1006676902 211
182 3300006852 Ga0075433_10009944 Ga0075433_1000994410 211
183 3300006852 Ga0075433_10045538 Ga0075433_100455381 211
184 3300006852 Ga0075433_10231962 Ga0075433_102319621 211
185 3300006852 Ga0075433_10280195 Ga0075433_102801953 211
186 3300006852 Ga0075433_10886946 Ga0075433_108869461 211
187 3300006852 Ga0075433_10956674 Ga0075433_109566742 211
188 3300006871 Ga0075434_100025766 Ga0075434_1000257662 211
189 3300006871 Ga0075434_100336546 Ga0075434_1003365462 211
190 3300006880 Ga0075429_100005800 Ga0075429_1000058006 211
191 3300006881 Ga0068865_100000407 Ga0068865_10000040723 211
192 3300006914 Ga0075436_100009289 Ga0075436_1000092896 211
193 3300006914 Ga0075436_100173322 Ga0075436_1001733221 211
194 3300006931 Ga0097620_100001726 Ga0097620_10000172614 211
195 3300006931 Ga0097620_100131079 Ga0097620_1001310792 211
196 3300006931 Ga0097620_100955446 Ga0097620_1009554462 211
197 3300007076 Ga0075435_100008379 Ga0075435_1000083798 211
198 3300007076 Ga0075435_100153002 Ga0075435_1001530023 211
199 3300009093 Ga0105240_10537942 Ga0105240_105379422 211
200 3300009093 Ga0105240_10937698 Ga0105240_109376981 211
201 3300009094 Ga0111539_10013487 Ga0111539_100134878 211
202 3300009094 Ga0111539_10034696 Ga0111539_100346964 211
203 3300009098 Ga0105245_10003506 Ga0105245_1000350616 211
204 3300009098 Ga0105245_10010072 Ga0105245_100100728 211
205 3300009098 Ga0105245_10016870 Ga0105245_1001687012 211
206 3300009147 Ga0114129_10002308 Ga0114129_1000230826 211
207 3300009147 Ga0114129_10006698 Ga0114129_1000669812 211
208 3300009147 Ga0114129_10037806 Ga0114129_100378064 211
209 3300009147 Ga0114129_10223362 Ga0114129_102233621 211
210 3300009147 Ga0114129_10530866 Ga0114129_105308661 211
211 3300009147 Ga0114129_11600472 Ga0114129_116004721 211
212 3300009148 Ga0105243_10000583 Ga0105243_1000058326 211
213 3300009174 Ga0105241_10059707 Ga0105241_100597072 211
214 3300009176 Ga0105242_10003882 Ga0105242_1000388213 211
215 3300009177 Ga0105248_10012840 Ga0105248_100128408 211
216 3300009177 Ga0105248_10041798 Ga0105248_100417986 211
217 3300009177 Ga0105248_10539172 Ga0105248_105391722 211
218 3300009545 Ga0105237_10137006 Ga0105237_101370062 211
219 3300009553 Ga0105249_10195820 Ga0105249_101958202 211
220 3300009553 Ga0105249_10259769 Ga0105249_102597691 211
221 3300010375 Ga0105239_10614660 Ga0105239_106146602 211
222 3300010375 Ga0105239_10769853 Ga0105239_107698532 211
223 3300011119 Ga0105246_10029011 Ga0105246_100290114 211
224 3300013102 Ga0157371_10427135 Ga0157371_104271351 211
225 3300013104 Ga0157370_10086832 Ga0157370_100868323 211
226 3300013104 Ga0157370_10294498 Ga0157370_102944982 211
227 3300013105 Ga0157369_10469733 Ga0157369_104697332 211
228 3300013296 Ga0157374_10235234 Ga0157374_102352343 211
229 3300013297 Ga0157378_10002943 Ga0157378_100029437 211
230 3300013297 Ga0157378_10167866 Ga0157378_101678663 211
231 3300013297 Ga0157378_10999597 Ga0157378_109995972 211
232 3300013306 Ga0163162_10023911 Ga0163162_100239112 211
