F454604
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 494 | 290 | 494 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_1089434|Ga0436364_1089434_327_1022 |
| Length | 231 |
| Sequence | MARWLEAAHAQSGEDDMKVGILGSGDVAKALAAGFVKHGHQVTLGTRDTGKLKDFLAQHQGAQAASFAEAAKFGEVVVLAVKGNVAHDALKATGAANLSGKPVIDATNPIADAPPTNGVLKFFTYLDQSLMEQLQSAFPDAHFVKAYNSVGNARMINPEFPGGAKPTMFICGNDDKAKAVVRGINDQFGWETADMGKAEAARAIEPLCMLWCILGFTKNEWTHAFKLLHQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 136 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 140 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 141 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 142 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 143 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 148 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 150 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 151 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 153 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 154 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 158 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 159 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 160 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 168 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 175 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 181 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 182 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 183 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 184 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 185 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 186 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 187 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 188 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 189 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 234 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 237 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 238 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 269 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 283 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 284 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 286 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 287 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 288 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 289 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0.2 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.81 |
| Nodule | 0 |
| Rhizoplane | 1.82 |
| Rhizosphere | 96.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1001163 | 3300002705 | Bacteria | 11713 |
| 2 | rootH1_10012424 | 3300003316 | Bacteria | 16855 |
| 3 | Ga0058863_11092087 | 3300004799 | Unclassified | 1015 |
| 4 | Ga0065712_10348092 | 3300005290 | Unclassified | 791 |
| 5 | Ga0065707_10103056 | 3300005295 | Bacteria | 2770 |
| 6 | Ga0070658_10094802 | 3300005327 | Bacteria | 2463 |
| 7 | Ga0070683_100032985 | 3300005329 | Bacteria | 4719 |
| 8 | Ga0070683_100240705 | 3300005329 | Bacteria | 1721 |
| 9 | Ga0070690_100000575 | 3300005330 | Bacteria | 18554 |
| 10 | Ga0070690_100163015 | 3300005330 | Bacteria | 1529 |
| 11 | Ga0070690_100233176 | 3300005330 | Bacteria | 1295 |
| 12 | Ga0070670_101054593 | 3300005331 | Unclassified | 740 |
| 13 | Ga0068869_100001102 | 3300005334 | Bacteria | 15741 |
| 14 | Ga0068869_100208441 | 3300005334 | Bacteria | 1544 |
| 15 | Ga0070666_10198773 | 3300005335 | Bacteria | 1410 |
| 16 | Ga0070666_10465528 | 3300005335 | Bacteria | 914 |
| 17 | Ga0070680_100024246 | 3300005336 | Bacteria | 4843 |
| 18 | Ga0070680_100492952 | 3300005336 | Unclassified | 1048 |
| 19 | Ga0070682_100005071 | 3300005337 | Bacteria | 7320 |
| 20 | Ga0068868_100021926 | 3300005338 | Bacteria | 4815 |
| 21 | Ga0068868_100531993 | 3300005338 | Bacteria | 1033 |
| 22 | Ga0068868_100551003 | 3300005338 | Bacteria | 1016 |
| 23 | Ga0070689_100000814 | 3300005340 | Bacteria | 19254 |
| 24 | Ga0070689_100779427 | 3300005340 | Bacteria | 840 |
| 25 | Ga0070687_100000171 | 3300005343 | Bacteria | 22395 |
| 26 | Ga0070692_10002591 | 3300005345 | Bacteria | 7050 |
| 27 | Ga0070692_10138073 | 3300005345 | Bacteria | 1377 |
| 28 | Ga0070669_100072368 | 3300005353 | Bacteria | 2552 |
| 29 | Ga0070675_101142694 | 3300005354 | Bacteria | 716 |
| 30 | Ga0070671_100431679 | 3300005355 | Bacteria | 1129 |
| 31 | Ga0070673_100141774 | 3300005364 | Bacteria | 2028 |
| 32 | Ga0070673_100727504 | 3300005364 | Bacteria | 913 |
| 33 | Ga0070688_100666436 | 3300005365 | Bacteria | 803 |
| 34 | Ga0070659_100426577 | 3300005366 | Bacteria | 1122 |
| 35 | Ga0070703_10015642 | 3300005406 | Bacteria | 2173 |
| 36 | Ga0070703_10020760 | 3300005406 | Bacteria | 1914 |
| 37 | Ga0070703_10133650 | 3300005406 | Bacteria | 914 |
| 38 | Ga0070713_100076875 | 3300005436 | Bacteria | 2837 |
| 39 | Ga0070713_100532687 | 3300005436 | Bacteria | 1111 |
| 40 | Ga0070713_101150198 | 3300005436 | Unclassified | 751 |
| 41 | Ga0070701_10000376 | 3300005438 | Bacteria | 14969 |
| 42 | Ga0070701_10455238 | 3300005438 | Bacteria | 822 |
| 43 | Ga0070711_100107323 | 3300005439 | Unclassified | 2043 |
| 44 | Ga0070705_100000270 | 3300005440 | Bacteria | 31405 |
| 45 | Ga0070700_100002521 | 3300005441 | Bacteria | 9338 |
| 46 | Ga0070694_100000941 | 3300005444 | Bacteria | 16440 |
| 47 | Ga0070694_100849625 | 3300005444 | Bacteria | 751 |
| 48 | Ga0070708_100204035 | 3300005445 | Bacteria | 1852 |
| 49 | Ga0070662_100033739 | 3300005457 | Unclassified | 3606 |
| 50 | Ga0070681_10046516 | 3300005458 | Bacteria | 4338 |
| 51 | Ga0070681_10049411 | 3300005458 | Bacteria | 4200 |
| 52 | Ga0070681_10721441 | 3300005458 | Bacteria | 913 |
| 53 | Ga0068867_100000947 | 3300005459 | Bacteria | 19763 |
| 54 | Ga0070707_100039874 | 3300005468 | Bacteria | 4491 |
| 55 | Ga0070698_100156887 | 3300005471 | Bacteria | 2222 |
| 56 | Ga0070699_100006690 | 3300005518 | Bacteria | 10026 |
| 57 | Ga0070699_100192247 | 3300005518 | Unclassified | 1813 |
| 58 | Ga0070679_100004354 | 3300005530 | Bacteria | 13078 |
| 59 | Ga0070679_100263424 | 3300005530 | Bacteria | 1679 |
| 60 | Ga0070684_100267973 | 3300005535 | Bacteria | 1563 |
| 61 | Ga0070697_100117970 | 3300005536 | Bacteria | 2217 |
| 62 | Ga0070697_100126144 | 3300005536 | Unclassified | 2144 |
| 63 | Ga0068853_100081521 | 3300005539 | Bacteria | 2833 |
| 64 | Ga0068853_101070345 | 3300005539 | Unclassified | 777 |
| 65 | Ga0070686_100000516 | 3300005544 | Bacteria | 23132 |
| 66 | Ga0070686_100136201 | 3300005544 | Bacteria | 1704 |
| 67 | Ga0070695_100000162 | 3300005545 | Bacteria | 31870 |
| 68 | Ga0070696_100001207 | 3300005546 | Bacteria | 16779 |
| 69 | Ga0070696_100001426 | 3300005546 | Bacteria | 15634 |
| 70 | Ga0070696_100002453 | 3300005546 | Bacteria | 12299 |
| 71 | Ga0070696_100006184 | 3300005546 | Bacteria | 8003 |
| 72 | Ga0070696_100155479 | 3300005546 | Bacteria | 1682 |
| 73 | Ga0070693_100000071 | 3300005547 | Bacteria | 42071 |
| 74 | Ga0070704_100001539 | 3300005549 | Bacteria | 12433 |
| 75 | Ga0070704_100210879 | 3300005549 | Bacteria | 1574 |
| 76 | Ga0068855_100004363 | 3300005563 | Bacteria | 17292 |
| 77 | Ga0068855_100120314 | 3300005563 | Unclassified | 3005 |
| 78 | Ga0068855_100260216 | 3300005563 | Unclassified | 1933 |
| 79 | Ga0068854_100004587 | 3300005578 | Bacteria | 8712 |
| 80 | Ga0068856_100006005 | 3300005614 | Bacteria | 11948 |
| 81 | Ga0068856_100231269 | 3300005614 | Bacteria | 1864 |
| 82 | Ga0070702_100000211 | 3300005615 | Bacteria | 19353 |
| 83 | Ga0068852_100404194 | 3300005616 | Bacteria | 1344 |
| 84 | Ga0068852_100636692 | 3300005616 | Bacteria | 1073 |
| 85 | Ga0068859_100001726 | 3300005617 | Bacteria | 22275 |
| 86 | Ga0068859_100131079 | 3300005617 | Bacteria | 2579 |
| 87 | Ga0068859_100955216 | 3300005617 | Unclassified | 940 |
| 88 | Ga0068861_100138348 | 3300005719 | Bacteria | 1984 |
| 89 | Ga0068870_10002272 | 3300005840 | Bacteria | 7980 |
| 90 | Ga0068863_100268894 | 3300005841 | Unclassified | 1650 |
| 91 | Ga0068858_100001499 | 3300005842 | Bacteria | 24066 |
| 92 | Ga0068858_100775325 | 3300005842 | Bacteria | 935 |
| 93 | Ga0068860_100001892 | 3300005843 | Bacteria | 22244 |
| 94 | Ga0068860_100340829 | 3300005843 | Unclassified | 1474 |
| 95 | Ga0068862_100004151 | 3300005844 | Bacteria | 12275 |
| 96 | Ga0068862_100620310 | 3300005844 | Unclassified | 1040 |
| 97 | Ga0070717_10062554 | 3300006028 | Bacteria | 3087 |
| 98 | Ga0075366_10158785 | 3300006195 | Bacteria | 1370 |
| 99 | Ga0097621_100001372 | 3300006237 | Bacteria | 16751 |
| 100 | Ga0068871_100001218 | 3300006358 | Bacteria | 17166 |
| 101 | Ga0068871_100312456 | 3300006358 | Bacteria | 1382 |
| 102 | Ga0075428_100002539 | 3300006844 | Bacteria | 19847 |
| 103 | Ga0075428_100017442 | 3300006844 | Bacteria | 7936 |