233 3300013308 Ga0157375_10075762 Ga0157375_100757622 211
234 3300014325 Ga0163163_10037746 Ga0163163_100377463 211
235 3300014325 Ga0163163_10134436 Ga0163163_101344362 211
236 3300014326 Ga0157380_10188852 Ga0157380_101888522 211
237 3300014326 Ga0157380_10255045 Ga0157380_102550453 211
238 3300014968 Ga0157379_10059470 Ga0157379_100594703 211
239 3300014968 Ga0157379_10143233 Ga0157379_101432332 211
240 3300014969 Ga0157376_10001972 Ga0157376_1000197212 211
241 3300014969 Ga0157376_10413954 Ga0157376_104139542 211
242 3300017792 Ga0163161_10504538 Ga0163161_105045382 211
243 3300025901 Ga0207688_10112226 Ga0207688_101122262 211
244 3300025908 Ga0207643_10007956 Ga0207643_100079563 211
245 3300025910 Ga0207684_10219127 Ga0207684_102191273 211
246 3300025911 Ga0207654_10291887 Ga0207654_102918872 211
247 3300025912 Ga0207707_10094747 Ga0207707_100947472 211
248 3300025913 Ga0207695_10367379 Ga0207695_103673792 211
249 3300025913 Ga0207695_10667298 Ga0207695_106672981 211
250 3300025915 Ga0207693_10483370 Ga0207693_104833702 211
251 3300025916 Ga0207663_10053592 Ga0207663_100535923 211
252 3300025917 Ga0207660_10002021 Ga0207660_1000202114 211
253 3300025917 Ga0207660_10123594 Ga0207660_101235942 211
254 3300025918 Ga0207662_10000050 Ga0207662_1000005016 211
255 3300025921 Ga0207652_10104896 Ga0207652_101048962 211
256 3300025921 Ga0207652_10249761 Ga0207652_102497611 211
257 3300025922 Ga0207646_10031789 Ga0207646_100317893 211
258 3300025923 Ga0207681_10510662 Ga0207681_105106621 211
259 3300025927 Ga0207687_10002282 Ga0207687_1000228211 211
260 3300025927 Ga0207687_10005719 Ga0207687_100057198 211
261 3300025928 Ga0207700_10084709 Ga0207700_100847091 211
262 3300025929 Ga0207664_10450903 Ga0207664_104509032 211
263 3300025931 Ga0207644_10718154 Ga0207644_107181541 211
264 3300025932 Ga0207690_10358947 Ga0207690_103589471 211
265 3300025935 Ga0207709_10001116 Ga0207709_1000111611 211
266 3300025936 Ga0207670_10005774 Ga0207670_100057743 211
267 3300025938 Ga0207704_10000431 Ga0207704_1000043114 211
268 3300025939 Ga0207665_10240954 Ga0207665_102409542 211
269 3300025941 Ga0207711_10026049 Ga0207711_100260494 211
270 3300025941 Ga0207711_10238400 Ga0207711_102384002 211
271 3300025942 Ga0207689_10002662 Ga0207689_1000266213 211
272 3300025942 Ga0207689_10321695 Ga0207689_103216952 211
273 3300025944 Ga0207661_10400799 Ga0207661_104007992 211
274 3300025949 Ga0207667_10106016 Ga0207667_101060161 211
275 3300025949 Ga0207667_10212501 Ga0207667_102125012 211
276 3300025949 Ga0207667_10672856 Ga0207667_106728562 211
277 3300025960 Ga0207651_10167719 Ga0207651_101677191 211
278 3300025961 Ga0207712_10002625 Ga0207712_100026252 211
279 3300025981 Ga0207640_10035267 Ga0207640_100352674 211
280 3300026035 Ga0207703_10600159 Ga0207703_106001592 211
281 3300026041 Ga0207639_10035656 Ga0207639_100356563 211
282 3300026041 Ga0207639_10205227 Ga0207639_102052272 211
283 3300026075 Ga0207708_10000375 Ga0207708_1000037515 211
284 3300026078 Ga0207702_10004664 Ga0207702_1000466413 211
285 3300026078 Ga0207702_10357172 Ga0207702_103571722 211
286 3300026078 Ga0207702_10423683 Ga0207702_104236832 211
287 3300026088 Ga0207641_10165657 Ga0207641_101656572 211
288 3300026088 Ga0207641_10746170 Ga0207641_107461701 211
289 3300026089 Ga0207648_10000663 Ga0207648_1000066328 211
290 3300026118 Ga0207675_100000454 Ga0207675_10000045423 211
291 3300026118 Ga0207675_101150102 Ga0207675_1011501021 211
292 3300027907 Ga0207428_10003019 Ga0207428_100030192 211
293 3300027907 Ga0207428_10011324 Ga0207428_100113243 211
294 3300027907 Ga0207428_10120703 Ga0207428_101207031 211
295 3300028380 Ga0268265_10001189 Ga0268265_100011897 211
296 3300028381 Ga0268264_10002258 Ga0268264_100022587 211
297 3300028556 Ga0265337_1056358 Ga0265337_10563581 211
298 3300028573 Ga0265334_10040985 Ga0265334_100409852 211
299 3300028573 Ga0265334_10077648 Ga0265334_100776481 211
300 3300028653 Ga0265323_10014730 Ga0265323_100147303 211
301 3300028654 Ga0265322_10072800 Ga0265322_100728001 211
302 3300028666 Ga0265336_10001353 Ga0265336_100013539 211
303 3300028666 Ga0265336_10018355 Ga0265336_100183553 211
304 3300028800 Ga0265338_10024630 Ga0265338_100246303 211
305 3300028800 Ga0265338_10058799 Ga0265338_100587992 211
306 3300028800 Ga0265338_10078097 Ga0265338_100780973 211
307 3300028800 Ga0265338_10391399 Ga0265338_103913992 211
308 3300029957 Ga0265324_10000006 Ga0265324_100000069 211
309 3300029957 Ga0265324_10001274 Ga0265324_1000127411 211
310 3300031235 Ga0265330_10187845 Ga0265330_101878452 211
311 3300031239 Ga0265328_10005997 Ga0265328_100059972 211
312 3300031241 Ga0265325_10000767 Ga0265325_1000076710 211
313 3300031247 Ga0265340_10122090 Ga0265340_101220901 211
314 3300031250 Ga0265331_10026866 Ga0265331_100268663 211
315 3300031344 Ga0265316_10054216 Ga0265316_100542163 211
316 3300031507 Ga0307509_10403004 Ga0307509_104030042 211
317 3300031711 Ga0265314_10004530 Ga0265314_100045308 211
318 3300031711 Ga0265314_10197385 Ga0265314_101973852 211
319 3300031711 Ga0265314_10264023 Ga0265314_102640232 211
320 3300031712 Ga0265342_10005610 Ga0265342_100056105 211
321 3300031712 Ga0265342_10009909 Ga0265342_100099096 211
322 3300034816 Ga0373930_0001188 Ga0373930_0001188_367_1005 211
323 3300034816 Ga0373930_0028237 Ga0373930_0028237_411_1052 211
324 3300034957 Ga0373938_0003154 Ga0373938_0003154_1014_1652 211
325 3300035086 Ga0373934_0007838 Ga0373934_0007838_2012_2647 211
326 3300035089 Ga0373944_0015791 Ga0373944_0015791_1456_2100 211
327 3300035112 Ga0373932_0026808 Ga0373932_0026808_255_896 211
328 3300035120 Ga0373957_0027242 Ga0373957_0027242_756_1403 211
329 3300035121 Ga0373960_0032661 Ga0373960_0032661_44_685 211
330 3300035172 Ga0373955_0014946 Ga0373955_0014946_1228_1875 211
331 3300035172 Ga0373955_0175439 Ga0373955_0175439_385_1023 211
332 3300035410 Ga0373924_0020673 Ga0373924_0020673_796_1443 211
333 3300035691 Ga0373931_0001986 Ga0373931_0001986_6399_7037 211
334 3300035691 Ga0373931_0004207 Ga0373931_0004207_203_844 211
335 3300035692 Ga0373935_0236273 Ga0373935_0236273_542_1180 211