| 104 | Ga0075428_100108989 | 3300006844 | Unclassified | 3018 |
| 105 | Ga0075430_100036869 | 3300006846 | Bacteria | 4144 |
| 106 | Ga0075430_100059571 | 3300006846 | Bacteria | 3210 |
| 107 | Ga0075430_100137138 | 3300006846 | Bacteria | 2038 |
| 108 | Ga0075430_100150465 | 3300006846 | Bacteria | 1938 |
| 109 | Ga0075431_100015650 | 3300006847 | Bacteria | 7689 |
| 110 | Ga0075431_100667690 | 3300006847 | Bacteria | 1019 |
| 111 | Ga0075433_10009944 | 3300006852 | Bacteria | 7621 |
| 112 | Ga0075433_10045538 | 3300006852 | Bacteria | 3814 |
| 113 | Ga0075433_10231962 | 3300006852 | Unclassified | 1639 |
| 114 | Ga0075433_10280195 | 3300006852 | Unclassified | 1477 |
| 115 | Ga0075433_10886946 | 3300006852 | Unclassified | 778 |
| 116 | Ga0075433_10956674 | 3300006852 | Unclassified | 746 |
| 117 | Ga0075434_100001831 | 3300006871 | Bacteria | 18346 |
| 118 | Ga0075434_100025766 | 3300006871 | Bacteria | 5757 |
| 119 | Ga0075434_100336546 | 3300006871 | Bacteria | 1530 |
| 120 | Ga0075434_100495130 | 3300006871 | Unclassified | 1243 |
| 121 | Ga0075429_100005800 | 3300006880 | Bacteria | 10655 |
| 122 | Ga0068865_100000407 | 3300006881 | Bacteria | 23897 |
| 123 | Ga0075436_100009289 | 3300006914 | Bacteria | 6728 |
| 124 | Ga0075436_100173322 | 3300006914 | Bacteria | 1523 |
| 125 | Ga0097620_100001726 | 3300006931 | Bacteria | 22275 |
| 126 | Ga0097620_100131079 | 3300006931 | Bacteria | 2579 |
| 127 | Ga0097620_100955446 | 3300006931 | Unclassified | 940 |
| 128 | Ga0075435_100008379 | 3300007076 | Bacteria | 7414 |
| 129 | Ga0075435_100153002 | 3300007076 | Bacteria | 1940 |
| 130 | Ga0105240_10103152 | 3300009093 | Bacteria | 3466 |
| 131 | Ga0105240_10508208 | 3300009093 | Unclassified | 1339 |
| 132 | Ga0105240_10537942 | 3300009093 | Unclassified | 1294 |
| 133 | Ga0105240_10937698 | 3300009093 | Bacteria | 929 |
| 134 | Ga0111539_10013487 | 3300009094 | Bacteria | 10213 |
| 135 | Ga0111539_10034696 | 3300009094 | Bacteria | 6113 |
| 136 | Ga0111539_10386804 | 3300009094 | Bacteria | 1629 |
| 137 | Ga0105245_10003506 | 3300009098 | Bacteria | 14041 |
| 138 | Ga0105245_10010072 | 3300009098 | Bacteria | 8236 |
| 139 | Ga0105245_10016870 | 3300009098 | Bacteria | 6375 |
| 140 | Ga0114129_10002308 | 3300009147 | Bacteria | 26441 |
| 141 | Ga0114129_10006698 | 3300009147 | Bacteria | 16362 |
| 142 | Ga0114129_10037806 | 3300009147 | Bacteria | 6813 |
| 143 | Ga0114129_10223362 | 3300009147 | Unclassified | 2540 |
| 144 | Ga0114129_10530866 | 3300009147 | Bacteria | 1533 |
| 145 | Ga0114129_11600472 | 3300009147 | Bacteria | 798 |
| 146 | Ga0105243_10000583 | 3300009148 | Bacteria | 36624 |
| 147 | Ga0105241_10059707 | 3300009174 | Unclassified | 2933 |
| 148 | Ga0105242_10003882 | 3300009176 | Bacteria | 11615 |
| 149 | Ga0105248_10012840 | 3300009177 | Bacteria | 9239 |
| 150 | Ga0105248_10041798 | 3300009177 | Bacteria | 5141 |
| 151 | Ga0105248_10539172 | 3300009177 | Bacteria | 1316 |
| 152 | Ga0105237_10137006 | 3300009545 | Bacteria | 2442 |
| 153 | Ga0105249_10195820 | 3300009553 | Bacteria | 1975 |
| 154 | Ga0105249_10259769 | 3300009553 | Bacteria | 1725 |
| 155 | Ga0105239_10614660 | 3300010375 | Unclassified | 1240 |
| 156 | Ga0105239_10769853 | 3300010375 | Bacteria | 1102 |
| 157 | Ga0105246_10029011 | 3300011119 | Bacteria | 3639 |
| 158 | Ga0157371_10427135 | 3300013102 | Bacteria | 972 |
| 159 | Ga0157370_10086832 | 3300013104 | Bacteria | 2938 |
| 160 | Ga0157370_10294498 | 3300013104 | Bacteria | 1499 |
| 161 | Ga0157369_10469733 | 3300013105 | Bacteria | 1302 |
| 162 | Ga0157374_10235234 | 3300013296 | Bacteria | 1800 |
| 163 | Ga0157378_10002943 | 3300013297 | Bacteria | 15146 |
| 164 | Ga0157378_10149320 | 3300013297 | Unclassified | 2177 |
| 165 | Ga0157378_10167866 | 3300013297 | Unclassified | 2057 |
| 166 | Ga0157378_10999597 | 3300013297 | Unclassified | 871 |
| 167 | Ga0163162_10023911 | 3300013306 | Bacteria | 6029 |
| 168 | Ga0157375_10075762 | 3300013308 | Bacteria | 3389 |
| 169 | Ga0163163_10037746 | 3300014325 | Unclassified | 4701 |
| 170 | Ga0163163_10059219 | 3300014325 | Bacteria | 3787 |
| 171 | Ga0163163_10134436 | 3300014325 | Bacteria | 2513 |
| 172 | Ga0157380_10188852 | 3300014326 | Bacteria | 1817 |
| 173 | Ga0157380_10255045 | 3300014326 | Bacteria | 1590 |
| 174 | Ga0157379_10059470 | 3300014968 | Bacteria | 3417 |
| 175 | Ga0157379_10143233 | 3300014968 | Bacteria | 2155 |
| 176 | Ga0157376_10001972 | 3300014969 | Bacteria | 13728 |
| 177 | Ga0157376_10413954 | 3300014969 | Bacteria | 1306 |
| 178 | Ga0163161_10504538 | 3300017792 | Bacteria | 986 |
| 179 | Ga0207688_10112226 | 3300025901 | Bacteria | 1584 |
| 180 | Ga0207643_10007956 | 3300025908 | Bacteria | 5689 |
| 181 | Ga0207684_10219127 | 3300025910 | Bacteria | 1642 |
| 182 | Ga0207654_10291887 | 3300025911 | Bacteria | 1106 |
| 183 | Ga0207707_10094747 | 3300025912 | Bacteria | 2609 |
| 184 | Ga0207695_10367379 | 3300025913 | Bacteria | 1325 |
| 185 | Ga0207695_10667298 | 3300025913 | Bacteria | 920 |
| 186 | Ga0207693_10483370 | 3300025915 | Bacteria | 967 |
| 187 | Ga0207663_10053592 | 3300025916 | Unclassified | 2521 |
| 188 | Ga0207660_10002021 | 3300025917 | Bacteria | 13487 |
| 189 | Ga0207660_10123594 | 3300025917 | Bacteria | 1963 |
| 190 | Ga0207662_10000050 | 3300025918 | Bacteria | 51610 |
| 191 | Ga0207652_10104896 | 3300025921 | Bacteria | 2501 |
| 192 | Ga0207652_10249761 | 3300025921 | Bacteria | 1600 |
| 193 | Ga0207646_10031789 | 3300025922 | Bacteria | 4778 |
| 194 | Ga0207681_10510662 | 3300025923 | Unclassified | 985 |
| 195 | Ga0207687_10002282 | 3300025927 | Bacteria | 13054 |
| 196 | Ga0207687_10005719 | 3300025927 | Bacteria | 8226 |
| 197 | Ga0207700_10084709 | 3300025928 | Bacteria | 2486 |
| 198 | Ga0207664_10450903 | 3300025929 | Bacteria | 1148 |
| 199 | Ga0207644_10718154 | 3300025931 | Bacteria | 834 |
| 200 | Ga0207690_10358947 | 3300025932 | Bacteria | 1154 |
| 201 | Ga0207706_10039571 | 3300025933 | Unclassified | 4180 |
| 202 | Ga0207709_10001116 | 3300025935 | Bacteria | 19677 |
| 203 | Ga0207670_10005774 | 3300025936 | Bacteria | 6831 |
| 204 | Ga0207704_10000431 | 3300025938 | Bacteria | 18723 |
| 205 | Ga0207665_10240954 | 3300025939 | Bacteria | 1332 |
| 206 | Ga0207711_10026049 | 3300025941 | Bacteria | 4905 |
| 207 | Ga0207711_10238400 | 3300025941 | Bacteria | 1667 |
| 208 | Ga0207689_10002662 | 3300025942 | Bacteria | 16515 |
| 209 | Ga0207689_10321695 | 3300025942 | Bacteria | 1284 |
| 210 | Ga0207661_10400799 | 3300025944 | Bacteria | 1244 |
| 211 | Ga0207667_10106016 | 3300025949 | Unclassified | 2900 |
| 212 | Ga0207667_10212501 | 3300025949 | Unclassified | 1983 |
| 213 | Ga0207667_10672856 | 3300025949 | Bacteria | 1039 |
| 214 | Ga0207651_10167719 | 3300025960 | Bacteria | 1728 |
| 215 | Ga0207651_10648493 | 3300025960 | Bacteria | 927 |
| 216 | Ga0207712_10002625 | 3300025961 | Bacteria | 11514 |
| 217 | Ga0207640_10035267 | 3300025981 | Bacteria | 3129 |
| 218 | Ga0207677_11054670 | 3300026023 | Bacteria | 739 |
| 219 | Ga0207703_10600159 | 3300026035 | Bacteria | 1041 |
| 220 | Ga0207639_10035656 | 3300026041 | Bacteria | 3682 |
| 221 | Ga0207639_10205227 | 3300026041 | Bacteria | 1693 |
| 222 | Ga0207708_10000375 | 3300026075 | Bacteria | 34939 |
| 223 | Ga0207708_10388217 | 3300026075 | Bacteria | 1152 |
| 224 | Ga0207702_10004664 | 3300026078 | Bacteria | 12107 |
| 225 | Ga0207702_10357172 | 3300026078 | Bacteria | 1400 |
| 226 | Ga0207702_10423683 | 3300026078 | Bacteria | 1287 |
| 227 | Ga0207641_10165657 | 3300026088 | Bacteria | 2013 |
| 228 | Ga0207641_10746170 | 3300026088 | Bacteria | 966 |
| 229 | Ga0207648_10000663 | 3300026089 | Bacteria | 38545 |
| 230 | Ga0207675_100000454 | 3300026118 | Bacteria | 39739 |
| 231 | Ga0207675_101150102 | 3300026118 | Bacteria | 796 |
| 232 | Ga0207428_10003019 | 3300027907 | Bacteria | 16581 |
| 233 | Ga0207428_10011324 | 3300027907 | Bacteria | 7889 |
| 234 | Ga0207428_10120703 | 3300027907 | Unclassified | 2010 |
| 235 | Ga0207428_10203701 | 3300027907 | Bacteria | 1488 |
| 236 | Ga0268265_10001189 | 3300028380 | Bacteria | 22690 |
| 237 | Ga0268264_10002258 | 3300028381 | Bacteria | 17067 |
| 238 | Ga0265337_1056358 | 3300028556 | Bacteria | 1096 |
| 239 | Ga0265334_10008611 | 3300028573 | Bacteria | 4332 |
| 240 | Ga0265334_10040985 | 3300028573 | Bacteria | 1811 |
| 241 | Ga0265334_10077648 | 3300028573 | Unclassified | 1228 |
| 242 | Ga0265318_10000007 | 3300028577 | Bacteria | 280699 |
| 243 | Ga0265323_10014730 | 3300028653 | Bacteria | 3086 |
| 244 | Ga0265322_10072800 | 3300028654 | Bacteria | 975 |
| 245 | Ga0265336_10001353 | 3300028666 | Bacteria | 11359 |
| 246 | Ga0265336_10018355 | 3300028666 | Unclassified | 2267 |
| 247 | Ga0265338_10024630 | 3300028800 | Bacteria | 6141 |
| 248 | Ga0265338_10058799 | 3300028800 | Bacteria | 3390 |
| 249 | Ga0265338_10078097 | 3300028800 | Bacteria | 2794 |
| 250 | Ga0265338_10391399 | 3300028800 | Bacteria | 992 |
| 251 | Ga0265324_10000006 | 3300029957 | Bacteria | 267048 |
| 252 | Ga0265324_10001274 | 3300029957 | Bacteria | 14809 |
| 253 | Ga0265324_10014449 | 3300029957 | Bacteria | 2922 |
| 254 | Ga0265330_10187845 | 3300031235 | Bacteria | 875 |
| 255 | Ga0265328_10005997 | 3300031239 | Bacteria | 5175 |
| 256 | Ga0265320_10040009 | 3300031240 | Bacteria | 2340 |
| 257 | Ga0265325_10000767 | 3300031241 | Bacteria | 23240 |
| 258 | Ga0265340_10122090 | 3300031247 | Bacteria | 1198 |
| 259 | Ga0265331_10026866 | 3300031250 | Bacteria | 2890 |
| 260 | Ga0265331_10094943 | 3300031250 | Bacteria | 1376 |
| 261 | Ga0265316_10054216 | 3300031344 | Unclassified | 3140 |
| 262 | Ga0307509_10403004 | 3300031507 | Bacteria | 1074 |
| 263 | Ga0265313_10015730 | 3300031595 | Bacteria | 4386 |
| 264 | Ga0265314_10000594 | 3300031711 | Bacteria | 45538 |
| 265 | Ga0265314_10004530 | 3300031711 | Bacteria | 12844 |
| 266 | Ga0265314_10197385 | 3300031711 | Unclassified | 1192 |
| 267 | Ga0265314_10264023 | 3300031711 | Bacteria | 982 |
| 268 | Ga0265342_10005610 | 3300031712 | Bacteria | 9512 |
| 269 | Ga0265342_10009909 | 3300031712 | Bacteria | 6664 |
| 270 | Ga0373930_0001188 | 3300034816 | Bacteria | 3821 |
| 271 | Ga0373930_0028237 | 3300034816 | Bacteria | 1141 |
| 272 | Ga0373959_0032979 | 3300034820 | Bacteria | 1055 |
| 273 | Ga0373938_0003154 | 3300034957 | Bacteria | 2678 |
| 274 | Ga0373934_0007838 | 3300035086 | Bacteria | 3970 |
| 275 | Ga0373944_0015791 | 3300035089 | Bacteria | 2121 |
| 276 | Ga0373932_0026808 | 3300035112 | Bacteria | 1571 |
| 277 | Ga0373936_0021937 | 3300035113 | Bacteria | 2485 |
| 278 | Ga0373945_0036345 | 3300035116 | Bacteria | 1764 |
| 279 | Ga0373954_0003898 | 3300035118 | Bacteria | 6385 |
| 280 | Ga0373956_0220660 | 3300035119 | Unclassified | 900 |
| 281 | Ga0373957_0027242 | 3300035120 | Bacteria | 2075 |
| 282 | Ga0373960_0032661 | 3300035121 | Bacteria | 1463 |
| 283 | Ga0373946_0082710 | 3300035171 | Bacteria | 1409 |
| 284 | Ga0373955_0014946 | 3300035172 | Bacteria | 3790 |
| 285 | Ga0373955_0175439 | 3300035172 | Bacteria | 1270 |
| 286 | Ga0373924_0020673 | 3300035410 | Bacteria | 2561 |
| 287 | Ga0373931_0001986 | 3300035691 | Bacteria | 9001 |
| 288 | Ga0373931_0004207 | 3300035691 | Bacteria | 6555 |
| 289 | Ga0373935_0236273 | 3300035692 | Bacteria | 1274 |
| 290 | Ga0373927_0045469 | 3300035695 | Bacteria | 2840 |
| 291 | Ga0373927_0163508 | 3300035695 | Bacteria | 1458 |
| 292 | Ga0373933_0000974 | 3300035724 | Bacteria | 17483 |
| 293 | Ga0373933_0012850 | 3300035724 | Bacteria | 4630 |
| 294 | Ga0373933_0052806 | 3300035724 | Unclassified | 2433 |
| 295 | Ga0373933_0137047 | 3300035724 | Bacteria | 1543 |
| 296 | Ga0373933_0212153 | 3300035724 | Unclassified | 1241 |
| 297 | Ga0373947_0015528 | 3300035725 | Bacteria | 4373 |
| 298 | Ga0373937_0000924 | 3300036401 | Bacteria | 24924 |
| 299 | Ga0373937_0005804 | 3300036401 | Bacteria | 10612 |
| 300 | Ga0373937_0021182 | 3300036401 | Bacteria | 5834 |
| 301 | Ga0373937_0041786 | 3300036401 | Unclassified | 4183 |
| 302 | Ga0373937_0221736 | 3300036401 | Bacteria | 1780 |
| 303 | Ga0373937_0558530 | 3300036401 | Bacteria | 1087 |
| 304 | Ga0373937_0598309 | 3300036401 | Bacteria | 1047 |
| 305 | Ga0373925_0172213 | 3300037068 | Bacteria | 1709 |
| 306 | Ga0395900_0560718 | 3300037418 | Bacteria | 1086 |
| 307 | Ga0436364_1089434 | 3300037853 | Bacteria | 1081 |
| 308 | Ga0436362_0187221 | 3300039453 | Bacteria | 736 |
| 309 | Ga0451802_1021577 | 3300041460 | Unclassified | 718 |
| 310 | Ga0439462_0021171 | 3300042015 | Unclassified | 1698 |
| 311 | Ga0451577_0341339 | 3300042876 | Bacteria | 1358 |
| 312 | Ga0451577_1271237 | 3300042876 | Unclassified | 655 |
| 313 | Ga0453683_0012579 | 3300044673 | Bacteria | 5544 |
| 314 | Ga0453683_0111262 | 3300044673 | Bacteria | 1722 |
| 315 | Ga0453684_0121878 | 3300044712 | Bacteria | 3146 |
| 316 | Ga0453684_0579852 | 3300044712 | Unclassified | 1232 |
| 317 | Ga0451576_0001630 | 3300045051 | Bacteria | 37561 |
| 318 | Ga0451576_0006369 | 3300045051 | Bacteria | 14494 |
| 319 | Ga0451576_0116154 | 3300045051 | Bacteria | 2786 |
| 320 | Ga0451576_0222538 | 3300045051 | Bacteria | 1970 |
| 321 | Ga0451576_0450212 | 3300045051 | Bacteria | 1351 |
| 322 | Ga0451576_0932945 | 3300045051 | Unclassified | 910 |
| 323 | Ga0451576_1040521 | 3300045051 | Bacteria | 858 |
| 324 | Ga0466967_0344392 | 3300045976 | Bacteria | 1442 |
| 325 | Ga0495592_0039769 | 3300046454 | Bacteria | 3532 |
| 326 | Ga0495603_0006754 | 3300046455 | Bacteria | 6885 |
| 327 | Ga0495629_0002047 | 3300046459 | Bacteria | 15675 |
| 328 | Ga0495629_0129217 | 3300046459 | Bacteria | 1760 |
| 329 | Ga0495651_0000214 | 3300046462 | Bacteria | 44308 |
| 330 | Ga0495653_0001647 | 3300046463 | Bacteria | 17541 |
| 331 | Ga0495580_0005855 | 3300046472 | Bacteria | 10087 |
| 332 | Ga0495580_0347653 | 3300046472 | Bacteria | 1005 |
| 333 | Ga0495582_0039527 | 3300046473 | Bacteria | 2597 |
| 334 | Ga0495662_0038562 | 3300046476 | Bacteria | 2309 |
| 335 | Ga0495662_0053605 | 3300046476 | Bacteria | 1948 |
| 336 | Ga0495664_0006909 | 3300046477 | Bacteria | 6282 |
| 337 | Ga0495664_0011809 | 3300046477 | Bacteria | 4933 |
| 338 | Ga0495594_0015299 | 3300046499 | Bacteria | 4028 |
| 339 | Ga0495594_0274144 | 3300046499 | Bacteria | 961 |
| 340 | Ga0495594_0376614 | 3300046499 | Bacteria | 808 |
| 341 | Ga0495608_0009530 | 3300046511 | Bacteria | 6781 |
| 342 | Ga0495618_0000537 | 3300046514 | Bacteria | 26842 |
| 343 | Ga0495618_0001686 | 3300046514 | Bacteria | 14661 |
| 344 | Ga0495618_0009614 | 3300046514 | Bacteria | 5839 |
| 345 | Ga0495628_0030182 | 3300046516 | Bacteria | 4391 |
| 346 | Ga0495630_0063234 | 3300046517 | Bacteria | 2780 |
| 347 | Ga0495630_0087008 | 3300046517 | Bacteria | 2360 |
| 348 | Ga0495630_0408732 | 3300046517 | Bacteria | 1040 |
| 349 | Ga0495630_0475063 | 3300046517 | Bacteria | 958 |
| 350 | Ga0495666_0045798 | 3300046526 | Bacteria | 2109 |
| 351 | Ga0495652_0002479 | 3300046529 | Bacteria | 18959 |
| 352 | Ga0495665_0181629 | 3300046531 | Bacteria | 1093 |
| 353 | Ga0495640_0007570 | 3300046533 | Bacteria | 8532 |
| 354 | Ga0495640_0057472 | 3300046533 | Bacteria | 2655 |
| 355 | Ga0495640_0169488 | 3300046533 | Bacteria | 1395 |
| 356 | Ga0495586_0004334 | 3300046535 | Bacteria | 7580 |
| 357 | Ga0495587_0000715 | 3300046536 | Bacteria | 22151 |
| 358 | Ga0495645_0008358 | 3300046543 | Bacteria | 7226 |
| 359 | Ga0495667_0047639 | 3300046559 | Bacteria | 2831 |
| 360 | Ga0495634_0003492 | 3300046642 | Bacteria | 12596 |
| 361 | Ga0495634_0029297 | 3300046642 | Bacteria | 3812 |
| 362 | Ga0495634_0089664 | 3300046642 | Bacteria | 1998 |
| 363 | Ga0495634_0271576 | 3300046642 | Bacteria | 1032 |
| 364 | Ga0495635_0000562 | 3300046663 | Bacteria | 23704 |
| 365 | Ga0495635_0367398 | 3300046663 | Bacteria | 958 |
| 366 | Ga0495635_0592665 | 3300046663 | Unclassified | 724 |
| 367 | Ga0495588_0070957 | 3300046674 | Bacteria | 1811 |
| 368 | Ga0495657_0109018 | 3300046675 | Bacteria | 1756 |
| 369 | Ga0495599_0008513 | 3300046678 | Bacteria | 6240 |
| 370 | Ga0495623_0001280 | 3300046679 | Bacteria | 17075 |
| 371 | Ga0495623_0064891 | 3300046679 | Bacteria | 2284 |
| 372 | Ga0495646_0002811 | 3300046680 | Bacteria | 10773 |
| 373 | Ga0495647_0005582 | 3300046681 | Bacteria | 4130 |
| 374 | Ga0495658_0002156 | 3300046683 | Bacteria | 9965 |
| 375 | Ga0495658_0013385 | 3300046683 | Bacteria | 4175 |
| 376 | Ga0495658_0016587 | 3300046683 | Bacteria | 3791 |
| 377 | Ga0495613_0012341 | 3300046689 | Bacteria | 6347 |
| 378 | Ga0495613_0049700 | 3300046689 | Bacteria | 3094 |
| 379 | Ga0495624_0210442 | 3300046690 | Bacteria | 1180 |
| 380 | Ga0495624_0243983 | 3300046690 | Bacteria | 1087 |
| 381 | Ga0495600_0013786 | 3300046809 | Bacteria | 5090 |
| 382 | Ga0495600_0383198 | 3300046809 | Bacteria | 877 |
| 383 | Ga0495581_0089301 | 3300047315 | Bacteria | 1787 |
| 384 | Ga0495581_0178096 | 3300047315 | Bacteria | 1243 |
| 385 | Ga0495604_0000382 | 3300047317 | Bacteria | 40024 |
| 386 | Ga0495674_0003824 | 3300047319 | Bacteria | 14620 |
| 387 | Ga0495674_0100098 | 3300047319 | Bacteria | 2467 |
| 388 | Ga0495680_0001240 | 3300047322 | Bacteria | 27994 |
| 389 | Ga0495680_0012581 | 3300047322 | Bacteria | 7436 |
| 390 | Ga0495675_0001812 | 3300047444 | Bacteria | 12732 |
| 391 | Ga0495684_0294040 | 3300047471 | Bacteria | 1168 |
| 392 | Ga0495593_0057173 | 3300047673 | Bacteria | 2049 |
| 393 | Ga0495602_0001751 | 3300048088 | Bacteria | 21661 |
| 394 | Ga0495602_0321645 | 3300048088 | Unclassified | 1125 |
| 395 | Ga0496100_0456019 | 3300048903 | Bacteria | 981 |
| 396 | Ga0496106_0735135 | 3300048909 | Bacteria | 785 |