336 3300035695 Ga0373927_0045469 Ga0373927_0045469_939_1586 211
337 3300035724 Ga0373933_0000974 Ga0373933_0000974_3911_4558 211
338 3300035724 Ga0373933_0052806 Ga0373933_0052806_1404_2042 211
339 3300035724 Ga0373933_0137047 Ga0373933_0137047_111_749 211
340 3300035724 Ga0373933_0212153 Ga0373933_0212153_575_1216 211
341 3300036401 Ga0373937_0000924 Ga0373937_0000924_6181_6828 211
342 3300036401 Ga0373937_0005804 Ga0373937_0005804_2426_3064 211
343 3300036401 Ga0373937_0041786 Ga0373937_0041786_3072_3713 211
344 3300036401 Ga0373937_0598309 Ga0373937_0598309_86_727 211
345 3300037853 Ga0436364_1089434 Ga0436364_1089434_327_1022 211
346 3300039453 Ga0436362_0187221 Ga0436362_0187221_21_689 211
347 3300042876 Ga0451577_0341339 Ga0451577_0341339_299_937 211
348 3300044673 Ga0453683_0012579 Ga0453683_0012579_783_1472 211
349 3300044673 Ga0453683_0111262 Ga0453683_0111262_115_756 211
350 3300045051 Ga0451576_0001630 Ga0451576_0001630_30805_31491 211
351 3300045051 Ga0451576_0006369 Ga0451576_0006369_8499_9137 211
352 3300045051 Ga0451576_0116154 Ga0451576_0116154_1429_2070 211
353 3300045051 Ga0451576_0222538 Ga0451576_0222538_146_784 211
354 3300045051 Ga0451576_0450212 Ga0451576_0450212_195_836 211
355 3300045051 Ga0451576_0932945 Ga0451576_0932945_106_795 211
356 3300045051 Ga0451576_1040521 Ga0451576_1040521_19_657 211
357 3300046454 Ga0495592_0039769 Ga0495592_0039769_236_883 211
358 3300046459 Ga0495629_0002047 Ga0495629_0002047_2774_3421 211
359 3300046462 Ga0495651_0000214 Ga0495651_0000214_16131_16778 211
360 3300046463 Ga0495653_0001647 Ga0495653_0001647_3607_4254 211
361 3300046472 Ga0495580_0347653 Ga0495580_0347653_217_855 211
362 3300046476 Ga0495662_0038562 Ga0495662_0038562_351_998 211
363 3300046476 Ga0495662_0053605 Ga0495662_0053605_189_827 211
364 3300046477 Ga0495664_0006909 Ga0495664_0006909_57_704 211
365 3300046477 Ga0495664_0011809 Ga0495664_0011809_3354_3992 211
366 3300046499 Ga0495594_0015299 Ga0495594_0015299_2793_3431 211
367 3300046499 Ga0495594_0376614 Ga0495594_0376614_74_721 211
368 3300046511 Ga0495608_0009530 Ga0495608_0009530_1919_2566 211
369 3300046514 Ga0495618_0000537 Ga0495618_0000537_15910_16557 211
370 3300046514 Ga0495618_0009614 Ga0495618_0009614_1602_2240 211
371 3300046516 Ga0495628_0030182 Ga0495628_0030182_2627_3274 211
372 3300046517 Ga0495630_0063234 Ga0495630_0063234_1297_1944 211
373 3300046517 Ga0495630_0475063 Ga0495630_0475063_280_918 211
374 3300046529 Ga0495652_0002479 Ga0495652_0002479_2917_3564 211
375 3300046533 Ga0495640_0007570 Ga0495640_0007570_1065_1712 211
376 3300046533 Ga0495640_0169488 Ga0495640_0169488_227_865 211
377 3300046536 Ga0495587_0000715 Ga0495587_0000715_10320_10967 211
378 3300046543 Ga0495645_0008358 Ga0495645_0008358_3165_3812 211
379 3300046559 Ga0495667_0047639 Ga0495667_0047639_1935_2582 211
380 3300046642 Ga0495634_0003492 Ga0495634_0003492_9701_10348 211
381 3300046642 Ga0495634_0089664 Ga0495634_0089664_212_850 211
382 3300046642 Ga0495634_0271576 Ga0495634_0271576_125_763 211