| 397 | Ga0496107_0288316 | 3300048910 | Bacteria | 1222 |
| 398 | Ga0496108_0416085 | 3300048911 | Bacteria | 1174 |
| 399 | Ga0496109_0136610 | 3300048912 | Bacteria | 2291 |
| 400 | Ga0496109_0877514 | 3300048912 | Bacteria | 835 |
| 401 | Ga0496114_0035068 | 3300048917 | Unclassified | 4142 |
| 402 | Ga0496115_0208839 | 3300048918 | Bacteria | 1613 |
| 403 | Ga0501033_0005965 | 3300049570 | Bacteria | 9563 |
| 404 | Ga0501033_0037825 | 3300049570 | Bacteria | 3611 |
| 405 | Ga0501034_0495994 | 3300049571 | Bacteria | 1135 |
| 406 | Ga0501036_0002300 | 3300049572 | Bacteria | 14940 |
| 407 | Ga0501037_0011409 | 3300049573 | Bacteria | 6539 |
| 408 | Ga0501037_0179566 | 3300049573 | Bacteria | 1502 |
| 409 | Ga0501038_0016769 | 3300049574 | Bacteria | 6634 |
| 410 | Ga0501039_0009384 | 3300049575 | Bacteria | 7458 |
| 411 | Ga0501039_0753363 | 3300049575 | Bacteria | 760 |
| 412 | Ga0501040_0009441 | 3300049576 | Bacteria | 6361 |
| 413 | Ga0501040_0190712 | 3300049576 | Bacteria | 1454 |
| 414 | Ga0501041_0001494 | 3300049577 | Bacteria | 12958 |
| 415 | Ga0501041_0252075 | 3300049577 | Bacteria | 1109 |
| 416 | Ga0501042_0001293 | 3300049578 | Bacteria | 14587 |
| 417 | Ga0501043_0013889 | 3300049579 | Bacteria | 6301 |
| 418 | Ga0501046_0005727 | 3300049580 | Bacteria | 11088 |
| 419 | Ga0501047_0006762 | 3300049581 | Bacteria | 10774 |
| 420 | Ga0501048_0055615 | 3300049582 | Bacteria | 2808 |
| 421 | Ga0501068_0053576 | 3300049584 | Bacteria | 2443 |
| 422 | Ga0501069_0041718 | 3300049585 | Bacteria | 2537 |
| 423 | Ga0501070_0012341 | 3300049586 | Bacteria | 7208 |
| 424 | Ga0501071_0007128 | 3300049587 | Bacteria | 7307 |
| 425 | Ga0501071_0031340 | 3300049587 | Bacteria | 3768 |
| 426 | Ga0501071_0344349 | 3300049587 | Bacteria | 1134 |
| 427 | Ga0501072_0001780 | 3300049588 | Bacteria | 16027 |
| 428 | Ga0501072_0261055 | 3300049588 | Unclassified | 1379 |
| 429 | Ga0501073_0028416 | 3300049589 | Bacteria | 3996 |
| 430 | Ga0501074_0006854 | 3300049590 | Bacteria | 8228 |
| 431 | Ga0501074_0023638 | 3300049590 | Bacteria | 4467 |
| 432 | Ga0501075_0039172 | 3300049591 | Bacteria | 3546 |
| 433 | Ga0501076_0001146 | 3300049592 | Bacteria | 17555 |
| 434 | Ga0501076_0297000 | 3300049592 | Bacteria | 1324 |
| 435 | Ga0501077_0003582 | 3300049593 | Bacteria | 9330 |
| 436 | Ga0501079_0002542 | 3300049741 | Bacteria | 13241 |
| 437 | Ga0501079_0441980 | 3300049741 | Bacteria | 1021 |
| 438 | Ga0501080_0236289 | 3300049742 | Bacteria | 1669 |
| 439 | Ga0501081_0000579 | 3300049743 | Bacteria | 20804 |
| 440 | Ga0501081_0012163 | 3300049743 | Bacteria | 5645 |
| 441 | Ga0501081_0232471 | 3300049743 | Bacteria | 1343 |
| 442 | Ga0501083_0369263 | 3300049744 | Bacteria | 933 |
| 443 | Ga0501035_0081117 | 3300049822 | Bacteria | 2863 |
| 444 | Ga0501035_0082106 | 3300049822 | Bacteria | 2844 |
| 445 | Ga0501044_0015384 | 3300049823 | Bacteria | 8240 |
| 446 | Ga0501045_0284596 | 3300049824 | Unclassified | 1231 |
| 447 | nmdc:mga0k408_108228_c1 | 3300050493 | Bacteria | 1642 |
| 448 | nmdc:mga05p37_1129375_c1 | 3300050507 | Unclassified | 817 |
| 449 | nmdc:mga05p37_138229_c1 | 3300050507 | Bacteria | 2986 |
| 450 | nmdc:mga05p37_1657_c2 | 3300050507 | Bacteria | 25223 |
| 451 | nmdc:mga05p37_3701_c1 | 3300050507 | Bacteria | 17881 |
| 452 | nmdc:mga05p37_450319_c1 | 3300050507 | Unclassified | 1490 |
| 453 | nmdc:mga05p37_912149_c1 | 3300050507 | Bacteria | 946 |
| 454 | nmdc:mga09592_199016_c1 | 3300050508 | Unclassified | 1735 |
| 455 | nmdc:mga09592_2089_c1 | 3300050508 | Bacteria | 16115 |
| 456 | nmdc:mga0qj67_164083_c1 | 3300050509 | Bacteria | 1803 |
| 457 | nmdc:mga0qj67_51159_c1 | 3300050509 | Bacteria | 3266 |
| 458 | nmdc:mga06r32_254234_c1 | 3300050510 | Unclassified | 1745 |
| 459 | nmdc:mga06r32_27446_c1 | 3300050510 | Bacteria | 5318 |
| 460 | nmdc:mga06r32_840285_c1 | 3300050510 | Bacteria | 877 |
| 461 | nmdc:mga08y16_235687_c1 | 3300050511 | Bacteria | 1893 |
| 462 | nmdc:mga08y16_309225_c1 | 3300050511 | Bacteria | 1628 |
| 463 | nmdc:mga08y16_59357_c1 | 3300050511 | Unclassified | 3996 |
| 464 | nmdc:mga0n895_1877_c1 | 3300050512 | Bacteria | 16061 |
| 465 | nmdc:mga0n895_205287_c1 | 3300050512 | Unclassified | 2001 |
| 466 | nmdc:mga0n895_388879_c1 | 3300050512 | Unclassified | 1411 |
| 467 | nmdc:mga0n895_43173_c2 | 3300050512 | Bacteria | 1410 |
| 468 | nmdc:mga0n895_93081_c1 | 3300050512 | Bacteria | 3018 |
| 469 | nmdc:mga0rr50_231521_c1 | 3300050513 | Bacteria | 1529 |
| 470 | nmdc:mga0rr50_82541_c1 | 3300050513 | Bacteria | 2483 |
| 471 | nmdc:mga08x19_2511_c1 | 3300050514 | Bacteria | 11151 |
| 472 | nmdc:mga08x19_405939_c1 | 3300050514 | Bacteria | 956 |
| 473 | nmdc:mga0a205_239550_c1 | 3300050515 | Unclassified | 1695 |
| 474 | nmdc:mga0a205_24210_c1 | 3300050515 | Bacteria | 5768 |
| 475 | nmdc:mga0a205_29218_c1 | 3300050515 | Bacteria | 5276 |
| 476 | nmdc:mga0a205_413836_c1 | 3300050515 | Bacteria | 1211 |
| 477 | nmdc:mga0a205_760677_c1 | 3300050515 | Bacteria | 817 |
| 478 | nmdc:mga0a205_98374_c1 | 3300050515 | Unclassified | 2824 |
| 479 | Ga0495601_0026105 | 3300053077 | Unclassified | 3605 |
| 480 | Ga0495612_0001450 | 3300053078 | Bacteria | 9771 |
| 481 | Ga0495595_0003038 | 3300053084 | Bacteria | 6636 |
| 482 | Ga0495595_0255860 | 3300053084 | Unclassified | 877 |
| 483 | Ga0495619_0003346 | 3300053085 | Bacteria | 10364 |
| 484 | Ga0500559_0189046 | 3300053136 | Bacteria | 971 |
| 485 | Ga0500552_030087 | 3300053733 | Bacteria | 831 |
| 486 | Ga0501084_0015970 | 3300054114 | Bacteria | 6231 |
| 487 | Ga0501084_0218208 | 3300054114 | Bacteria | 1609 |
| 488 | Ga0590071_000266 | 3300059421 | Bacteria | 15231 |
| 489 | Ga0590074_000639 | 3300059423 | Bacteria | 5279 |
| 490 | Ga0590075_000189 | 3300059424 | Bacteria | 17095 |
| 491 | Ga0590077_000037 | 3300059426 | Bacteria | 30721 |
| 492 | Ga0501082_0018016 | 3300060353 | Bacteria | 6082 |
| 493 | Ga0530510_0016366 | 3300061734 | Bacteria | 5248 |
| 494 | Ga0530510_0106335 | 3300061734 | Bacteria | 2054 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035113 | Ga0373936_0021937 | Ga0373936_0021937_566_1210 | 178 |
| 2 | 3300035116 | Ga0373945_0036345 | Ga0373945_0036345_677_1321 | 178 |
| 3 | 3300035171 | Ga0373946_0082710 | Ga0373946_0082710_635_1279 | 178 |
| 4 | 3300035695 | Ga0373927_0163508 | Ga0373927_0163508_346_990 | 178 |
| 5 | 3300035725 | Ga0373947_0015528 | Ga0373947_0015528_448_1092 | 178 |
| 6 | 3300037068 | Ga0373925_0172213 | Ga0373925_0172213_497_1141 | 178 |
| 7 | 3300046455 | Ga0495603_0006754 | Ga0495603_0006754_4055_4699 | 178 |
| 8 | 3300046472 | Ga0495580_0005855 | Ga0495580_0005855_6182_6826 | 178 |
| 9 | 3300046473 | Ga0495582_0039527 | Ga0495582_0039527_1940_2584 | 178 |
| 10 | 3300046517 | Ga0495630_0087008 | Ga0495630_0087008_1649_2293 | 178 |
| 11 | 3300046526 | Ga0495666_0045798 | Ga0495666_0045798_345_989 | 178 |
| 12 | 3300046531 | Ga0495665_0181629 | Ga0495665_0181629_334_978 | 178 |
| 13 | 3300046535 | Ga0495586_0004334 | Ga0495586_0004334_6105_6749 | 178 |
| 14 | 3300046674 | Ga0495588_0070957 | Ga0495588_0070957_25_669 | 178 |
| 15 | 3300046683 | Ga0495658_0002156 | Ga0495658_0002156_3037_3681 | 178 |
| 16 | 3300005338 | Ga0068868_100551003 | Ga0068868_1005510031 | 184 |
| 17 | 3300014325 | Ga0163163_10059219 | Ga0163163_100592191 | 184 |
| 18 | 3300042876 | Ga0451577_1271237 | Ga0451577_1271237_81_641 | 184 |
| 19 | 3300006871 | Ga0075434_100001831 | Ga0075434_10000183119 | 185 |
| 20 | 3300036401 | Ga0373937_0558530 | Ga0373937_0558530_203_847 | 185 |
| 21 | 3300046499 | Ga0495594_0274144 | Ga0495594_0274144_28_588 | 185 |
| 22 | 3300050512 | nmdc:mga0n895_1877_c1 | nmdc:mga0n895_1877_c1_9901_10464 | 185 |
| 23 | 3300050514 | nmdc:mga08x19_405939_c1 | nmdc:mga08x19_405939_c1_379_939 | 185 |
| 24 | 3300036401 | Ga0373937_0221736 | Ga0373937_0221736_622_1260 | 190 |
| 25 | 3300044712 | Ga0453684_0121878 | Ga0453684_0121878_2234_2815 | 192 |
| 26 | 3300035118 | Ga0373954_0003898 | Ga0373954_0003898_4422_5060 | 193 |
| 27 | 3300035119 | Ga0373956_0220660 | Ga0373956_0220660_14_652 | 193 |
| 28 | 3300035724 | Ga0373933_0012850 | Ga0373933_0012850_3718_4356 | 193 |
| 29 | 3300036401 | Ga0373937_0021182 | Ga0373937_0021182_111_749 | 193 |
| 30 | 3300046459 | Ga0495629_0129217 | Ga0495629_0129217_284_922 | 193 |
| 31 | 3300046514 | Ga0495618_0001686 | Ga0495618_0001686_8782_9420 | 193 |
| 32 | 3300046517 | Ga0495630_0408732 | Ga0495630_0408732_238_876 | 193 |
| 33 | 3300046533 | Ga0495640_0057472 | Ga0495640_0057472_679_1317 | 193 |
| 34 | 3300046642 | Ga0495634_0029297 | Ga0495634_0029297_2905_3543 | 193 |
| 35 | 3300046663 | Ga0495635_0367398 | Ga0495635_0367398_197_835 | 193 |
| 36 | 3300046689 | Ga0495613_0012341 | Ga0495613_0012341_4173_4811 | 193 |
| 37 | 3300047322 | Ga0495680_0012581 | Ga0495680_0012581_1742_2380 | 193 |
| 38 | 3300047471 | Ga0495684_0294040 | Ga0495684_0294040_371_1009 | 193 |
| 39 | 3300053136 | Ga0500559_0189046 | Ga0500559_0189046_127_771 | 193 |
| 40 | 3300009093 | Ga0105240_10103152 | Ga0105240_101031524 | 195 |
| 41 | 3300009093 | Ga0105240_10508208 | Ga0105240_105082082 | 195 |
| 42 | 3300027907 | Ga0207428_10203701 | Ga0207428_102037012 | 195 |
| 43 | 3300009094 | Ga0111539_10386804 | Ga0111539_103868042 | 196 |
| 44 | 3300050511 | nmdc:mga08y16_309225_c1 | nmdc:mga08y16_309225_c1_478_1119 | 196 |
| 45 | 3300026075 | Ga0207708_10388217 | Ga0207708_103882172 | 197 |
| 46 | 3300031240 | Ga0265320_10040009 | Ga0265320_100400094 | 197 |
| 47 | 3300031250 | Ga0265331_10094943 | Ga0265331_100949431 | 197 |
| 48 | 3300005338 | Ga0068868_100531993 | Ga0068868_1005319931 | 198 |
| 49 | 3300025960 | Ga0207651_10648493 | Ga0207651_106484932 | 198 |
| 50 | 3300041460 | Ga0451802_1021577 | Ga0451802_1021577_10_618 | 199 |
| 51 | 3300050512 | nmdc:mga0n895_388879_c1 | nmdc:mga0n895_388879_c1_443_1054 | 200 |
| 52 | 3300046663 | Ga0495635_0592665 | Ga0495635_0592665_22_630 | 201 |
| 53 | 3300049576 | Ga0501040_0190712 | Ga0501040_0190712_563_1177 | 201 |
| 54 | 3300049577 | Ga0501041_0252075 | Ga0501041_0252075_24_638 | 201 |
| 55 | 3300049743 | Ga0501081_0012163 | Ga0501081_0012163_3104_3718 | 201 |
| 56 | 3300049824 | Ga0501045_0284596 | Ga0501045_0284596_58_672 | 201 |
| 57 | 3300061734 | Ga0530510_0106335 | Ga0530510_0106335_1296_1910 | 201 |
| 58 | 3300045976 | Ga0466967_0344392 | Ga0466967_0344392_289_915 | 203 |
| 59 | 3300028573 | Ga0265334_10008611 | Ga0265334_100086114 | 204 |
| 60 | 3300028577 | Ga0265318_10000007 | Ga0265318_10000007153 | 204 |
| 61 | 3300029957 | Ga0265324_10014449 | Ga0265324_100144493 | 204 |
| 62 | 3300031595 | Ga0265313_10015730 | Ga0265313_100157305 | 204 |
| 63 | 3300031711 | Ga0265314_10000594 | Ga0265314_1000059424 | 204 |
| 64 | 3300049744 | Ga0501083_0369263 | Ga0501083_0369263_110_733 | 204 |
| 65 | 3300034820 | Ga0373959_0032979 | Ga0373959_0032979_268_906 | 206 |
| 66 | 3300003316 | rootH1_10012424 | rootH1_1001242414 | 208 |
| 67 | 3300049743 | Ga0501081_0232471 | Ga0501081_0232471_493_1137 | 209 |
| 68 | 3300005457 | Ga0070662_100033739 | Ga0070662_1000337393 | 210 |
| 69 | 3300006871 | Ga0075434_100495130 | Ga0075434_1004951302 | 210 |
| 70 | 3300013297 | Ga0157378_10149320 | Ga0157378_101493202 | 210 |
| 71 | 3300025933 | Ga0207706_10039571 | Ga0207706_100395713 | 210 |
| 72 | 3300026023 | Ga0207677_11054670 | Ga0207677_110546701 | 210 |
| 73 | 3300037418 | Ga0395900_0560718 | Ga0395900_0560718_37_702 | 210 |
| 74 | 3300042015 | Ga0439462_0021171 | Ga0439462_0021171_698_1342 | 210 |
| 75 | 3300044712 | Ga0453684_0579852 | Ga0453684_0579852_400_1041 | 210 |
| 76 | 3300002705 | JGI25156J39149_1001163 | JGI25156J39149_10011637 | 211 |
| 77 | 3300004799 | Ga0058863_11092087 | Ga0058863_110920872 | 211 |
| 78 | 3300005290 | Ga0065712_10348092 | Ga0065712_103480921 | 211 |
| 79 | 3300005295 | Ga0065707_10103056 | Ga0065707_101030562 | 211 |
| 80 | 3300005327 | Ga0070658_10094802 | Ga0070658_100948023 | 211 |
| 81 | 3300005329 | Ga0070683_100032985 | Ga0070683_1000329856 | 211 |
| 82 | 3300005329 | Ga0070683_100240705 | Ga0070683_1002407051 | 211 |
| 83 | 3300005330 | Ga0070690_100000575 | Ga0070690_1000005751 | 211 |
| 84 | 3300005330 | Ga0070690_100163015 | Ga0070690_1001630151 | 211 |
| 85 | 3300005330 | Ga0070690_100233176 | Ga0070690_1002331762 | 211 |
| 86 | 3300005331 | Ga0070670_101054593 | Ga0070670_1010545931 | 211 |
| 87 | 3300005334 | Ga0068869_100001102 | Ga0068869_1000011026 | 211 |
| 88 | 3300005334 | Ga0068869_100208441 | Ga0068869_1002084412 | 211 |
| 89 | 3300005335 | Ga0070666_10198773 | Ga0070666_101987732 | 211 |
| 90 | 3300005335 | Ga0070666_10465528 | Ga0070666_104655281 | 211 |
| 91 | 3300005336 | Ga0070680_100024246 | Ga0070680_1000242463 | 211 |
| 92 | 3300005336 | Ga0070680_100492952 | Ga0070680_1004929521 | 211 |
| 93 | 3300005337 | Ga0070682_100005071 | Ga0070682_1000050716 | 211 |
| 94 | 3300005338 | Ga0068868_100021926 | Ga0068868_1000219264 | 211 |
| 95 | 3300005340 | Ga0070689_100000814 | Ga0070689_10000081411 | 211 |
| 96 | 3300005340 | Ga0070689_100779427 | Ga0070689_1007794271 | 211 |
| 97 | 3300005343 | Ga0070687_100000171 | Ga0070687_1000001718 | 211 |
| 98 | 3300005345 | Ga0070692_10002591 | Ga0070692_100025912 | 211 |
| 99 | 3300005345 | Ga0070692_10138073 | Ga0070692_101380732 | 211 |
| 100 | 3300005353 | Ga0070669_100072368 | Ga0070669_1000723681 | 211 |
| 101 | 3300005354 | Ga0070675_101142694 | Ga0070675_1011426941 | 211 |
| 102 | 3300005355 | Ga0070671_100431679 | Ga0070671_1004316792 | 211 |
| 103 | 3300005364 | Ga0070673_100141774 | Ga0070673_1001417742 | 211 |
| 104 | 3300005364 | Ga0070673_100727504 | Ga0070673_1007275041 | 211 |
| 105 | 3300005365 | Ga0070688_100666436 | Ga0070688_1006664361 | 211 |
| 106 | 3300005366 | Ga0070659_100426577 | Ga0070659_1004265771 | 211 |
| 107 | 3300005406 | Ga0070703_10015642 | Ga0070703_100156422 | 211 |
| 108 | 3300005406 | Ga0070703_10020760 | Ga0070703_100207602 | 211 |
| 109 | 3300005406 | Ga0070703_10133650 | Ga0070703_101336502 | 211 |
| 110 | 3300005436 | Ga0070713_100076875 | Ga0070713_1000768754 | 211 |
| 111 | 3300005436 | Ga0070713_100532687 | Ga0070713_1005326872 | 211 |
| 112 | 3300005436 | Ga0070713_101150198 | Ga0070713_1011501981 | 211 |
| 113 | 3300005438 | Ga0070701_10000376 | Ga0070701_1000037612 | 211 |
| 114 | 3300005438 | Ga0070701_10455238 | Ga0070701_104552381 | 211 |
| 115 | 3300005439 | Ga0070711_100107323 | Ga0070711_1001073233 | 211 |
| 116 | 3300005440 | Ga0070705_100000270 | Ga0070705_10000027013 | 211 |
| 117 | 3300005441 | Ga0070700_100002521 | Ga0070700_1000025214 | 211 |
| 118 | 3300005444 | Ga0070694_100000941 | Ga0070694_10000094113 | 211 |
| 119 | 3300005444 | Ga0070694_100849625 | Ga0070694_1008496251 | 211 |
| 120 | 3300005445 | Ga0070708_100204035 | Ga0070708_1002040352 | 211 |
| 121 | 3300005458 | Ga0070681_10046516 | Ga0070681_100465165 | 211 |
| 122 | 3300005458 | Ga0070681_10049411 | Ga0070681_100494112 | 211 |
| 123 | 3300005458 | Ga0070681_10721441 | Ga0070681_107214412 | 211 |
| 124 | 3300005459 | Ga0068867_100000947 | Ga0068867_10000094710 | 211 |
| 125 | 3300005468 | Ga0070707_100039874 | Ga0070707_1000398742 | 211 |
| 126 | 3300005471 | Ga0070698_100156887 | Ga0070698_1001568873 | 211 |
| 127 | 3300005518 | Ga0070699_100006690 | Ga0070699_1000066903 | 211 |
| 128 | 3300005518 | Ga0070699_100192247 | Ga0070699_1001922472 | 211 |
| 129 | 3300005530 | Ga0070679_100004354 | Ga0070679_10000435412 | 211 |
| 130 | 3300005530 | Ga0070679_100263424 | Ga0070679_1002634242 | 211 |
| 131 | 3300005535 | Ga0070684_100267973 | Ga0070684_1002679732 | 211 |
| 132 | 3300005536 | Ga0070697_100117970 | Ga0070697_1001179702 | 211 |
| 133 | 3300005536 | Ga0070697_100126144 | Ga0070697_1001261442 | 211 |
| 134 | 3300005539 | Ga0068853_100081521 | Ga0068853_1000815213 | 211 |
| 135 | 3300005539 | Ga0068853_101070345 | Ga0068853_1010703451 | 211 |
| 136 | 3300005544 | Ga0070686_100000516 | Ga0070686_1000005164 | 211 |
| 137 | 3300005544 | Ga0070686_100136201 | Ga0070686_1001362012 | 211 |
| 138 | 3300005545 | Ga0070695_100000162 | Ga0070695_10000016214 | 211 |
| 139 | 3300005546 | Ga0070696_100001207 | Ga0070696_1000012076 | 211 |
| 140 | 3300005546 | Ga0070696_100001426 | Ga0070696_10000142614 | 211 |
| 141 | 3300005546 | Ga0070696_100002453 | Ga0070696_10000245314 | 211 |
| 142 | 3300005546 | Ga0070696_100006184 | Ga0070696_1000061844 | 211 |
| 143 | 3300005546 | Ga0070696_100155479 | Ga0070696_1001554792 | 211 |
| 144 | 3300005547 | Ga0070693_100000071 | Ga0070693_10000007123 | 211 |
| 145 | 3300005549 | Ga0070704_100001539 | Ga0070704_1000015394 | 211 |
| 146 | 3300005549 | Ga0070704_100210879 | Ga0070704_1002108792 | 211 |
| 147 | 3300005563 | Ga0068855_100004363 | Ga0068855_1000043632 | 211 |
| 148 | 3300005563 | Ga0068855_100120314 | Ga0068855_1001203144 | 211 |
| 149 | 3300005563 | Ga0068855_100260216 | Ga0068855_1002602162 | 211 |
| 150 | 3300005578 | Ga0068854_100004587 | Ga0068854_1000045878 | 211 |
| 151 | 3300005614 | Ga0068856_100006005 | Ga0068856_10000600513 | 211 |
| 152 | 3300005614 | Ga0068856_100231269 | Ga0068856_1002312691 | 211 |
| 153 | 3300005615 | Ga0070702_100000211 | Ga0070702_1000002112 | 211 |
| 154 | 3300005616 | Ga0068852_100404194 | Ga0068852_1004041942 | 211 |
| 155 | 3300005616 | Ga0068852_100636692 | Ga0068852_1006366921 | 211 |
| 156 | 3300005617 | Ga0068859_100001726 | Ga0068859_10000172614 | 211 |
| 157 | 3300005617 | Ga0068859_100131079 | Ga0068859_1001310793 | 211 |
| 158 | 3300005617 | Ga0068859_100955216 | Ga0068859_1009552162 | 211 |
| 159 | 3300005719 | Ga0068861_100138348 | Ga0068861_1001383484 | 211 |
| 160 | 3300005840 | Ga0068870_10002272 | Ga0068870_100022725 | 211 |