383 3300046663 Ga0495635_0000562 Ga0495635_0000562_379_1026 211
384 3300046675 Ga0495657_0109018 Ga0495657_0109018_93_731 211
385 3300046678 Ga0495599_0008513 Ga0495599_0008513_1156_1803 211
386 3300046679 Ga0495623_0001280 Ga0495623_0001280_3013_3660 211
387 3300046679 Ga0495623_0064891 Ga0495623_0064891_37_675 211
388 3300046680 Ga0495646_0002811 Ga0495646_0002811_1387_2034 211
389 3300046681 Ga0495647_0005582 Ga0495647_0005582_3209_3847 211
390 3300046683 Ga0495658_0013385 Ga0495658_0013385_676_1314 211
391 3300046683 Ga0495658_0016587 Ga0495658_0016587_2155_2802 211
392 3300046689 Ga0495613_0049700 Ga0495613_0049700_1132_1779 211
393 3300046690 Ga0495624_0210442 Ga0495624_0210442_428_1066 211
394 3300046690 Ga0495624_0243983 Ga0495624_0243983_139_777 211
395 3300046809 Ga0495600_0013786 Ga0495600_0013786_2878_3525 211
396 3300046809 Ga0495600_0383198 Ga0495600_0383198_174_815 211
397 3300047315 Ga0495581_0089301 Ga0495581_0089301_1089_1736 211
398 3300047315 Ga0495581_0178096 Ga0495581_0178096_220_858 211
399 3300047317 Ga0495604_0000382 Ga0495604_0000382_27451_28098 211
400 3300047319 Ga0495674_0003824 Ga0495674_0003824_11926_12573 211
401 3300047319 Ga0495674_0100098 Ga0495674_0100098_1647_2285 211
402 3300047322 Ga0495680_0001240 Ga0495680_0001240_23326_23973 211
403 3300047444 Ga0495675_0001812 Ga0495675_0001812_9850_10497 211
404 3300047673 Ga0495593_0057173 Ga0495593_0057173_529_1176 211
405 3300048088 Ga0495602_0001751 Ga0495602_0001751_17996_18643 211
406 3300048088 Ga0495602_0321645 Ga0495602_0321645_141_782 211
407 3300048903 Ga0496100_0456019 Ga0496100_0456019_248_895 211
408 3300048909 Ga0496106_0735135 Ga0496106_0735135_46_693 211
409 3300048910 Ga0496107_0288316 Ga0496107_0288316_509_1204 211
410 3300048911 Ga0496108_0416085 Ga0496108_0416085_193_840 211
411 3300048912 Ga0496109_0136610 Ga0496109_0136610_1042_1737 211
412 3300048912 Ga0496109_0877514 Ga0496109_0877514_107_751 211
413 3300048917 Ga0496114_0035068 Ga0496114_0035068_391_1041 211
414 3300048918 Ga0496115_0208839 Ga0496115_0208839_192_839 211
415 3300049570 Ga0501033_0005965 Ga0501033_0005965_7483_8124 211
416 3300049570 Ga0501033_0037825 Ga0501033_0037825_1260_1901 211
417 3300049571 Ga0501034_0495994 Ga0501034_0495994_401_1048 211
418 3300049572 Ga0501036_0002300 Ga0501036_0002300_10044_10685 211
419 3300049573 Ga0501037_0011409 Ga0501037_0011409_523_1170 211
420 3300049573 Ga0501037_0179566 Ga0501037_0179566_737_1378 211
421 3300049574 Ga0501038_0016769 Ga0501038_0016769_1360_2001 211
422 3300049575 Ga0501039_0009384 Ga0501039_0009384_845_1486 211
423 3300049575 Ga0501039_0753363 Ga0501039_0753363_20_670 211
424 3300049576 Ga0501040_0009441 Ga0501040_0009441_5091_5732 211
425 3300049577 Ga0501041_0001494 Ga0501041_0001494_502_1143 211
426 3300049578 Ga0501042_0001293 Ga0501042_0001293_8955_9596 211
427 3300049579 Ga0501043_0013889 Ga0501043_0013889_4991_5632 211
428 3300049580 Ga0501046_0005727 Ga0501046_0005727_4433_5074 211
429 3300049581 Ga0501047_0006762 Ga0501047_0006762_4598_5245 211
430 3300049582 Ga0501048_0055615 Ga0501048_0055615_965_1606 211
431 3300049584 Ga0501068_0053576 Ga0501068_0053576_388_1029 211
432 3300049585 Ga0501069_0041718 Ga0501069_0041718_1386_2033 211
433 3300049586 Ga0501070_0012341 Ga0501070_0012341_5595_6242 211
434 3300049587 Ga0501071_0007128 Ga0501071_0007128_2551_3198 211
435 3300049587 Ga0501071_0031340 Ga0501071_0031340_2152_2793 211
436 3300049587 Ga0501071_0344349 Ga0501071_0344349_415_1053 211
437 3300049588 Ga0501072_0001780 Ga0501072_0001780_4215_4856 211
438 3300049588 Ga0501072_0261055 Ga0501072_0261055_612_1262 211
439 3300049589 Ga0501073_0028416 Ga0501073_0028416_647_1294 211
440 3300049590 Ga0501074_0006854 Ga0501074_0006854_7160_7807 211
441 3300049590 Ga0501074_0023638 Ga0501074_0023638_3423_4064 211
442 3300049591 Ga0501075_0039172 Ga0501075_0039172_1233_1874 211
443 3300049592 Ga0501076_0001146 Ga0501076_0001146_11762_12403 211
444 3300049592 Ga0501076_0297000 Ga0501076_0297000_222_869 211
445 3300049593 Ga0501077_0003582 Ga0501077_0003582_4964_5605 211
446 3300049741 Ga0501079_0002542 Ga0501079_0002542_10227_10868 211
447 3300049741 Ga0501079_0441980 Ga0501079_0441980_219_863 211
448 3300049742 Ga0501080_0236289 Ga0501080_0236289_742_1389 211
449 3300049743 Ga0501081_0000579 Ga0501081_0000579_11359_12000 211
450 3300049822 Ga0501035_0081117 Ga0501035_0081117_608_1255 211
451 3300049822 Ga0501035_0082106 Ga0501035_0082106_664_1305 211
452 3300049823 Ga0501044_0015384 Ga0501044_0015384_5090_5737 211
453 3300050493 nmdc:mga0k408_108228_c1 nmdc:mga0k408_108228_c1_408_1052 211
454 3300050507 nmdc:mga05p37_1129375_c1 nmdc:mga05p37_1129375_c1_81_746 211
455 3300050507 nmdc:mga05p37_138229_c1 nmdc:mga05p37_138229_c1_1076_1714 211
456 3300050507 nmdc:mga05p37_1657_c2 nmdc:mga05p37_1657_c2_8327_8971 211
457 3300050507 nmdc:mga05p37_3701_c1 nmdc:mga05p37_3701_c1_1296_1934 211
458 3300050507 nmdc:mga05p37_450319_c1 nmdc:mga05p37_450319_c1_531_1169 211
459 3300050507 nmdc:mga05p37_912149_c1 nmdc:mga05p37_912149_c1_199_840 211
460 3300050508 nmdc:mga09592_199016_c1 nmdc:mga09592_199016_c1_1060_1701 211
461 3300050508 nmdc:mga09592_2089_c1 nmdc:mga09592_2089_c1_5722_6360 211
462 3300050509 nmdc:mga0qj67_164083_c1 nmdc:mga0qj67_164083_c1_801_1439 211
463 3300050509 nmdc:mga0qj67_51159_c1 nmdc:mga0qj67_51159_c1_954_1592 211
464 3300050510 nmdc:mga06r32_254234_c1 nmdc:mga06r32_254234_c1_212_850 211
465 3300050510 nmdc:mga06r32_27446_c1 nmdc:mga06r32_27446_c1_1801_2445 211
466 3300050510 nmdc:mga06r32_840285_c1 nmdc:mga06r32_840285_c1_70_714 211
467 3300050511 nmdc:mga08y16_235687_c1 nmdc:mga08y16_235687_c1_1028_1666 211
468 3300050511 nmdc:mga08y16_59357_c1 nmdc:mga08y16_59357_c1_25_666 211
469 3300050512 nmdc:mga0n895_205287_c1 nmdc:mga0n895_205287_c1_24_662 211
470 3300050512 nmdc:mga0n895_43173_c2 nmdc:mga0n895_43173_c2_538_1176 211
471 3300050512 nmdc:mga0n895_93081_c1 nmdc:mga0n895_93081_c1_2172_2816 211
472 3300050513 nmdc:mga0rr50_231521_c1 nmdc:mga0rr50_231521_c1_192_830 211
473 3300050513 nmdc:mga0rr50_82541_c1 nmdc:mga0rr50_82541_c1_1623_2267 211
474 3300050514 nmdc:mga08x19_2511_c1 nmdc:mga08x19_2511_c1_8019_8663 211
475 3300050515 nmdc:mga0a205_239550_c1 nmdc:mga0a205_239550_c1_965_1606 211
476 3300050515 nmdc:mga0a205_24210_c1 nmdc:mga0a205_24210_c1_1974_2615 211
477 3300050515 nmdc:mga0a205_29218_c1 nmdc:mga0a205_29218_c1_1850_2494 211
478 3300050515 nmdc:mga0a205_413836_c1 nmdc:mga0a205_413836_c1_126_764 211
479 3300050515 nmdc:mga0a205_760677_c1 nmdc:mga0a205_760677_c1_14_658 211
480 3300050515 nmdc:mga0a205_98374_c1 nmdc:mga0a205_98374_c1_1716_2354 211
481 3300053077 Ga0495601_0026105 Ga0495601_0026105_2174_2812 211
482 3300053078 Ga0495612_0001450 Ga0495612_0001450_2826_3473 211
483 3300053084 Ga0495595_0003038 Ga0495595_0003038_4134_4781 211
484 3300053084 Ga0495595_0255860 Ga0495595_0255860_120_758 211
485 3300053085 Ga0495619_0003346 Ga0495619_0003346_6572_7219 211
486 3300053733 Ga0500552_030087 Ga0500552_030087_164_811 211
487 3300054114 Ga0501084_0015970 Ga0501084_0015970_4278_4919 211
488 3300054114 Ga0501084_0218208 Ga0501084_0218208_66_710 211
489 3300059421 Ga0590071_000266 Ga0590071_000266_11134_11784 211
490 3300059423 Ga0590074_000639 Ga0590074_000639_356_1006 211
491 3300059424 Ga0590075_000189 Ga0590075_000189_3350_4000 211
492 3300059426 Ga0590077_000037 Ga0590077_000037_19026_19676 211
493 3300060353 Ga0501082_0018016 Ga0501082_0018016_1313_1954 211
494 3300061734 Ga0530510_0016366 Ga0530510_0016366_1642_2283 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

18

109

0.96

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

18

113

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ici-assembly1.cif.gz_A crystal structure of human mical3 0.9896 2 31
4j36-assembly2.cif.gz_B cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) 0.9855 2 28
4j33-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase (kmo-394) 0.9852 2 30
3ka7-assembly1.cif.gz_A crystal structure of an oxidoreductase from methanosarcina mazei. northeast structural genomics consortium target id mar208 0.9833 1 31
5x6r-assembly1.cif.gz_A crystal structure of saccharomyces cerevisiae kmo in complex with ro 61-8048 0.9775 2 30
ID Description Score Start End Superfamily
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9855 2 28 3.50.50.60
af_A4HWA7_1_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9779 2 30 3.50.50.60
4k7zA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.972 2 32 3.50.50.60
af_O15229_1_369_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9695 2 30 3.50.50.60
3i3lA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.968 2 32 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2N1T0K2-F1-model_v4 deleted 0.9914 1 211
AF-A0A1G3IN80-F1-model_v4 DNA-binding protein 0.9898 1 189 GO:0003677
AF-A0A2P1QY54-F1-model_v4 NADP oxidoreductase coenzyme F420-dependent 0.9879 2 211
AF-A0A2N1T0K2-F1-model_v4 deleted 0.9867 1 211
AF-M6X3P1-F1-model_v4 deleted 0.9838 44 211

Feature Viewer

pLDDT pTM Quality
96.11 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map