| 161 | 3300005841 | Ga0068863_100268894 | Ga0068863_1002688941 | 211 |
| 162 | 3300005842 | Ga0068858_100001499 | Ga0068858_10000149913 | 211 |
| 163 | 3300005842 | Ga0068858_100775325 | Ga0068858_1007753252 | 211 |
| 164 | 3300005843 | Ga0068860_100001892 | Ga0068860_10000189214 | 211 |
| 165 | 3300005843 | Ga0068860_100340829 | Ga0068860_1003408292 | 211 |
| 166 | 3300005844 | Ga0068862_100004151 | Ga0068862_1000041514 | 211 |
| 167 | 3300005844 | Ga0068862_100620310 | Ga0068862_1006203101 | 211 |
| 168 | 3300006028 | Ga0070717_10062554 | Ga0070717_100625541 | 211 |
| 169 | 3300006195 | Ga0075366_10158785 | Ga0075366_101587852 | 211 |
| 170 | 3300006237 | Ga0097621_100001372 | Ga0097621_10000137213 | 211 |
| 171 | 3300006358 | Ga0068871_100001218 | Ga0068871_10000121813 | 211 |
| 172 | 3300006358 | Ga0068871_100312456 | Ga0068871_1003124561 | 211 |
| 173 | 3300006844 | Ga0075428_100002539 | Ga0075428_1000025398 | 211 |
| 174 | 3300006844 | Ga0075428_100017442 | Ga0075428_1000174425 | 211 |
| 175 | 3300006844 | Ga0075428_100108989 | Ga0075428_1001089894 | 211 |
| 176 | 3300006846 | Ga0075430_100036869 | Ga0075430_1000368694 | 211 |
| 177 | 3300006846 | Ga0075430_100059571 | Ga0075430_1000595713 | 211 |
| 178 | 3300006846 | Ga0075430_100137138 | Ga0075430_1001371382 | 211 |
| 179 | 3300006846 | Ga0075430_100150465 | Ga0075430_1001504653 | 211 |
| 180 | 3300006847 | Ga0075431_100015650 | Ga0075431_1000156507 | 211 |
| 181 | 3300006847 | Ga0075431_100667690 | Ga0075431_1006676902 | 211 |
| 182 | 3300006852 | Ga0075433_10009944 | Ga0075433_1000994410 | 211 |
| 183 | 3300006852 | Ga0075433_10045538 | Ga0075433_100455381 | 211 |
| 184 | 3300006852 | Ga0075433_10231962 | Ga0075433_102319621 | 211 |
| 185 | 3300006852 | Ga0075433_10280195 | Ga0075433_102801953 | 211 |
| 186 | 3300006852 | Ga0075433_10886946 | Ga0075433_108869461 | 211 |
| 187 | 3300006852 | Ga0075433_10956674 | Ga0075433_109566742 | 211 |
| 188 | 3300006871 | Ga0075434_100025766 | Ga0075434_1000257662 | 211 |
| 189 | 3300006871 | Ga0075434_100336546 | Ga0075434_1003365462 | 211 |
| 190 | 3300006880 | Ga0075429_100005800 | Ga0075429_1000058006 | 211 |
| 191 | 3300006881 | Ga0068865_100000407 | Ga0068865_10000040723 | 211 |
| 192 | 3300006914 | Ga0075436_100009289 | Ga0075436_1000092896 | 211 |
| 193 | 3300006914 | Ga0075436_100173322 | Ga0075436_1001733221 | 211 |
| 194 | 3300006931 | Ga0097620_100001726 | Ga0097620_10000172614 | 211 |
| 195 | 3300006931 | Ga0097620_100131079 | Ga0097620_1001310792 | 211 |
| 196 | 3300006931 | Ga0097620_100955446 | Ga0097620_1009554462 | 211 |
| 197 | 3300007076 | Ga0075435_100008379 | Ga0075435_1000083798 | 211 |
| 198 | 3300007076 | Ga0075435_100153002 | Ga0075435_1001530023 | 211 |
| 199 | 3300009093 | Ga0105240_10537942 | Ga0105240_105379422 | 211 |
| 200 | 3300009093 | Ga0105240_10937698 | Ga0105240_109376981 | 211 |
| 201 | 3300009094 | Ga0111539_10013487 | Ga0111539_100134878 | 211 |
| 202 | 3300009094 | Ga0111539_10034696 | Ga0111539_100346964 | 211 |
| 203 | 3300009098 | Ga0105245_10003506 | Ga0105245_1000350616 | 211 |
| 204 | 3300009098 | Ga0105245_10010072 | Ga0105245_100100728 | 211 |
| 205 | 3300009098 | Ga0105245_10016870 | Ga0105245_1001687012 | 211 |
| 206 | 3300009147 | Ga0114129_10002308 | Ga0114129_1000230826 | 211 |
| 207 | 3300009147 | Ga0114129_10006698 | Ga0114129_1000669812 | 211 |
| 208 | 3300009147 | Ga0114129_10037806 | Ga0114129_100378064 | 211 |
| 209 | 3300009147 | Ga0114129_10223362 | Ga0114129_102233621 | 211 |
| 210 | 3300009147 | Ga0114129_10530866 | Ga0114129_105308661 | 211 |
| 211 | 3300009147 | Ga0114129_11600472 | Ga0114129_116004721 | 211 |
| 212 | 3300009148 | Ga0105243_10000583 | Ga0105243_1000058326 | 211 |
| 213 | 3300009174 | Ga0105241_10059707 | Ga0105241_100597072 | 211 |
| 214 | 3300009176 | Ga0105242_10003882 | Ga0105242_1000388213 | 211 |
| 215 | 3300009177 | Ga0105248_10012840 | Ga0105248_100128408 | 211 |
| 216 | 3300009177 | Ga0105248_10041798 | Ga0105248_100417986 | 211 |
| 217 | 3300009177 | Ga0105248_10539172 | Ga0105248_105391722 | 211 |
| 218 | 3300009545 | Ga0105237_10137006 | Ga0105237_101370062 | 211 |
| 219 | 3300009553 | Ga0105249_10195820 | Ga0105249_101958202 | 211 |
| 220 | 3300009553 | Ga0105249_10259769 | Ga0105249_102597691 | 211 |
| 221 | 3300010375 | Ga0105239_10614660 | Ga0105239_106146602 | 211 |
| 222 | 3300010375 | Ga0105239_10769853 | Ga0105239_107698532 | 211 |
| 223 | 3300011119 | Ga0105246_10029011 | Ga0105246_100290114 | 211 |
| 224 | 3300013102 | Ga0157371_10427135 | Ga0157371_104271351 | 211 |
| 225 | 3300013104 | Ga0157370_10086832 | Ga0157370_100868323 | 211 |
| 226 | 3300013104 | Ga0157370_10294498 | Ga0157370_102944982 | 211 |
| 227 | 3300013105 | Ga0157369_10469733 | Ga0157369_104697332 | 211 |
| 228 | 3300013296 | Ga0157374_10235234 | Ga0157374_102352343 | 211 |
| 229 | 3300013297 | Ga0157378_10002943 | Ga0157378_100029437 | 211 |
| 230 | 3300013297 | Ga0157378_10167866 | Ga0157378_101678663 | 211 |
| 231 | 3300013297 | Ga0157378_10999597 | Ga0157378_109995972 | 211 |
| 232 | 3300013306 | Ga0163162_10023911 | Ga0163162_100239112 | 211 |
| 233 | 3300013308 | Ga0157375_10075762 | Ga0157375_100757622 | 211 |
| 234 | 3300014325 | Ga0163163_10037746 | Ga0163163_100377463 | 211 |
| 235 | 3300014325 | Ga0163163_10134436 | Ga0163163_101344362 | 211 |
| 236 | 3300014326 | Ga0157380_10188852 | Ga0157380_101888522 | 211 |
| 237 | 3300014326 | Ga0157380_10255045 | Ga0157380_102550453 | 211 |
| 238 | 3300014968 | Ga0157379_10059470 | Ga0157379_100594703 | 211 |
| 239 | 3300014968 | Ga0157379_10143233 | Ga0157379_101432332 | 211 |
| 240 | 3300014969 | Ga0157376_10001972 | Ga0157376_1000197212 | 211 |
| 241 | 3300014969 | Ga0157376_10413954 | Ga0157376_104139542 | 211 |
| 242 | 3300017792 | Ga0163161_10504538 | Ga0163161_105045382 | 211 |
| 243 | 3300025901 | Ga0207688_10112226 | Ga0207688_101122262 | 211 |
| 244 | 3300025908 | Ga0207643_10007956 | Ga0207643_100079563 | 211 |
| 245 | 3300025910 | Ga0207684_10219127 | Ga0207684_102191273 | 211 |
| 246 | 3300025911 | Ga0207654_10291887 | Ga0207654_102918872 | 211 |
| 247 | 3300025912 | Ga0207707_10094747 | Ga0207707_100947472 | 211 |
| 248 | 3300025913 | Ga0207695_10367379 | Ga0207695_103673792 | 211 |
| 249 | 3300025913 | Ga0207695_10667298 | Ga0207695_106672981 | 211 |
| 250 | 3300025915 | Ga0207693_10483370 | Ga0207693_104833702 | 211 |
| 251 | 3300025916 | Ga0207663_10053592 | Ga0207663_100535923 | 211 |
| 252 | 3300025917 | Ga0207660_10002021 | Ga0207660_1000202114 | 211 |
| 253 | 3300025917 | Ga0207660_10123594 | Ga0207660_101235942 | 211 |
| 254 | 3300025918 | Ga0207662_10000050 | Ga0207662_1000005016 | 211 |
| 255 | 3300025921 | Ga0207652_10104896 | Ga0207652_101048962 | 211 |
| 256 | 3300025921 | Ga0207652_10249761 | Ga0207652_102497611 | 211 |
| 257 | 3300025922 | Ga0207646_10031789 | Ga0207646_100317893 | 211 |
| 258 | 3300025923 | Ga0207681_10510662 | Ga0207681_105106621 | 211 |
| 259 | 3300025927 | Ga0207687_10002282 | Ga0207687_1000228211 | 211 |
| 260 | 3300025927 | Ga0207687_10005719 | Ga0207687_100057198 | 211 |
| 261 | 3300025928 | Ga0207700_10084709 | Ga0207700_100847091 | 211 |
| 262 | 3300025929 | Ga0207664_10450903 | Ga0207664_104509032 | 211 |
| 263 | 3300025931 | Ga0207644_10718154 | Ga0207644_107181541 | 211 |
| 264 | 3300025932 | Ga0207690_10358947 | Ga0207690_103589471 | 211 |
| 265 | 3300025935 | Ga0207709_10001116 | Ga0207709_1000111611 | 211 |
| 266 | 3300025936 | Ga0207670_10005774 | Ga0207670_100057743 | 211 |
| 267 | 3300025938 | Ga0207704_10000431 | Ga0207704_1000043114 | 211 |
| 268 | 3300025939 | Ga0207665_10240954 | Ga0207665_102409542 | 211 |
| 269 | 3300025941 | Ga0207711_10026049 | Ga0207711_100260494 | 211 |
| 270 | 3300025941 | Ga0207711_10238400 | Ga0207711_102384002 | 211 |
| 271 | 3300025942 | Ga0207689_10002662 | Ga0207689_1000266213 | 211 |
| 272 | 3300025942 | Ga0207689_10321695 | Ga0207689_103216952 | 211 |
| 273 | 3300025944 | Ga0207661_10400799 | Ga0207661_104007992 | 211 |
| 274 | 3300025949 | Ga0207667_10106016 | Ga0207667_101060161 | 211 |
| 275 | 3300025949 | Ga0207667_10212501 | Ga0207667_102125012 | 211 |
| 276 | 3300025949 | Ga0207667_10672856 | Ga0207667_106728562 | 211 |
| 277 | 3300025960 | Ga0207651_10167719 | Ga0207651_101677191 | 211 |
| 278 | 3300025961 | Ga0207712_10002625 | Ga0207712_100026252 | 211 |
| 279 | 3300025981 | Ga0207640_10035267 | Ga0207640_100352674 | 211 |
| 280 | 3300026035 | Ga0207703_10600159 | Ga0207703_106001592 | 211 |
| 281 | 3300026041 | Ga0207639_10035656 | Ga0207639_100356563 | 211 |
| 282 | 3300026041 | Ga0207639_10205227 | Ga0207639_102052272 | 211 |
| 283 | 3300026075 | Ga0207708_10000375 | Ga0207708_1000037515 | 211 |
| 284 | 3300026078 | Ga0207702_10004664 | Ga0207702_1000466413 | 211 |
| 285 | 3300026078 | Ga0207702_10357172 | Ga0207702_103571722 | 211 |
| 286 | 3300026078 | Ga0207702_10423683 | Ga0207702_104236832 | 211 |
| 287 | 3300026088 | Ga0207641_10165657 | Ga0207641_101656572 | 211 |
| 288 | 3300026088 | Ga0207641_10746170 | Ga0207641_107461701 | 211 |
| 289 | 3300026089 | Ga0207648_10000663 | Ga0207648_1000066328 | 211 |
| 290 | 3300026118 | Ga0207675_100000454 | Ga0207675_10000045423 | 211 |
| 291 | 3300026118 | Ga0207675_101150102 | Ga0207675_1011501021 | 211 |
| 292 | 3300027907 | Ga0207428_10003019 | Ga0207428_100030192 | 211 |
| 293 | 3300027907 | Ga0207428_10011324 | Ga0207428_100113243 | 211 |
| 294 | 3300027907 | Ga0207428_10120703 | Ga0207428_101207031 | 211 |
| 295 | 3300028380 | Ga0268265_10001189 | Ga0268265_100011897 | 211 |
| 296 | 3300028381 | Ga0268264_10002258 | Ga0268264_100022587 | 211 |
| 297 | 3300028556 | Ga0265337_1056358 | Ga0265337_10563581 | 211 |
| 298 | 3300028573 | Ga0265334_10040985 | Ga0265334_100409852 | 211 |
| 299 | 3300028573 | Ga0265334_10077648 | Ga0265334_100776481 | 211 |
| 300 | 3300028653 | Ga0265323_10014730 | Ga0265323_100147303 | 211 |
| 301 | 3300028654 | Ga0265322_10072800 | Ga0265322_100728001 | 211 |
| 302 | 3300028666 | Ga0265336_10001353 | Ga0265336_100013539 | 211 |
| 303 | 3300028666 | Ga0265336_10018355 | Ga0265336_100183553 | 211 |
| 304 | 3300028800 | Ga0265338_10024630 | Ga0265338_100246303 | 211 |
| 305 | 3300028800 | Ga0265338_10058799 | Ga0265338_100587992 | 211 |
| 306 | 3300028800 | Ga0265338_10078097 | Ga0265338_100780973 | 211 |
| 307 | 3300028800 | Ga0265338_10391399 | Ga0265338_103913992 | 211 |
| 308 | 3300029957 | Ga0265324_10000006 | Ga0265324_100000069 | 211 |
| 309 | 3300029957 | Ga0265324_10001274 | Ga0265324_1000127411 | 211 |
| 310 | 3300031235 | Ga0265330_10187845 | Ga0265330_101878452 | 211 |
| 311 | 3300031239 | Ga0265328_10005997 | Ga0265328_100059972 | 211 |
| 312 | 3300031241 | Ga0265325_10000767 | Ga0265325_1000076710 | 211 |
| 313 | 3300031247 | Ga0265340_10122090 | Ga0265340_101220901 | 211 |
| 314 | 3300031250 | Ga0265331_10026866 | Ga0265331_100268663 | 211 |
| 315 | 3300031344 | Ga0265316_10054216 | Ga0265316_100542163 | 211 |
| 316 | 3300031507 | Ga0307509_10403004 | Ga0307509_104030042 | 211 |
| 317 | 3300031711 | Ga0265314_10004530 | Ga0265314_100045308 | 211 |
| 318 | 3300031711 | Ga0265314_10197385 | Ga0265314_101973852 | 211 |
| 319 | 3300031711 | Ga0265314_10264023 | Ga0265314_102640232 | 211 |
| 320 | 3300031712 | Ga0265342_10005610 | Ga0265342_100056105 | 211 |
| 321 | 3300031712 | Ga0265342_10009909 | Ga0265342_100099096 | 211 |
| 322 | 3300034816 | Ga0373930_0001188 | Ga0373930_0001188_367_1005 | 211 |
| 323 | 3300034816 | Ga0373930_0028237 | Ga0373930_0028237_411_1052 | 211 |
| 324 | 3300034957 | Ga0373938_0003154 | Ga0373938_0003154_1014_1652 | 211 |
| 325 | 3300035086 | Ga0373934_0007838 | Ga0373934_0007838_2012_2647 | 211 |
| 326 | 3300035089 | Ga0373944_0015791 | Ga0373944_0015791_1456_2100 | 211 |
| 327 | 3300035112 | Ga0373932_0026808 | Ga0373932_0026808_255_896 | 211 |
| 328 | 3300035120 | Ga0373957_0027242 | Ga0373957_0027242_756_1403 | 211 |
| 329 | 3300035121 | Ga0373960_0032661 | Ga0373960_0032661_44_685 | 211 |
| 330 | 3300035172 | Ga0373955_0014946 | Ga0373955_0014946_1228_1875 | 211 |
| 331 | 3300035172 | Ga0373955_0175439 | Ga0373955_0175439_385_1023 | 211 |
| 332 | 3300035410 | Ga0373924_0020673 | Ga0373924_0020673_796_1443 | 211 |
| 333 | 3300035691 | Ga0373931_0001986 | Ga0373931_0001986_6399_7037 | 211 |
| 334 | 3300035691 | Ga0373931_0004207 | Ga0373931_0004207_203_844 | 211 |
| 335 | 3300035692 | Ga0373935_0236273 | Ga0373935_0236273_542_1180 | 211 |
| 336 | 3300035695 | Ga0373927_0045469 | Ga0373927_0045469_939_1586 | 211 |
| 337 | 3300035724 | Ga0373933_0000974 | Ga0373933_0000974_3911_4558 | 211 |
| 338 | 3300035724 | Ga0373933_0052806 | Ga0373933_0052806_1404_2042 | 211 |
| 339 | 3300035724 | Ga0373933_0137047 | Ga0373933_0137047_111_749 | 211 |
| 340 | 3300035724 | Ga0373933_0212153 | Ga0373933_0212153_575_1216 | 211 |
| 341 | 3300036401 | Ga0373937_0000924 | Ga0373937_0000924_6181_6828 | 211 |
| 342 | 3300036401 | Ga0373937_0005804 | Ga0373937_0005804_2426_3064 | 211 |
| 343 | 3300036401 | Ga0373937_0041786 | Ga0373937_0041786_3072_3713 | 211 |
| 344 | 3300036401 | Ga0373937_0598309 | Ga0373937_0598309_86_727 | 211 |
| 345 | 3300037853 | Ga0436364_1089434 | Ga0436364_1089434_327_1022 | 211 |
| 346 | 3300039453 | Ga0436362_0187221 | Ga0436362_0187221_21_689 | 211 |
| 347 | 3300042876 | Ga0451577_0341339 | Ga0451577_0341339_299_937 | 211 |
| 348 | 3300044673 | Ga0453683_0012579 | Ga0453683_0012579_783_1472 | 211 |
| 349 | 3300044673 | Ga0453683_0111262 | Ga0453683_0111262_115_756 | 211 |
| 350 | 3300045051 | Ga0451576_0001630 | Ga0451576_0001630_30805_31491 | 211 |
| 351 | 3300045051 | Ga0451576_0006369 | Ga0451576_0006369_8499_9137 | 211 |
| 352 | 3300045051 | Ga0451576_0116154 | Ga0451576_0116154_1429_2070 | 211 |
| 353 | 3300045051 | Ga0451576_0222538 | Ga0451576_0222538_146_784 | 211 |
| 354 | 3300045051 | Ga0451576_0450212 | Ga0451576_0450212_195_836 | 211 |
| 355 | 3300045051 | Ga0451576_0932945 | Ga0451576_0932945_106_795 | 211 |
| 356 | 3300045051 | Ga0451576_1040521 | Ga0451576_1040521_19_657 | 211 |
| 357 | 3300046454 | Ga0495592_0039769 | Ga0495592_0039769_236_883 | 211 |
| 358 | 3300046459 | Ga0495629_0002047 | Ga0495629_0002047_2774_3421 | 211 |
| 359 | 3300046462 | Ga0495651_0000214 | Ga0495651_0000214_16131_16778 | 211 |
| 360 | 3300046463 | Ga0495653_0001647 | Ga0495653_0001647_3607_4254 | 211 |
| 361 | 3300046472 | Ga0495580_0347653 | Ga0495580_0347653_217_855 | 211 |
| 362 | 3300046476 | Ga0495662_0038562 | Ga0495662_0038562_351_998 | 211 |
| 363 | 3300046476 | Ga0495662_0053605 | Ga0495662_0053605_189_827 | 211 |
| 364 | 3300046477 | Ga0495664_0006909 | Ga0495664_0006909_57_704 | 211 |
| 365 | 3300046477 | Ga0495664_0011809 | Ga0495664_0011809_3354_3992 | 211 |
| 366 | 3300046499 | Ga0495594_0015299 | Ga0495594_0015299_2793_3431 | 211 |
| 367 | 3300046499 | Ga0495594_0376614 | Ga0495594_0376614_74_721 | 211 |
| 368 | 3300046511 | Ga0495608_0009530 | Ga0495608_0009530_1919_2566 | 211 |
| 369 | 3300046514 | Ga0495618_0000537 | Ga0495618_0000537_15910_16557 | 211 |
| 370 | 3300046514 | Ga0495618_0009614 | Ga0495618_0009614_1602_2240 | 211 |
| 371 | 3300046516 | Ga0495628_0030182 | Ga0495628_0030182_2627_3274 | 211 |
| 372 | 3300046517 | Ga0495630_0063234 | Ga0495630_0063234_1297_1944 | 211 |
| 373 | 3300046517 | Ga0495630_0475063 | Ga0495630_0475063_280_918 | 211 |
| 374 | 3300046529 | Ga0495652_0002479 | Ga0495652_0002479_2917_3564 | 211 |
| 375 | 3300046533 | Ga0495640_0007570 | Ga0495640_0007570_1065_1712 | 211 |
| 376 | 3300046533 | Ga0495640_0169488 | Ga0495640_0169488_227_865 | 211 |
| 377 | 3300046536 | Ga0495587_0000715 | Ga0495587_0000715_10320_10967 | 211 |
| 378 | 3300046543 | Ga0495645_0008358 | Ga0495645_0008358_3165_3812 | 211 |
| 379 | 3300046559 | Ga0495667_0047639 | Ga0495667_0047639_1935_2582 | 211 |
| 380 | 3300046642 | Ga0495634_0003492 | Ga0495634_0003492_9701_10348 | 211 |
| 381 | 3300046642 | Ga0495634_0089664 | Ga0495634_0089664_212_850 | 211 |
| 382 | 3300046642 | Ga0495634_0271576 | Ga0495634_0271576_125_763 | 211 |
| 383 | 3300046663 | Ga0495635_0000562 | Ga0495635_0000562_379_1026 | 211 |
| 384 | 3300046675 | Ga0495657_0109018 | Ga0495657_0109018_93_731 | 211 |
| 385 | 3300046678 | Ga0495599_0008513 | Ga0495599_0008513_1156_1803 | 211 |
| 386 | 3300046679 | Ga0495623_0001280 | Ga0495623_0001280_3013_3660 | 211 |
| 387 | 3300046679 | Ga0495623_0064891 | Ga0495623_0064891_37_675 | 211 |
| 388 | 3300046680 | Ga0495646_0002811 | Ga0495646_0002811_1387_2034 | 211 |
| 389 | 3300046681 | Ga0495647_0005582 | Ga0495647_0005582_3209_3847 | 211 |
| 390 | 3300046683 | Ga0495658_0013385 | Ga0495658_0013385_676_1314 | 211 |
| 391 | 3300046683 | Ga0495658_0016587 | Ga0495658_0016587_2155_2802 | 211 |
| 392 | 3300046689 | Ga0495613_0049700 | Ga0495613_0049700_1132_1779 | 211 |
| 393 | 3300046690 | Ga0495624_0210442 | Ga0495624_0210442_428_1066 | 211 |
| 394 | 3300046690 | Ga0495624_0243983 | Ga0495624_0243983_139_777 | 211 |
| 395 | 3300046809 | Ga0495600_0013786 | Ga0495600_0013786_2878_3525 | 211 |
| 396 | 3300046809 | Ga0495600_0383198 | Ga0495600_0383198_174_815 | 211 |
| 397 | 3300047315 | Ga0495581_0089301 | Ga0495581_0089301_1089_1736 | 211 |
| 398 | 3300047315 | Ga0495581_0178096 | Ga0495581_0178096_220_858 | 211 |
| 399 | 3300047317 | Ga0495604_0000382 | Ga0495604_0000382_27451_28098 | 211 |
| 400 | 3300047319 | Ga0495674_0003824 | Ga0495674_0003824_11926_12573 | 211 |
| 401 | 3300047319 | Ga0495674_0100098 | Ga0495674_0100098_1647_2285 | 211 |
| 402 | 3300047322 | Ga0495680_0001240 | Ga0495680_0001240_23326_23973 | 211 |
| 403 | 3300047444 | Ga0495675_0001812 | Ga0495675_0001812_9850_10497 | 211 |
| 404 | 3300047673 | Ga0495593_0057173 | Ga0495593_0057173_529_1176 | 211 |
| 405 | 3300048088 | Ga0495602_0001751 | Ga0495602_0001751_17996_18643 | 211 |
| 406 | 3300048088 | Ga0495602_0321645 | Ga0495602_0321645_141_782 | 211 |
| 407 | 3300048903 | Ga0496100_0456019 | Ga0496100_0456019_248_895 | 211 |
| 408 | 3300048909 | Ga0496106_0735135 | Ga0496106_0735135_46_693 | 211 |
| 409 | 3300048910 | Ga0496107_0288316 | Ga0496107_0288316_509_1204 | 211 |
| 410 | 3300048911 | Ga0496108_0416085 | Ga0496108_0416085_193_840 | 211 |
| 411 | 3300048912 | Ga0496109_0136610 | Ga0496109_0136610_1042_1737 | 211 |
| 412 | 3300048912 | Ga0496109_0877514 | Ga0496109_0877514_107_751 | 211 |
| 413 | 3300048917 | Ga0496114_0035068 | Ga0496114_0035068_391_1041 | 211 |
| 414 | 3300048918 | Ga0496115_0208839 | Ga0496115_0208839_192_839 | 211 |
| 415 | 3300049570 | Ga0501033_0005965 | Ga0501033_0005965_7483_8124 | 211 |
| 416 | 3300049570 | Ga0501033_0037825 | Ga0501033_0037825_1260_1901 | 211 |
| 417 | 3300049571 | Ga0501034_0495994 | Ga0501034_0495994_401_1048 | 211 |
| 418 | 3300049572 | Ga0501036_0002300 | Ga0501036_0002300_10044_10685 | 211 |
| 419 | 3300049573 | Ga0501037_0011409 | Ga0501037_0011409_523_1170 | 211 |
| 420 | 3300049573 | Ga0501037_0179566 | Ga0501037_0179566_737_1378 | 211 |
| 421 | 3300049574 | Ga0501038_0016769 | Ga0501038_0016769_1360_2001 | 211 |
| 422 | 3300049575 | Ga0501039_0009384 | Ga0501039_0009384_845_1486 | 211 |
| 423 | 3300049575 | Ga0501039_0753363 | Ga0501039_0753363_20_670 | 211 |
| 424 | 3300049576 | Ga0501040_0009441 | Ga0501040_0009441_5091_5732 | 211 |
| 425 | 3300049577 | Ga0501041_0001494 | Ga0501041_0001494_502_1143 | 211 |
| 426 | 3300049578 | Ga0501042_0001293 | Ga0501042_0001293_8955_9596 | 211 |
| 427 | 3300049579 | Ga0501043_0013889 | Ga0501043_0013889_4991_5632 | 211 |
| 428 | 3300049580 | Ga0501046_0005727 | Ga0501046_0005727_4433_5074 | 211 |
| 429 | 3300049581 | Ga0501047_0006762 | Ga0501047_0006762_4598_5245 | 211 |
| 430 | 3300049582 | Ga0501048_0055615 | Ga0501048_0055615_965_1606 | 211 |
| 431 | 3300049584 | Ga0501068_0053576 | Ga0501068_0053576_388_1029 | 211 |
| 432 | 3300049585 | Ga0501069_0041718 | Ga0501069_0041718_1386_2033 | 211 |
| 433 | 3300049586 | Ga0501070_0012341 | Ga0501070_0012341_5595_6242 | 211 |
| 434 | 3300049587 | Ga0501071_0007128 | Ga0501071_0007128_2551_3198 | 211 |
| 435 | 3300049587 | Ga0501071_0031340 | Ga0501071_0031340_2152_2793 | 211 |
| 436 | 3300049587 | Ga0501071_0344349 | Ga0501071_0344349_415_1053 | 211 |
| 437 | 3300049588 | Ga0501072_0001780 | Ga0501072_0001780_4215_4856 | 211 |
| 438 | 3300049588 | Ga0501072_0261055 | Ga0501072_0261055_612_1262 | 211 |
| 439 | 3300049589 | Ga0501073_0028416 | Ga0501073_0028416_647_1294 | 211 |
| 440 | 3300049590 | Ga0501074_0006854 | Ga0501074_0006854_7160_7807 | 211 |
| 441 | 3300049590 | Ga0501074_0023638 | Ga0501074_0023638_3423_4064 | 211 |
| 442 | 3300049591 | Ga0501075_0039172 | Ga0501075_0039172_1233_1874 | 211 |
| 443 | 3300049592 | Ga0501076_0001146 | Ga0501076_0001146_11762_12403 | 211 |
| 444 | 3300049592 | Ga0501076_0297000 | Ga0501076_0297000_222_869 | 211 |
| 445 | 3300049593 | Ga0501077_0003582 | Ga0501077_0003582_4964_5605 | 211 |
| 446 | 3300049741 | Ga0501079_0002542 | Ga0501079_0002542_10227_10868 | 211 |
| 447 | 3300049741 | Ga0501079_0441980 | Ga0501079_0441980_219_863 | 211 |
| 448 | 3300049742 | Ga0501080_0236289 | Ga0501080_0236289_742_1389 | 211 |
| 449 | 3300049743 | Ga0501081_0000579 | Ga0501081_0000579_11359_12000 | 211 |
| 450 | 3300049822 | Ga0501035_0081117 | Ga0501035_0081117_608_1255 | 211 |
| 451 | 3300049822 | Ga0501035_0082106 | Ga0501035_0082106_664_1305 | 211 |
| 452 | 3300049823 | Ga0501044_0015384 | Ga0501044_0015384_5090_5737 | 211 |
| 453 | 3300050493 | nmdc:mga0k408_108228_c1 | nmdc:mga0k408_108228_c1_408_1052 | 211 |
| 454 | 3300050507 | nmdc:mga05p37_1129375_c1 | nmdc:mga05p37_1129375_c1_81_746 | 211 |
| 455 | 3300050507 | nmdc:mga05p37_138229_c1 | nmdc:mga05p37_138229_c1_1076_1714 | 211 |
| 456 | 3300050507 | nmdc:mga05p37_1657_c2 | nmdc:mga05p37_1657_c2_8327_8971 | 211 |
| 457 | 3300050507 | nmdc:mga05p37_3701_c1 | nmdc:mga05p37_3701_c1_1296_1934 | 211 |
| 458 | 3300050507 | nmdc:mga05p37_450319_c1 | nmdc:mga05p37_450319_c1_531_1169 | 211 |
| 459 | 3300050507 | nmdc:mga05p37_912149_c1 | nmdc:mga05p37_912149_c1_199_840 | 211 |
| 460 | 3300050508 | nmdc:mga09592_199016_c1 | nmdc:mga09592_199016_c1_1060_1701 | 211 |
| 461 | 3300050508 | nmdc:mga09592_2089_c1 | nmdc:mga09592_2089_c1_5722_6360 | 211 |
| 462 | 3300050509 | nmdc:mga0qj67_164083_c1 | nmdc:mga0qj67_164083_c1_801_1439 | 211 |
| 463 | 3300050509 | nmdc:mga0qj67_51159_c1 | nmdc:mga0qj67_51159_c1_954_1592 | 211 |
| 464 | 3300050510 | nmdc:mga06r32_254234_c1 | nmdc:mga06r32_254234_c1_212_850 | 211 |
| 465 | 3300050510 | nmdc:mga06r32_27446_c1 | nmdc:mga06r32_27446_c1_1801_2445 | 211 |
| 466 | 3300050510 | nmdc:mga06r32_840285_c1 | nmdc:mga06r32_840285_c1_70_714 | 211 |
| 467 | 3300050511 | nmdc:mga08y16_235687_c1 | nmdc:mga08y16_235687_c1_1028_1666 | 211 |
| 468 | 3300050511 | nmdc:mga08y16_59357_c1 | nmdc:mga08y16_59357_c1_25_666 | 211 |
| 469 | 3300050512 | nmdc:mga0n895_205287_c1 | nmdc:mga0n895_205287_c1_24_662 | 211 |
| 470 | 3300050512 | nmdc:mga0n895_43173_c2 | nmdc:mga0n895_43173_c2_538_1176 | 211 |
| 471 | 3300050512 | nmdc:mga0n895_93081_c1 | nmdc:mga0n895_93081_c1_2172_2816 | 211 |
| 472 | 3300050513 | nmdc:mga0rr50_231521_c1 | nmdc:mga0rr50_231521_c1_192_830 | 211 |
| 473 | 3300050513 | nmdc:mga0rr50_82541_c1 | nmdc:mga0rr50_82541_c1_1623_2267 | 211 |
| 474 | 3300050514 | nmdc:mga08x19_2511_c1 | nmdc:mga08x19_2511_c1_8019_8663 | 211 |
| 475 | 3300050515 | nmdc:mga0a205_239550_c1 | nmdc:mga0a205_239550_c1_965_1606 | 211 |
| 476 | 3300050515 | nmdc:mga0a205_24210_c1 | nmdc:mga0a205_24210_c1_1974_2615 | 211 |
| 477 | 3300050515 | nmdc:mga0a205_29218_c1 | nmdc:mga0a205_29218_c1_1850_2494 | 211 |
| 478 | 3300050515 | nmdc:mga0a205_413836_c1 | nmdc:mga0a205_413836_c1_126_764 | 211 |
| 479 | 3300050515 | nmdc:mga0a205_760677_c1 | nmdc:mga0a205_760677_c1_14_658 | 211 |
| 480 | 3300050515 | nmdc:mga0a205_98374_c1 | nmdc:mga0a205_98374_c1_1716_2354 | 211 |
| 481 | 3300053077 | Ga0495601_0026105 | Ga0495601_0026105_2174_2812 | 211 |
| 482 | 3300053078 | Ga0495612_0001450 | Ga0495612_0001450_2826_3473 | 211 |
| 483 | 3300053084 | Ga0495595_0003038 | Ga0495595_0003038_4134_4781 | 211 |
| 484 | 3300053084 | Ga0495595_0255860 | Ga0495595_0255860_120_758 | 211 |
| 485 | 3300053085 | Ga0495619_0003346 | Ga0495619_0003346_6572_7219 | 211 |
| 486 | 3300053733 | Ga0500552_030087 | Ga0500552_030087_164_811 | 211 |
| 487 | 3300054114 | Ga0501084_0015970 | Ga0501084_0015970_4278_4919 | 211 |
| 488 | 3300054114 | Ga0501084_0218208 | Ga0501084_0218208_66_710 | 211 |
| 489 | 3300059421 | Ga0590071_000266 | Ga0590071_000266_11134_11784 | 211 |
| 490 | 3300059423 | Ga0590074_000639 | Ga0590074_000639_356_1006 | 211 |
| 491 | 3300059424 | Ga0590075_000189 | Ga0590075_000189_3350_4000 | 211 |
| 492 | 3300059426 | Ga0590077_000037 | Ga0590077_000037_19026_19676 | 211 |
| 493 | 3300060353 | Ga0501082_0018016 | Ga0501082_0018016_1313_1954 | 211 |
| 494 | 3300061734 | Ga0530510_0016366 | Ga0530510_0016366_1642_2283 | 211 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ici-assembly1.cif.gz_A | crystal structure of human mical3 | 0.9896 | 2 | 31 |
| 4j36-assembly2.cif.gz_B | cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) | 0.9855 | 2 | 28 |
| 4j33-assembly1.cif.gz_A | crystal structure of kynurenine 3-monooxygenase (kmo-394) | 0.9852 | 2 | 30 |
| 3ka7-assembly1.cif.gz_A | crystal structure of an oxidoreductase from methanosarcina mazei. northeast structural genomics consortium target id mar208 | 0.9833 | 1 | 31 |
| 5x6r-assembly1.cif.gz_A | crystal structure of saccharomyces cerevisiae kmo in complex with ro 61-8048 | 0.9775 | 2 | 30 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4j36B00 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9855 | 2 | 28 | 3.50.50.60 |
| af_A4HWA7_1_176_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9779 | 2 | 30 | 3.50.50.60 |
| 4k7zA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.972 | 2 | 32 | 3.50.50.60 |
| af_O15229_1_369_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9695 | 2 | 30 | 3.50.50.60 |
| 3i3lA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.968 | 2 | 32 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N1T0K2-F1-model_v4 | deleted | 0.9914 | 1 | 211 |
|
| AF-A0A1G3IN80-F1-model_v4 | DNA-binding protein | 0.9898 | 1 | 189 |
GO:0003677
|
| AF-A0A2P1QY54-F1-model_v4 | NADP oxidoreductase coenzyme F420-dependent | 0.9879 | 2 | 211 |
|
| AF-A0A2N1T0K2-F1-model_v4 | deleted | 0.9867 | 1 | 211 |
|
| AF-M6X3P1-F1-model_v4 | deleted | 0.9838 | 44 | 211 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar