metagRoot

F454575

General Info

Members	Datasets	Scaffolds	Average Seq Length
494	281	465	211

Family's Representative Sequence

Representative Sequence	3300014497\|Ga0182008_10315792\|Ga0182008_103157921
Length	235
Sequence	MSDTIGIADISNISDTSRIEGIAAALPTPNLDTDQIMPKQFLRGIDKTGLDQGLLYDLRHDADHRLRPDFVLNQSAYQGASIIVAGSNFGCGSSREHAVWGLQQFGIRAVIAPSFGEIFYSNAMNNRLLLVMLPETDVQRIIEDVSDPLASKVLIDVNSMTVRSRSVEAAFSLSARHRRMFLEGLDVIGATLSLQDEISAFQQQHWQRRPWLHDIAHATRARINASSPAKPSGNR

Samples

	Sample ID	Description	Type	Environment
1	2511231003	Herbaspirillum sp. CF444	Isolate	Rhizosphere
2	2599185178	Ralstonia sp. NFACC01	Isolate	Rhizoplane
3	2599185292	Achromobacter sp. NFACC18-2	Isolate	Rhizoplane
4	2599185302	Pseudomonas sp. NFACC43	Isolate	Rhizoplane
5	2599185304	Pseudomonas sp. NFACC47-1	Isolate	Rhizoplane
6	2738541281	Methylobacterium sp. GV094	Isolate	Unclassified
7	2738541296	Paraburkholderia sp. GV073	Isolate	Unclassified
8	2738541298	Paraburkholderia sp. GV068	Isolate	Unclassified
9	2738541306	Paraburkholderia sp. GV052	Isolate	Unclassified
10	2738541337	Pelomonas sp. BT06	Isolate	Unclassified
11	2738543002	Paraburkholderia sp. GV072	Isolate	Unclassified
12	2738543008	Paraburkholderia sp. GV060	Isolate	Unclassified
13	2738543032	Methylobacterium sp. GV104	Isolate	Unclassified
14	2791355520	Pseudomonas sp. s211(2017)	Isolate	Unclassified
15	2818991445	Herbaspirillum hiltneri 3195	Isolate	Unclassified
16	2818991449	Herbaspirillum huttiense 1147	Isolate	Unclassified
17	2821443989	Inquilinus ginsengisoli 584	Isolate	Unclassified
18	2831864461	Roseateles noduli HZ7	Isolate	Nodule
19	2834641062	Cupriavidus gilardii JZ4	Isolate	Unclassified
20	2886848708	Mitsuaria sp. TWR114	Isolate	Rhizosphere
21	2887375801	Parapusillimonas sp. SGNA-6	Isolate	Rhizosphere
22	2900577576	Ralstonia sp. TCR112	Isolate	Rhizosphere
23	2901300506	Cupriavidus sp. UYMSc13B	Isolate	Unclassified
24	2909042592	Labrys sp. LIt4	Isolate	Nodule
25	2928058823	Ralstonia sp. 1138	Isolate	Unclassified
26	2945934425	Paraburkholderia graminis W1I13	Isolate	Rhizosphere
27	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
28	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
29	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
30	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
31	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
32	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
33	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
34	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
35	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
36	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
37	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
38	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
39	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
40	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
41	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
42	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
43	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
44	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
45	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
46	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
47	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
48	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
49	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
50	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
51	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
52	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
53	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
54	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
55	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
56	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
57	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
58	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
59	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
60	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
61	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
62	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
63	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
64	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
65	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
66	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
67	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
68	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
69	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
70	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
71	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
72	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
73	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
74	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
75	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
76	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
77	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
78	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
79	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
80	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
81	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
82	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
83	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
84	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
85	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
86	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
87	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
88	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
89	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
90	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
91	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
92	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
93	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
94	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
95	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
96	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
97	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
98	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
99	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
100	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
101	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
102	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
103	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
104	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
105	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
106	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
107	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
108	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
109	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
110	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
111	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
112	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
113	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
114	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
115	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
116	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
117	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
118	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
119	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
120	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
121	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
122	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
123	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
124	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
125	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
126	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
127	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
128	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
129	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
130	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
131	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
132	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
133	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
154	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
155	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
156	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
157	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
158	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
159	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
160	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
161	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
162	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
163	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
164	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
165	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
166	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
167	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
168	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
169	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
170	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
171	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
172	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
173	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
174	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
175	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
176	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
177	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
178	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
179	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
180	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
181	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
182	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
183	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
184	3300044659	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E	Metagenome	Unclassified
185	3300044666	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E	Metagenome	Unclassified
186	3300044672	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E	Metagenome	Unclassified
187	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
188	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
189	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
190	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
191	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
192	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
193	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
194	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
195	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
196	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
197	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
198	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
199	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
200	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
201	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
202	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
203	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
204	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
205	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
206	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
207	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
208	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
209	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
210	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
211	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
212	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
213	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
214	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
215	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
216	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
217	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
218	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
219	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
220	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
221	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
222	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
223	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
224	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
225	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
226	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
227	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
228	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
229	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
230	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
231	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
232	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
233	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
234	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
235	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
236	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
237	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
238	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
239	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
240	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
241	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
242	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
243	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
244	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
245	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
246	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
247	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
248	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
249	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
250	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
251	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
252	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
253	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
254	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
255	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
256	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
257	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
258	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
259	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
260	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
261	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
262	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
263	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
264	3300049766	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought	Metagenome	Rhizosphere
265	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
266	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
267	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
268	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
269	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
270	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
271	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
272	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
273	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
274	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
275	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
276	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
277	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
278	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
279	641736151	Paraburkholderia graminis C4D1M	Isolate	Rhizoplane
280	643348564	Methylobacterium nodulans ORS 2060	Isolate	Nodule
281	8003400568	Cupriavidus gilardii USM5	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	93.93
Metatranscriptomes	0.2
Isolates	5.87

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	25.71
Nodule	1.01
Rhizoplane	1.42
Rhizosphere	57.89
Stem	0
Stem Tuber	0
Unclassified	13.97

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24741J21665_1000056	3300001915	Bacteria	27413
2	JGI24740J21852_10000472	3300001979	Bacteria	17311
3	JGI24740J21852_10000969	3300001979	Bacteria	12785
4	JGI24739J22299_10001406	3300001989	Bacteria	9065
5	JGI24735J21928_10003222	3300002067	Bacteria	5578
6	JGI25155J39150_1000096	3300002704	Bacteria	49227
7	JGI25155J39150_1000135	3300002704	Bacteria	34998
8	JGI25156J39149_1000274	3300002705	Bacteria	35007
9	JGI25156J39149_1008194	3300002705	Bacteria	2658
10	JGI25156J39149_1010258	3300002705	Bacteria	2213
11	JGI25154J39366_1000129	3300002738	Bacteria	59399
12	JGI25154J39366_1000146	3300002738	Bacteria	55646
13	JGI25154J39366_1000248	3300002738	Bacteria	34998
14	JGI25157J39369_1000225	3300002741	Bacteria	44469
15	JGI25159J45721_1001971	3300002987	Bacteria	8179
16	JGI25151J46595_10001449	3300003187	Bacteria	16081
17	JGI25151J46595_10013163	3300003187	Bacteria	3732
18	JGI25151J46595_10024749	3300003187	Bacteria	2453
19	JGI25153J46596_10020082	3300003215	Bacteria	2536
20	rootH2_10037016	3300003320	Bacteria	4604
21	rootL2_10001457	3300003322	Bacteria	117785
22	rootH1_10020269	3300003323	Bacteria	14185
23	rootH1_10148185	3300003323	Bacteria	2248
24	Ga0055538_1000059	3300003751	Bacteria	112508
25	Ga0055539_1000034	3300003752	Bacteria	223400
26	Ga0055539_1000089	3300003752	Bacteria	112508
27	Ga0055533_1000098	3300003756	Bacteria	112508
28	Ga0055533_1001791	3300003756	Bacteria	5412
29	Ga0055532_1000002	3300003758	Bacteria	576000
30	Ga0055532_1000015	3300003758	Bacteria	340197
31	Ga0055525_1000130	3300003759	Bacteria	112508
32	Ga0055525_1000285	3300003759	Bacteria	46348
33	Ga0055527_1001388	3300003760	Bacteria	5144
34	Ga0055542_1000724	3300003762	Bacteria	25809
35	Ga0055529_1000028	3300003763	Bacteria	287650
36	Ga0055526_1000917	3300003771	Bacteria	21919
37	Ga0055526_1002371	3300003771	Bacteria	12763
38	Ga0055526_1002634	3300003771	Bacteria	11990
39	Ga0055526_1008492	3300003771	Bacteria	5117
40	Ga0055526_1013063	3300003771	Bacteria	3550
41	Ga0055537_1005786	3300003773	Bacteria	3248
42	Ga0055524_1000310	3300003775	Bacteria	46341
43	Ga0055524_1000557	3300003775	Bacteria	28144
44	Ga0055536_1000031	3300003781	Bacteria	151112
45	Ga0055534_1001179	3300003784	Bacteria	10987
46	Ga0055534_1011103	3300003784	Bacteria	1848
47	Ga0055530_10000039	3300003791	Bacteria	115587
48	Ga0055540_1044499	3300003792	Bacteria	942
49	Ga0055531_10003703	3300003794	Bacteria	9618
50	Ga0055541_1000061	3300003841	Bacteria	112508
51	Ga0055541_1000327	3300003841	Bacteria	15408
52	Ga0055543_1004116	3300004625	Bacteria	4054
53	Ga0055543_1007411	3300004625	Bacteria	2539
54	Ga0055543_1014303	3300004625	Bacteria	1549
55	Ga0065165_1000007	3300005262	Bacteria	337871
56	Ga0065165_1000170	3300005262	Bacteria	115389
57	Ga0065165_1000950	3300005262	Bacteria	36689
58	Ga0065165_1000951	3300005262	Bacteria	36549
59	Ga0070658_10365950	3300005327	Bacteria	1235
60	Ga0070670_100724611	3300005331	Bacteria	895
61	Ga0070680_100084521	3300005336	Bacteria	2621
62	Ga0070682_100072227	3300005337	Bacteria	2211
63	Ga0070661_100000063	3300005344	Bacteria	85407
64	Ga0070669_100514187	3300005353	Bacteria	995
65	Ga0070659_100002495	3300005366	Bacteria	13070
66	Ga0070663_100000006	3300005455	Bacteria	208068
67	Ga0070681_10052839	3300005458	Bacteria	4052
68	Ga0070679_100114848	3300005530	Bacteria	2678
69	Ga0068853_100001980	3300005539	Bacteria	15101
70	Ga0068853_100133720	3300005539	Bacteria	2222
71	Ga0068855_100242651	3300005563	Bacteria	2012
72	Ga0070664_100000002	3300005564	Bacteria	458815
73	Ga0068857_100016053	3300005577	Bacteria	6561
74	Ga0068854_100000093	3300005578	Bacteria	63395
75	Ga0068856_100000028	3300005614	Bacteria	131498
76	Ga0068856_100448500	3300005614	Bacteria	1311
77	Ga0068856_100715232	3300005614	Bacteria	1022
78	Ga0070702_100566021	3300005615	Bacteria	846
79	Ga0068852_100973083	3300005616	Bacteria	867
80	Ga0070717_10001896	3300006028	Bacteria	14628
81	Ga0070717_10208306	3300006028	Bacteria	1715
82	Ga0075365_10035446	3300006038	Bacteria	3228
83	Ga0075364_10019655	3300006051	Bacteria	4240
84	Ga0075364_10103295	3300006051	Bacteria	1898
85	Ga0075364_10413323	3300006051	Bacteria	921
86	Ga0075367_10139219	3300006178	Bacteria	1503
87	Ga0075366_10015095	3300006195	Bacteria	4419
88	Ga0075366_10027013	3300006195	Bacteria	3366
89	Ga0075430_100154152	3300006846	Bacteria	1913
90	Ga0075429_100004508	3300006880	Bacteria	11984
91	Ga0099824_1052383	3300006942	Bacteria	737
92	Ga0099823_1000176	3300006944	Bacteria	35142
93	Ga0105251_10000032	3300009011	Bacteria	120825
94	Ga0105250_10000241	3300009092	Bacteria	45446
95	Ga0105240_10001507	3300009093	Bacteria	39670
96	Ga0105240_10003721	3300009093	Bacteria	23562
97	Ga0105240_10007856	3300009093	Bacteria	15393
98	Ga0105240_10034772	3300009093	Bacteria	6497
99	Ga0105245_10775263	3300009098	Bacteria	996
100	Ga0105241_10124890	3300009174	Bacteria	2077
101	Ga0105238_10257564	3300009551	Bacteria	1724
102	Ga0105238_10420570	3300009551	Bacteria	1331
103	Ga0105238_10446268	3300009551	Bacteria	1290
104	Ga0105238_10653355	3300009551	Bacteria	1062
105	Ga0105239_10000164	3300010375	Bacteria	95286
106	Ga0157319_1000003	3300012497	Bacteria	397199
107	Ga0157373_10003150	3300013100	Bacteria	12461
108	Ga0157371_10000123	3300013102	Bacteria	118119
109	Ga0157370_10000013	3300013104	Bacteria	198861
110	Ga0157369_10001233	3300013105	Bacteria	31886
111	Ga0157374_10021590	3300013296	Bacteria	5732
112	Ga0157374_11132978	3300013296	Bacteria	803
113	Ga0182008_10024918	3300014497	Bacteria	3042
114	Ga0182008_10046782	3300014497	Bacteria	2150
115	Ga0182008_10315792	3300014497	Bacteria	821
116	Ga0157379_10539055	3300014968	Bacteria	1085
117	Ga0182006_1000825	3300015261	Bacteria	20755
118	Ga0182006_1031139	3300015261	Bacteria	2152
119	Ga0154015_1060010	3300020610	Bacteria	7487
120	Ga0213872_10003175	3300021361	Bacteria	9221
121	Ga0213872_10008282	3300021361	Bacteria	5036
122	Ga0213872_10044591	3300021361	Bacteria	2018
123	Ga0209435_100021	3300025206	Bacteria	223961
124	Ga0209435_100057	3300025206	Bacteria	82390
125	Ga0209784_100003	3300025224	Bacteria	1379451
126	Ga0209784_100018	3300025224	Bacteria	456816
127	Ga0209784_100605	3300025224	Bacteria	11539
128	Ga0209784_101097	3300025224	Bacteria	4506
129	Ga0209566_100002	3300025225	Bacteria	2614868
130	Ga0209566_100016	3300025225	Bacteria	456824
131	Ga0209566_100639	3300025225	Bacteria	21283
132	Ga0209566_101900	3300025225	Bacteria	4630
133	Ga0209674_100008	3300025226	Bacteria	1076909
134	Ga0209674_100030	3300025226	Bacteria	456824
135	Ga0209674_100135	3300025226	Bacteria	113826
136	Ga0209674_105961	3300025226	Bacteria	1724
137	Ga0209672_101335	3300025228	Bacteria	9350
138	Ga0209147_100002	3300025229	Bacteria	2158988
139	Ga0209147_100004	3300025229	Bacteria	1371850
140	Ga0209563_100004	3300025230	Bacteria	1814108
141	Ga0209563_100034	3300025230	Bacteria	456824
142	Ga0207427_100551	3300025231	Bacteria	19055
143	Ga0209258_100002	3300025242	Bacteria	2158988
144	Ga0209258_100083	3300025242	Bacteria	246008
145	Ga0209646_1000027	3300025246	Bacteria	395141
146	Ga0209646_1000061	3300025246	Bacteria	255495
147	Ga0209646_1000074	3300025246	Bacteria	223961
148	Ga0209026_1000058	3300025250	Bacteria	228656
149	Ga0209026_1000462	3300025250	Bacteria	31297
150	Ga0209026_1003042	3300025250	Bacteria	5766
151	Ga0209677_100009	3300025253	Bacteria	749530
152	Ga0209677_100019	3300025253	Bacteria	456824
153	Ga0209677_104663	3300025253	Bacteria	3871
154	Ga0209148_1000019	3300025254	Bacteria	748518
155	Ga0209148_1013294	3300025254	Bacteria	1484
156	Ga0209759_1000046	3300025256	Bacteria	230149
157	Ga0209759_1000371	3300025256	Bacteria	56139
158	Ga0209759_1001486	3300025256	Bacteria	13022
159	Ga0209759_1006799	3300025256	Bacteria	3790
160	Ga0209759_1008760	3300025256	Bacteria	3125
161	Ga0209565_1000374	3300025263	Bacteria	38256
162	Ga0209565_1019667	3300025263	Bacteria	1438
163	Ga0209455_1000021	3300025272	Bacteria	699993
164	Ga0209673_1009477	3300025273	Bacteria	4210
165	Ga0209673_1053365	3300025273	Bacteria	1055
166	Ga0209130_1000047	3300025284	Bacteria	234691
167	Ga0209130_1000116	3300025284	Bacteria	129549
168	Ga0209130_1001008	3300025284	Bacteria	21864
169	Ga0209130_1017285	3300025284	Bacteria	1722
170	Ga0209675_1000231	3300025291	Bacteria	56755
171	Ga0209675_1000557	3300025291	Bacteria	27014
172	Ga0209675_1004819	3300025291	Bacteria	5853
173	Ga0209675_1035446	3300025291	Bacteria	1137
174	Ga0209676_1000036	3300025292	Bacteria	457623
175	Ga0209676_1003002	3300025292	Bacteria	10969
176	Ga0209025_1000345	3300025294	Bacteria	100876
177	Ga0209025_1000371	3300025294	Bacteria	94612
178	Ga0209025_1001077	3300025294	Bacteria	39567
179	Ga0209564_1000003	3300025295	Bacteria	1585848
180	Ga0209564_1000878	3300025295	Bacteria	39964
181	Ga0209564_1001207	3300025295	Bacteria	29501
182	Ga0209564_1001260	3300025295	Bacteria	27874
183	Ga0209564_1013356	3300025295	Bacteria	3497
184	Ga0209758_1000885	3300025297	Bacteria	41066
185	Ga0209758_1044704	3300025297	Bacteria	1615
186	Ga0209050_1000073	3300025298	Bacteria	292046
187	Ga0209050_1008757	3300025298	Bacteria	5324
188	Ga0209050_1009014	3300025298	Bacteria	5196
189	Ga0209050_1058260	3300025298	Bacteria	929
190	Ga0209256_1000061	3300025299	Bacteria	260890
191	Ga0209256_1000150	3300025299	Bacteria	146086
192	Ga0209256_1000846	3300025299	Bacteria	38261
193	Ga0209256_1024631	3300025299	Bacteria	1768
194	Ga0207426_1023407	3300025302	Bacteria	2108
195	Ga0207426_1063916	3300025302	Bacteria	1048
196	Ga0209051_1065246	3300025303	Bacteria	1124
197	Ga0209257_1000099	3300025304	Bacteria	255304
198	Ga0209257_1000318	3300025304	Bacteria	101186
199	Ga0209257_1017235	3300025304	Bacteria	2860
200	Ga0207696_1000363	3300025711	Bacteria	45454
201	Ga0207713_1000020	3300025735	Bacteria	359258
202	Ga0207699_10480746	3300025906	Bacteria	894
203	Ga0207654_10217616	3300025911	Bacteria	1265
204	Ga0207707_10046024	3300025912	Bacteria	3800
205	Ga0207695_10000437	3300025913	Bacteria	91491
206	Ga0207695_10004043	3300025913	Bacteria	20183
207	Ga0207695_10031413	3300025913	Bacteria	5824
208	Ga0207695_10039598	3300025913	Bacteria	5065
209	Ga0207660_10082493	3300025917	Bacteria	2365
210	Ga0207657_10227990	3300025919	Bacteria	1491
211	Ga0207652_10188094	3300025921	Bacteria	1857
212	Ga0207681_10509892	3300025923	Bacteria	986
213	Ga0207650_10794462	3300025925	Bacteria	802
214	Ga0207690_10003536	3300025932	Bacteria	9310
215	Ga0207679_10000001	3300025945	Bacteria	777444
216	Ga0207640_10000113	3300025981	Bacteria	60850
217	Ga0207639_10009334	3300026041	Bacteria	6765
218	Ga0207639_10061581	3300026041	Bacteria	2899
219	Ga0207678_10000001	3300026067	Bacteria	433184
220	Ga0207678_10336928	3300026067	Bacteria	1299
221	Ga0207702_10000009	3300026078	Bacteria	305906
222	Ga0207702_10243162	3300026078	Bacteria	1687
223	Ga0207702_11108935	3300026078	Bacteria	785
224	Ga0207674_10001809	3300026116	Bacteria	27292
225	Ga0207698_10605455	3300026142	Bacteria	1081
226	Ga0209371_1016267	3300027312	Bacteria	1969
227	Ga0265334_10011529	3300028573	Bacteria	3720
228	Ga0265318_10055555	3300028577	Bacteria	1481
229	Ga0265336_10011731	3300028666	Bacteria	2968
230	Ga0307515_10005239	3300028794	Bacteria	26356
231	Ga0307515_10006245	3300028794	Bacteria	23915
232	Ga0265338_10130778	3300028800	Bacteria	1982
233	Ga0265338_10326192	3300028800	Bacteria	1110
234	Ga0268256_1018079	3300030500	Bacteria	1969
235	Ga0265330_10000123	3300031235	Bacteria	63356
236	Ga0265332_10019026	3300031238	Bacteria	3032
237	Ga0265328_10009371	3300031239	Bacteria	3990
238	Ga0265320_10009485	3300031240	Bacteria	5867
239	Ga0265325_10075417	3300031241	Bacteria	1684
240	Ga0265329_10014101	3300031242	Bacteria	2829
241	Ga0265340_10004286	3300031247	Bacteria	7998
242	Ga0265340_10049319	3300031247	Bacteria	2045
243	Ga0265339_10007645	3300031249	Bacteria	6959
244	Ga0265331_10013355	3300031250	Bacteria	4420
245	Ga0265331_10041723	3300031250	Bacteria	2229
246	Ga0265316_10006591	3300031344	Bacteria	11068
247	Ga0265316_10028078	3300031344	Bacteria	4646
248	Ga0307513_10103580	3300031456	Bacteria	2861
249	Ga0307513_10436067	3300031456	Bacteria	1037
250	Ga0265313_10005125	3300031595	Bacteria	9757
251	Ga0265313_10061021	3300031595	Bacteria	1766
252	Ga0307514_10001051	3300031649	Bacteria	39603
253	Ga0307514_10003111	3300031649	Bacteria	16325
254	Ga0265314_10001814	3300031711	Bacteria	23024
255	Ga0265342_10008363	3300031712	Bacteria	7427
256	Ga0265342_10012811	3300031712	Bacteria	5660
257	Ga0307412_10505949	3300031911	Bacteria	1006
258	Ga0307510_10169582	3300033180	Bacteria	1764
259	Ga0395899_0000598	3300037312	Bacteria	37911
260	Ga0395899_0129385	3300037312	Bacteria	1804
261	Ga0395900_0003747	3300037418	Bacteria	16332
262	Ga0395900_0058275	3300037418	Bacteria	3976
263	Ga0395905_0255252	3300037471	Bacteria	1638
264	Ga0395905_0769692	3300037471	Bacteria	865
265	Ga0395901_0705967	3300038443	Bacteria	1006
266	Ga0436361_0459515	3300039447	Bacteria	8317
267	Ga0436361_0674317	3300039447	Bacteria	1257
268	Ga0436361_0755803	3300039447	Bacteria	16014
269	Ga0436361_0988282	3300039447	Bacteria	919
270	Ga0436361_1185595	3300039447	Bacteria	3727
271	Ga0439459_0000524	3300042438	Bacteria	5062
272	Ga0466969_0001355	3300044656	Bacteria	13213
273	Ga0466969_0030196	3300044656	Bacteria	2762
274	Ga0466969_0063323	3300044656	Bacteria	1793
275	Ga0466972_0000262	3300044658	Bacteria	34359
276	Ga0466972_0066469	3300044658	Bacteria	1723
277	Ga0466972_0117040	3300044658	Bacteria	1257
278	Ga0466973_0021554	3300044659	Bacteria	6168
279	Ga0466977_0142860	3300044666	Bacteria	1555
280	Ga0466982_0009788	3300044672	Bacteria	4934
281	Ga0466965_0007291	3300044683	Bacteria	5071
282	Ga0466965_0028094	3300044683	Bacteria	2731
283	Ga0466965_0049862	3300044683	Bacteria	2075
284	Ga0466965_0064687	3300044683	Bacteria	1831
285	Ga0466965_0109008	3300044683	Bacteria	1422
286	Ga0466966_0004556	3300044684	Bacteria	9132
287	Ga0466966_0007057	3300044684	Bacteria	7442
288	Ga0466966_0011599	3300044684	Bacteria	5841
289	Ga0466966_0018076	3300044684	Bacteria	4654
290	Ga0466961_0000026	3300044693	Bacteria	92667
291	Ga0466961_0044431	3300044693	Bacteria	2842
292	Ga0466961_0046031	3300044693	Bacteria	2791
293	Ga0466963_0005157	3300044694	Bacteria	7628
294	Ga0466963_0046471	3300044694	Bacteria	2863
295	Ga0466963_0082779	3300044694	Bacteria	2176
296	Ga0466963_0126652	3300044694	Bacteria	1761
297	Ga0466964_0059771	3300044706	Bacteria	1583
298	Ga0466964_0080062	3300044706	Bacteria	1400
299	Ga0466971_0000370	3300044719	Bacteria	17315
300	Ga0466971_0019804	3300044719	Bacteria	2988
301	Ga0466971_0041696	3300044719	Bacteria	2062
302	Ga0466971_0049236	3300044719	Bacteria	1896
303	Ga0466971_0231198	3300044719	Bacteria	878
304	Ga0466968_0006335	3300044735	Bacteria	4457
305	Ga0466968_0012372	3300044735	Bacteria	3340
306	Ga0466970_0000060	3300044765	Bacteria	42753
307	Ga0466970_0014898	3300044765	Bacteria	3998
308	Ga0466970_0015516	3300044765	Bacteria	3919
309	Ga0466970_0030993	3300044765	Bacteria	2822
310	Ga0466970_0121706	3300044765	Bacteria	1430
311	Ga0466970_0679154	3300044765	Bacteria	600
312	Ga0466957_0005548	3300044842	Bacteria	7087
313	Ga0466957_0008336	3300044842	Bacteria	5893
314	Ga0466957_0070213	3300044842	Bacteria	2164
315	Ga0466957_0078687	3300044842	Bacteria	2050
316	Ga0466957_0096877	3300044842	Bacteria	1854
317	Ga0466957_0143670	3300044842	Bacteria	1539
318	Ga0466960_0005490	3300044901	Bacteria	5027
319	Ga0466960_0035225	3300044901	Bacteria	2337
320	Ga0466959_0000129	3300045049	Bacteria	48753
321	Ga0466959_0010455	3300045049	Bacteria	6638
322	Ga0466958_0007619	3300045836	Bacteria	5963
323	Ga0466958_0018682	3300045836	Bacteria	4027
324	Ga0466958_0085077	3300045836	Bacteria	1951
325	Ga0466958_0157297	3300045836	Bacteria	1435
326	Ga0466967_0078753	3300045976	Bacteria	2969
327	Ga0466967_0258982	3300045976	Bacteria	1664
328	Ga0495592_0102794	3300046454	Bacteria	2034
329	Ga0495590_0056921	3300046457	Bacteria	1366
330	Ga0495591_007902	3300046458	Bacteria	4436
331	Ga0495638_0022191	3300046460	Bacteria	4170
332	Ga0495638_0192722	3300046460	Bacteria	1156
333	Ga0495650_0000319	3300046471	Bacteria	86032
334	Ga0495650_0012554	3300046471	Bacteria	4549
335	Ga0495605_0004116	3300046474	Bacteria	8575
336	Ga0495605_0007989	3300046474	Bacteria	5990
337	Ga0495605_0008250	3300046474	Bacteria	5891
338	Ga0495605_0194643	3300046474	Bacteria	886
339	Ga0495664_0081483	3300046477	Bacteria	1940
340	Ga0495584_0001679	3300046491	Bacteria	12982
341	Ga0495584_0004394	3300046491	Bacteria	7590
342	Ga0495584_0079221	3300046491	Bacteria	1653
343	Ga0495585_0036172	3300046492	Bacteria	2787
344	Ga0495596_0001148	3300046500	Bacteria	15580
345	Ga0495596_0004622	3300046500	Bacteria	6666
346	Ga0495596_0008967	3300046500	Bacteria	4419
347	Ga0495596_0022198	3300046500	Bacteria	2585
348	Ga0495596_0028863	3300046500	Bacteria	2225
349	Ga0495607_0005309	3300046501	Bacteria	9263
350	Ga0495607_0211302	3300046501	Bacteria	955
351	Ga0495606_0000070	3300046507	Bacteria	177343
352	Ga0495610_0007512	3300046512	Bacteria	7237
353	Ga0495616_0008939	3300046513	Bacteria	5887
354	Ga0495616_0152057	3300046513	Bacteria	1046
355	Ga0495631_0021112	3300046518	Bacteria	3034
356	Ga0495631_0094288	3300046518	Bacteria	1288
357	Ga0495632_0021928	3300046519	Bacteria	3432
358	Ga0495632_0033371	3300046519	Bacteria	2643
359	Ga0495643_0022469	3300046522	Bacteria	3599
360	Ga0495643_0026955	3300046522	Bacteria	3235
361	Ga0495643_0068851	3300046522	Bacteria	1862
362	Ga0495644_0023122	3300046523	Bacteria	2367
363	Ga0495648_0003509	3300046524	Bacteria	13748
364	Ga0495648_0008764	3300046524	Bacteria	7918
365	Ga0495648_0050914	3300046524	Bacteria	2527
366	Ga0495663_0000857	3300046525	Bacteria	10304
367	Ga0495666_0031026	3300046526	Bacteria	2620
368	Ga0495642_0004145	3300046528	Bacteria	5653
369	Ga0495642_0024392	3300046528	Bacteria	2392
370	Ga0495642_0073131	3300046528	Bacteria	1436
371	Ga0495665_0063667	3300046531	Bacteria	1947
372	Ga0495586_0114630	3300046535	Bacteria	1502
373	Ga0495609_0020049	3300046538	Bacteria	3090
374	Ga0495621_0001901	3300046539	Bacteria	5486
375	Ga0495633_0016088	3300046558	Bacteria	3868
376	Ga0495656_0022528	3300046615	Bacteria	2468
377	Ga0495656_0470881	3300046615	Bacteria	664
378	Ga0495668_0000020	3300046616	Bacteria	411641
379	Ga0495668_0075944	3300046616	Bacteria	1845
380	Ga0495668_0086716	3300046616	Bacteria	1717
381	Ga0495611_0007822	3300046648	Bacteria	4537
382	Ga0495625_0008511	3300046660	Bacteria	8746
383	Ga0495625_0012981	3300046660	Bacteria	6721
384	Ga0495625_0281019	3300046660	Bacteria	1071
385	Ga0495661_0004430	3300046665	Bacteria	10138
386	Ga0495661_0005278	3300046665	Bacteria	9185
387	Ga0495661_0014046	3300046665	Bacteria	5367
388	Ga0495661_0082038	3300046665	Bacteria	1857
389	Ga0495661_0153898	3300046665	Bacteria	1240
390	Ga0495588_0000563	3300046674	Bacteria	17722
391	Ga0495623_0276310	3300046679	Bacteria	936
392	Ga0495646_0239154	3300046680	Bacteria	976
393	Ga0495669_0032434	3300046684	Bacteria	2296
394	Ga0495669_0080372	3300046684	Bacteria	1496
395	Ga0495670_0086720	3300046691	Bacteria	1599
396	Ga0495649_0001856	3300046694	Bacteria	15480
397	Ga0495649_0008012	3300046694	Bacteria	6384
398	Ga0495649_0027491	3300046694	Bacteria	3157
399	Ga0495589_0006168	3300046794	Bacteria	6328
400	Ga0495660_0004028	3300046810	Bacteria	8971
401	Ga0495660_0015670	3300046810	Bacteria	4377
402	Ga0495660_0192440	3300046810	Bacteria	979
403	Ga0495674_0492238	3300047319	Bacteria	982
404	Ga0495676_0000092	3300047321	Bacteria	66361
405	Ga0495683_0013463	3300047323	Bacteria	4278
406	Ga0495687_032014	3300047443	Bacteria	2406
407	Ga0495687_077735	3300047443	Bacteria	1309
408	Ga0495675_0115471	3300047444	Bacteria	1674
409	Ga0495677_0041977	3300047445	Bacteria	1675
410	Ga0495673_0000008	3300047469	Bacteria	752462
411	Ga0495673_0006697	3300047469	Bacteria	6746
412	Ga0495681_0252752	3300047470	Bacteria	695
413	Ga0495686_0000337	3300047472	Bacteria	77142
414	Ga0495686_0000479	3300047472	Bacteria	59585
415	Ga0495686_0003533	3300047472	Bacteria	13466
416	Ga0495615_0000493	3300048090	Bacteria	5672
417	Ga0495626_0046517	3300048091	Bacteria	2021
418	Ga0496102_0007285	3300048905	Bacteria	9441
419	Ga0496114_0004013	3300048917	Bacteria	11374
420	Ga0496116_0180479	3300048919	Bacteria	1131
421	Ga0496116_0305649	3300048919	Bacteria	754
422	Ga0496117_0064092	3300048920	Bacteria	2508
423	Ga0496117_0097773	3300048920	Bacteria	1868
424	Ga0496118_0105378	3300048921	Bacteria	1890
425	Ga0496121_0000072	3300048924	Bacteria	244975
426	Ga0496121_0002477	3300048924	Bacteria	28134
427	Ga0496121_0010557	3300048924	Bacteria	10389
428	Ga0496122_0161493	3300048925	Bacteria	1366
429	Ga0496124_0010449	3300048927	Bacteria	9396
430	Ga0496124_0075763	3300048927	Bacteria	2779
431	Ga0496124_0250150	3300048927	Bacteria	1311
432	Ga0496125_0003735	3300048928	Bacteria	18132
433	Ga0496125_0015215	3300048928	Bacteria	7450
434	Ga0496125_0057128	3300048928	Bacteria	3163
435	Ga0496126_0003963	3300048929	Bacteria	18091
436	Ga0496126_0007972	3300048929	Bacteria	11505
437	Ga0496126_0773111	3300048929	Bacteria	739
438	Ga0495678_009040	3300049459	Bacteria	4973
439	Ga0495678_010050	3300049459	Bacteria	4622
440	Ga0495682_0000874	3300049460	Bacteria	18715
441	Ga0495682_0002198	3300049460	Bacteria	9440
442	Ga0501034_0000447	3300049571	Bacteria	68166
443	Ga0501034_0327768	3300049571	Bacteria	1463
444	Ga0501269_000543	3300049766	Bacteria	7315
445	nmdc:mga00v17_11474_c1	3300050491	Bacteria	4868
446	nmdc:mga00v17_352163_c1	3300050491	Bacteria	957
447	nmdc:mga0yw44_23085_c1	3300050492	Bacteria	3500
448	nmdc:mga0k408_36503_c1	3300050493	Bacteria	2821
449	nmdc:mga0k408_46363_c2	3300050493	Bacteria	2164
450	nmdc:mga06z11_460229_c1	3300050494	Bacteria	769
451	nmdc:mga09592_1310_c1	3300050508	Bacteria	19982
452	nmdc:mga0qj67_234237_c1	3300050509	Bacteria	1490
453	Ga0500643_001268	3300053087	Bacteria	14923
454	Ga0500594_0012334	3300053118	Bacteria	2012
455	Ga0500618_000044	3300053125	Bacteria	110159
456	Ga0500658_0009651	3300053134	Bacteria	3560
457	Ga0500622_0000070	3300053156	Bacteria	115284
458	Ga0500622_0005338	3300053156	Bacteria	7742
459	Ga0500622_0008407	3300053156	Bacteria	5775
460	Ga0500622_0110425	3300053156	Bacteria	1344
461	Ga0500634_0024337	3300053161	Bacteria	3293
462	Ga0500645_008492	3300053730	Bacteria	3504
463	Ga0466962_0003687	3300061719	Bacteria	7302
464	Ga0466962_0008488	3300061719	Bacteria	4922
465	Ga0466962_0036490	3300061719	Bacteria	2353

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005614	Ga0068856_100448500	Ga0068856_1004485002	190
2	3300026078	Ga0207702_10243162	Ga0207702_102431622	190
3	3300044765	Ga0466970_0679154	Ga0466970_0679154_12_590	192
4	3300046513	Ga0495616_0152057	Ga0495616_0152057_438_1016	192
5	3300046615	Ga0495656_0470881	Ga0495656_0470881_46_633	194
6	3300047470	Ga0495681_0252752	Ga0495681_0252752_86_670	194
7	3300044656	Ga0466969_0063323	Ga0466969_0063323_1184_1774	195
8	iso_pu_bacteria	2599185302	2599941294	195
9	iso_pu_bacteria	2599185304	2599953186	195
10	iso_pu_bacteria	2738541281	2738746902	195
11	iso_pu_bacteria	2738543032	2739356132	195
12	iso_pu_bacteria	2791355520	2794597991	195
13	iso_pu_bacteria	2818991449	2819617852	195
14	iso_pu_bacteria	2821443989	2821448378	195
15	3300046616	Ga0495668_0000020	Ga0495668_0000020_170775_171371	196
16	3300047472	Ga0495686_0003533	Ga0495686_0003533_4877_5473	196
17	iso_pu_bacteria	2738541296	2738819988	196
18	iso_pu_bacteria	2738541298	2738832468	196
19	iso_pu_bacteria	2738541306	2738873995	196
20	iso_pu_bacteria	2738543002	2739185625	196
21	iso_pu_bacteria	2738543008	2739220593	196
22	iso_pu_bacteria	2909042592	2909044372	196
23	iso_pu_bacteria	2945934425	2945935544	196
24	iso_pu_bacteria	641736151	642422061	196
25	iso_pu_bacteria	643348564	643600761	196
26	3300009093	Ga0105240_10003721	Ga0105240_100037214	197
27	3300025913	Ga0207695_10004043	Ga0207695_100040434	197
28	3300046471	Ga0495650_0000319	Ga0495650_0000319_45821_46420	197
29	3300047469	Ga0495673_0000008	Ga0495673_0000008_424727_425326	197
30	3300048924	Ga0496121_0002477	Ga0496121_0002477_10951_11562	198
31	3300053156	Ga0500622_0110425	Ga0500622_0110425_426_1031	198
32	3300002987	JGI25159J45721_1001971	JGI25159J45721_10019715	199
33	3300003751	Ga0055538_1000059	Ga0055538_100005925	199
34	3300003752	Ga0055539_1000089	Ga0055539_100008925	199
35	3300003756	Ga0055533_1000098	Ga0055533_100009825	199
36	3300003759	Ga0055525_1000130	Ga0055525_100013025	199
37	3300003841	Ga0055541_1000061	Ga0055541_100006125	199
38	3300004625	Ga0055543_1007411	Ga0055543_10074113	199
39	3300005262	Ga0065165_1000007	Ga0065165_1000007214	199
40	3300005331	Ga0070670_100724611	Ga0070670_1007246112	199
41	3300005336	Ga0070680_100084521	Ga0070680_1000845212	199
42	3300005337	Ga0070682_100072227	Ga0070682_1000722272	199
43	3300005458	Ga0070681_10052839	Ga0070681_100528392	199
44	3300005530	Ga0070679_100114848	Ga0070679_1001148483	199
45	3300005539	Ga0068853_100001980	Ga0068853_1000019807	199
46	3300005539	Ga0068853_100133720	Ga0068853_1001337202	199
47	3300005614	Ga0068856_100715232	Ga0068856_1007152321	199
48	3300005615	Ga0070702_100566021	Ga0070702_1005660212	199
49	3300006028	Ga0070717_10001896	Ga0070717_100018964	199
50	3300006028	Ga0070717_10208306	Ga0070717_102083061	199
51	3300006846	Ga0075430_100154152	Ga0075430_1001541522	199
52	3300006880	Ga0075429_100004508	Ga0075429_10000450811	199
53	3300009098	Ga0105245_10775263	Ga0105245_107752632	199
54	3300009174	Ga0105241_10124890	Ga0105241_101248901	199
55	3300013296	Ga0157374_10021590	Ga0157374_100215904	199
56	3300013296	Ga0157374_11132978	Ga0157374_111329781	199
57	3300014968	Ga0157379_10539055	Ga0157379_105390552	199
58	3300021361	Ga0213872_10003175	Ga0213872_100031757	199
59	3300021361	Ga0213872_10008282	Ga0213872_100082823	199
60	3300021361	Ga0213872_10044591	Ga0213872_100445911	199
61	3300025224	Ga0209784_100018	Ga0209784_100018309	199
62	3300025225	Ga0209566_100016	Ga0209566_100016309	199
63	3300025226	Ga0209674_100030	Ga0209674_100030309	199
64	3300025230	Ga0209563_100034	Ga0209563_100034309	199
65	3300025253	Ga0209677_100019	Ga0209677_100019309	199
66	3300025284	Ga0209130_1000047	Ga0209130_1000047191	199
67	3300025302	Ga0207426_1063916	Ga0207426_10639162	199
68	3300025906	Ga0207699_10480746	Ga0207699_104807461	199
69	3300025911	Ga0207654_10217616	Ga0207654_102176161	199
70	3300025912	Ga0207707_10046024	Ga0207707_100460242	199
71	3300025917	Ga0207660_10082493	Ga0207660_100824932	199
72	3300025919	Ga0207657_10227990	Ga0207657_102279902	199
73	3300025921	Ga0207652_10188094	Ga0207652_101880942	199
74	3300025925	Ga0207650_10794462	Ga0207650_107944622	199
75	3300026041	Ga0207639_10009334	Ga0207639_100093345	199
76	3300026041	Ga0207639_10061581	Ga0207639_100615813	199
77	3300026078	Ga0207702_11108935	Ga0207702_111089351	199
78	3300028573	Ga0265334_10011529	Ga0265334_100115292	199
79	3300028577	Ga0265318_10055555	Ga0265318_100555552	199
80	3300028666	Ga0265336_10011731	Ga0265336_100117314	199
81	3300028800	Ga0265338_10130778	Ga0265338_101307782	199
82	3300028800	Ga0265338_10326192	Ga0265338_103261922	199
83	3300031235	Ga0265330_10000123	Ga0265330_1000012319	199
84	3300031238	Ga0265332_10019026	Ga0265332_100190263	199
85	3300031239	Ga0265328_10009371	Ga0265328_100093713	199
86	3300031240	Ga0265320_10009485	Ga0265320_100094854	199
87	3300031241	Ga0265325_10075417	Ga0265325_100754172	199
88	3300031242	Ga0265329_10014101	Ga0265329_100141012	199
89	3300031247	Ga0265340_10004286	Ga0265340_100042862	199
90	3300031247	Ga0265340_10049319	Ga0265340_100493192	199
91	3300031249	Ga0265339_10007645	Ga0265339_100076454	199
92	3300031250	Ga0265331_10013355	Ga0265331_100133553	199
93	3300031250	Ga0265331_10041723	Ga0265331_100417232	199
94	3300031344	Ga0265316_10006591	Ga0265316_100065915	199
95	3300031344	Ga0265316_10028078	Ga0265316_100280782	199
96	3300031595	Ga0265313_10005125	Ga0265313_100051253	199
97	3300031595	Ga0265313_10061021	Ga0265313_100610212	199
98	3300031711	Ga0265314_10001814	Ga0265314_100018148	199
99	3300031712	Ga0265342_10008363	Ga0265342_100083636	199
100	3300031712	Ga0265342_10012811	Ga0265342_100128114	199
101	3300039447	Ga0436361_0459515	Ga0436361_0459515_3014_3622	199
102	3300039447	Ga0436361_0755803	Ga0436361_0755803_866_1471	199
103	3300039447	Ga0436361_0988282	Ga0436361_0988282_121_726	199
104	3300039447	Ga0436361_1185595	Ga0436361_1185595_1751_2395	199
105	3300044735	Ga0466968_0006335	Ga0466968_0006335_3752_4357	199
106	3300046507	Ga0495606_0000070	Ga0495606_0000070_152271_152876	199
107	3300046522	Ga0495643_0068851	Ga0495643_0068851_1138_1743	199
108	3300046524	Ga0495648_0003509	Ga0495648_0003509_1388_2014	199
109	3300046691	Ga0495670_0086720	Ga0495670_0086720_801_1409	199
110	3300047319	Ga0495674_0492238	Ga0495674_0492238_44_655	199
111	3300048919	Ga0496116_0305649	Ga0496116_0305649_111_716	199
112	3300048927	Ga0496124_0075763	Ga0496124_0075763_864_1469	199
113	3300048928	Ga0496125_0057128	Ga0496125_0057128_146_757	199
114	3300048929	Ga0496126_0007972	Ga0496126_0007972_8477_9082	199
115	3300049766	Ga0501269_000543	Ga0501269_000543_5672_6277	199
116	3300050508	nmdc:mga09592_1310_c1	nmdc:mga09592_1310_c1_19002_19613	199
117	3300050509	nmdc:mga0qj67_234237_c1	nmdc:mga0qj67_234237_c1_86_697	199
118	3300053118	Ga0500594_0012334	Ga0500594_0012334_989_1594	199
119	3300053125	Ga0500618_000044	Ga0500618_000044_21418_22023	199
120	3300053156	Ga0500622_0000070	Ga0500622_0000070_33084_33689	199
121	3300001989	JGI24739J22299_10001406	JGI24739J22299_100014065	200
122	3300002067	JGI24735J21928_10003222	JGI24735J21928_100032225	200
123	3300004625	Ga0055543_1014303	Ga0055543_10143031	200
124	3300005262	Ga0065165_1000951	Ga0065165_10009519	200
125	3300005327	Ga0070658_10365950	Ga0070658_103659502	200
126	3300005563	Ga0068855_100242651	Ga0068855_1002426512	200
127	3300005616	Ga0068852_100973083	Ga0068852_1009730832	200
128	3300009011	Ga0105251_10000032	Ga0105251_100000324	200
129	3300009092	Ga0105250_10000241	Ga0105250_1000024144	200
130	3300009551	Ga0105238_10257564	Ga0105238_102575642	200
131	3300009551	Ga0105238_10420570	Ga0105238_104205702	200
132	3300009551	Ga0105238_10653355	Ga0105238_106533552	200
133	3300025284	Ga0209130_1000116	Ga0209130_1000116110	200
134	3300025302	Ga0207426_1023407	Ga0207426_10234072	200
135	3300025711	Ga0207696_1000363	Ga0207696_100036344	200
136	3300025735	Ga0207713_1000020	Ga0207713_1000020225	200
137	3300026067	Ga0207678_10336928	Ga0207678_103369282	200
138	3300026142	Ga0207698_10605455	Ga0207698_106054551	200
139	3300031456	Ga0307513_10436067	Ga0307513_104360671	200
140	3300031911	Ga0307412_10505949	Ga0307412_105059492	200
141	3300044656	Ga0466969_0001355	Ga0466969_0001355_9376_9990	200
142	3300044659	Ga0466973_0021554	Ga0466973_0021554_2422_3036	200
143	3300044683	Ga0466965_0028094	Ga0466965_0028094_2096_2710	200
144	3300044684	Ga0466966_0007057	Ga0466966_0007057_3659_4273	200
145	3300044684	Ga0466966_0011599	Ga0466966_0011599_3586_4200	200
146	3300044684	Ga0466966_0018076	Ga0466966_0018076_1460_2074	200
147	3300044693	Ga0466961_0044431	Ga0466961_0044431_453_1067	200
148	3300044693	Ga0466961_0046031	Ga0466961_0046031_1482_2096	200
149	3300044694	Ga0466963_0005157	Ga0466963_0005157_2372_2986	200
150	3300044694	Ga0466963_0046471	Ga0466963_0046471_862_1476	200
151	3300044706	Ga0466964_0080062	Ga0466964_0080062_97_711	200
152	3300044719	Ga0466971_0000370	Ga0466971_0000370_16590_17204	200
153	3300044719	Ga0466971_0019804	Ga0466971_0019804_971_1585	200
154	3300044719	Ga0466971_0049236	Ga0466971_0049236_364_978	200
155	3300044735	Ga0466968_0012372	Ga0466968_0012372_2147_2761	200
156	3300044765	Ga0466970_0014898	Ga0466970_0014898_458_1072	200
157	3300044765	Ga0466970_0030993	Ga0466970_0030993_2001_2615	200
158	3300044842	Ga0466957_0005548	Ga0466957_0005548_3270_3884	200
159	3300044842	Ga0466957_0078687	Ga0466957_0078687_541_1155	200
160	3300044842	Ga0466957_0096877	Ga0466957_0096877_622_1236	200
161	3300045836	Ga0466958_0007619	Ga0466958_0007619_1280_1894	200
162	3300045836	Ga0466958_0018682	Ga0466958_0018682_382_996	200
163	3300045836	Ga0466958_0085077	Ga0466958_0085077_130_744	200
164	3300046454	Ga0495592_0102794	Ga0495592_0102794_844_1458	200
165	3300046474	Ga0495605_0004116	Ga0495605_0004116_4241_4855	200
166	3300046477	Ga0495664_0081483	Ga0495664_0081483_39_653	200
167	3300046500	Ga0495596_0022198	Ga0495596_0022198_1293_1907	200
168	3300046512	Ga0495610_0007512	Ga0495610_0007512_6364_6978	200
169	3300046528	Ga0495642_0024392	Ga0495642_0024392_1452_2066	200
170	3300046535	Ga0495586_0114630	Ga0495586_0114630_411_1025	200
171	3300047444	Ga0495675_0115471	Ga0495675_0115471_263_877	200
172	3300048920	Ga0496117_0097773	Ga0496117_0097773_650_1264	200
173	3300048921	Ga0496118_0105378	Ga0496118_0105378_510_1124	200
174	3300061719	Ga0466962_0003687	Ga0466962_0003687_4129_4743	200
175	3300061719	Ga0466962_0008488	Ga0466962_0008488_3720_4334	200
176	3300046474	Ga0495605_0194643	Ga0495605_0194643_158_772	201
177	3300046524	Ga0495648_0050914	Ga0495648_0050914_219_872	201
178	3300046660	Ga0495625_0281019	Ga0495625_0281019_157_771	201
179	3300053087	Ga0500643_001268	Ga0500643_001268_2830_3450	201
180	3300053730	Ga0500645_008492	Ga0500645_008492_2666_3280	201
181	3300009093	Ga0105240_10001507	Ga0105240_100015072	202
182	3300009551	Ga0105238_10446268	Ga0105238_104462682	202
183	3300010375	Ga0105239_10000164	Ga0105239_1000016442	202
184	3300025913	Ga0207695_10039598	Ga0207695_100395982	202
185	3300038443	Ga0395901_0705967	Ga0395901_0705967_352_972	202
186	3300048924	Ga0496121_0000072	Ga0496121_0000072_153594_154217	202
187	3300048929	Ga0496126_0003963	Ga0496126_0003963_8597_9220	202
188	3300003323	rootH1_10020269	rootH1_1002026914	205
189	3300006942	Ga0099824_1052383	Ga0099824_10523832	205
190	3300006944	Ga0099823_1000176	Ga0099823_100017624	205
191	3300025299	Ga0209256_1024631	Ga0209256_10246311	205
192	3300044694	Ga0466963_0126652	Ga0466963_0126652_199_822	205
193	3300044842	Ga0466957_0008336	Ga0466957_0008336_2557_3189	205
194	3300048927	Ga0496124_0010449	Ga0496124_0010449_4434_5057	205
195	3300025231	Ga0207427_100551	Ga0207427_1005518	206
196	iso_pu_bacteria	2831864461	2831865099	206
197	iso_pu_bacteria	2886848708	2886849118	206
198	3300002705	JGI25156J39149_1010258	JGI25156J39149_10102582	207
199	3300003752	Ga0055539_1000034	Ga0055539_1000034182	207
200	3300003758	Ga0055532_1000002	Ga0055532_1000002232	207
201	3300003759	Ga0055525_1000285	Ga0055525_100028520	207
202	3300003760	Ga0055527_1001388	Ga0055527_10013885	207
203	3300003763	Ga0055529_1000028	Ga0055529_100002874	207
204	3300003771	Ga0055526_1002634	Ga0055526_10026348	207
205	3300005577	Ga0068857_100016053	Ga0068857_1000160535	207
206	3300005578	Ga0068854_100000093	Ga0068854_10000009349	207
207	3300006038	Ga0075365_10035446	Ga0075365_100354461	207
208	3300006051	Ga0075364_10413323	Ga0075364_104133232	207
209	3300006178	Ga0075367_10139219	Ga0075367_101392192	207
210	3300006195	Ga0075366_10027013	Ga0075366_100270133	207
211	3300009093	Ga0105240_10034772	Ga0105240_100347726	207
212	3300013105	Ga0157369_10001233	Ga0157369_1000123325	207
213	3300020610	Ga0154015_1060010	Ga0154015_10600102	207
214	3300025224	Ga0209784_100003	Ga0209784_100003481	207
215	3300025225	Ga0209566_100002	Ga0209566_1000021524	207
216	3300025226	Ga0209674_100008	Ga0209674_100008665	207
217	3300025226	Ga0209674_105961	Ga0209674_1059611	207
218	3300025228	Ga0209672_101335	Ga0209672_1013356	207
219	3300025229	Ga0209147_100002	Ga0209147_1000021762	207
220	3300025230	Ga0209563_100004	Ga0209563_100004937	207
221	3300025242	Ga0209258_100002	Ga0209258_1000021762	207
222	3300025253	Ga0209677_100009	Ga0209677_100009695	207
223	3300025254	Ga0209148_1013294	Ga0209148_10132942	207
224	3300025256	Ga0209759_1006799	Ga0209759_10067992	207
225	3300025272	Ga0209455_1000021	Ga0209455_1000021349	207
226	3300025273	Ga0209673_1053365	Ga0209673_10533652	207
227	3300025295	Ga0209564_1000003	Ga0209564_100000359	207
228	3300025913	Ga0207695_10000437	Ga0207695_1000043730	207
229	3300025981	Ga0207640_10000113	Ga0207640_1000011349	207
230	3300037418	Ga0395900_0003747	Ga0395900_0003747_37_699	207
231	3300044683	Ga0466965_0064687	Ga0466965_0064687_1016_1645	207
232	3300044683	Ga0466965_0109008	Ga0466965_0109008_684_1316	207
233	3300050491	nmdc:mga00v17_352163_c1	nmdc:mga00v17_352163_c1_176_808	207
234	3300050492	nmdc:mga0yw44_23085_c1	nmdc:mga0yw44_23085_c1_60_692	207
235	3300050493	nmdc:mga0k408_46363_c2	nmdc:mga0k408_46363_c2_437_1069	207
236	3300050494	nmdc:mga06z11_460229_c1	nmdc:mga06z11_460229_c1_121_753	207
237	3300003215	JGI25153J46596_10020082	JGI25153J46596_100200823	208
238	3300003791	Ga0055530_10000039	Ga0055530_1000003993	208
239	3300003794	Ga0055531_10003703	Ga0055531_100037034	208
240	3300005262	Ga0065165_1000950	Ga0065165_100095020	208
241	3300025297	Ga0209758_1000885	Ga0209758_100088523	208
242	3300025298	Ga0209050_1000073	Ga0209050_1000073147	208
243	3300025304	Ga0209257_1000099	Ga0209257_1000099149	208
244	3300045976	Ga0466967_0258982	Ga0466967_0258982_464_1102	208
245	3300048905	Ga0496102_0007285	Ga0496102_0007285_2061_2693	208
246	iso_pu_bacteria	2599185292	2599904316	208
247	iso_pu_bacteria	2901300506	2901307943	208
248	3300003320	rootH2_10037016	rootH2_100370162	209
249	3300003322	rootL2_10001457	rootL2_1000145747	209
250	3300003775	Ga0055524_1000310	Ga0055524_100031032	209
251	3300004625	Ga0055543_1004116	Ga0055543_10041163	209
252	3300005262	Ga0065165_1000170	Ga0065165_1000170109	209
253	3300006195	Ga0075366_10015095	Ga0075366_100150953	209
254	3300012497	Ga0157319_1000003	Ga0157319_100000378	209
255	3300015261	Ga0182006_1000825	Ga0182006_10008252	209
256	3300025224	Ga0209784_101097	Ga0209784_1010972	209
257	3300025225	Ga0209566_101900	Ga0209566_1019002	209
258	3300025299	Ga0209256_1000150	Ga0209256_100015033	209
259	3300025304	Ga0209257_1000318	Ga0209257_100031862	209
260	3300027312	Ga0209371_1016267	Ga0209371_10162672	209
261	3300030500	Ga0268256_1018079	Ga0268256_10180792	209
262	3300042438	Ga0439459_0000524	Ga0439459_0000524_2232_2870	209
263	3300044658	Ga0466972_0066469	Ga0466972_0066469_164_799	209
264	3300046460	Ga0495638_0192722	Ga0495638_0192722_427_1062	209
265	3300046519	Ga0495632_0033371	Ga0495632_0033371_1818_2453	209
266	3300046539	Ga0495621_0001901	Ga0495621_0001901_3712_4347	209
267	3300046694	Ga0495649_0001856	Ga0495649_0001856_1035_1670	209
268	3300046810	Ga0495660_0192440	Ga0495660_0192440_323_958	209
269	3300047443	Ga0495687_077735	Ga0495687_077735_582_1217	209
270	3300048929	Ga0496126_0773111	Ga0496126_0773111_48_683	209
271	3300050493	nmdc:mga0k408_36503_c1	nmdc:mga0k408_36503_c1_1021_1656	209
272	3300053134	Ga0500658_0009651	Ga0500658_0009651_2572_3207	209
273	3300053156	Ga0500622_0005338	Ga0500622_0005338_1750_2388	209
274	3300053156	Ga0500622_0008407	Ga0500622_0008407_55_690	209
275	3300001979	JGI24740J21852_10000472	JGI24740J21852_1000047215	210
276	3300002705	JGI25156J39149_1008194	JGI25156J39149_10081942	210
277	3300002738	JGI25154J39366_1000129	JGI25154J39366_100012943	210
278	3300003756	Ga0055533_1001791	Ga0055533_10017912	210
279	3300003762	Ga0055542_1000724	Ga0055542_10007246	210
280	3300003792	Ga0055540_1044499	Ga0055540_10444991	210
281	3300003841	Ga0055541_1000327	Ga0055541_100032711	210
282	3300025224	Ga0209784_100605	Ga0209784_1006058	210
283	3300025225	Ga0209566_100639	Ga0209566_10063913	210
284	3300025226	Ga0209674_100135	Ga0209674_10013545	210
285	3300025246	Ga0209646_1000027	Ga0209646_1000027259	210
286	3300025250	Ga0209026_1003042	Ga0209026_10030423	210
287	3300025253	Ga0209677_104663	Ga0209677_1046634	210
288	3300025254	Ga0209148_1000019	Ga0209148_1000019353	210
289	3300025256	Ga0209759_1001486	Ga0209759_10014865	210
290	3300025284	Ga0209130_1001008	Ga0209130_10010082	210
291	3300025291	Ga0209675_1000557	Ga0209675_10005579	210
292	3300025292	Ga0209676_1003002	Ga0209676_10030027	210
293	3300025295	Ga0209564_1013356	Ga0209564_10133562	210
294	3300025298	Ga0209050_1009014	Ga0209050_10090142	210
295	3300025303	Ga0209051_1065246	Ga0209051_10652462	210
296	3300025304	Ga0209257_1017235	Ga0209257_10172351	210
297	iso_pu_bacteria	2738541337	2739057205	210
298	3300003187	JGI25151J46595_10001449	JGI25151J46595_1000144916	211
299	3300003187	JGI25151J46595_10013163	JGI25151J46595_100131634	211
300	3300003771	Ga0055526_1000917	Ga0055526_10009173	211
301	3300003771	Ga0055526_1002371	Ga0055526_100237111	211
302	3300003771	Ga0055526_1008492	Ga0055526_10084922	211
303	3300003771	Ga0055526_1013063	Ga0055526_10130632	211
304	3300003773	Ga0055537_1005786	Ga0055537_10057863	211
305	3300003775	Ga0055524_1000557	Ga0055524_10005576	211
306	3300003781	Ga0055536_1000031	Ga0055536_100003191	211
307	3300003784	Ga0055534_1001179	Ga0055534_10011797	211
308	3300003784	Ga0055534_1011103	Ga0055534_10111032	211
309	3300014497	Ga0182008_10046782	Ga0182008_100467822	211
310	3300025263	Ga0209565_1000374	Ga0209565_100037412	211
311	3300025263	Ga0209565_1019667	Ga0209565_10196671	211
312	3300025273	Ga0209673_1009477	Ga0209673_10094772	211
313	3300025284	Ga0209130_1017285	Ga0209130_10172851	211
314	3300025291	Ga0209675_1000231	Ga0209675_100023118	211
315	3300025291	Ga0209675_1004819	Ga0209675_10048192	211
316	3300025291	Ga0209675_1035446	Ga0209675_10354462	211
317	3300025292	Ga0209676_1000036	Ga0209676_1000036318	211
318	3300025294	Ga0209025_1000345	Ga0209025_100034537	211
319	3300025294	Ga0209025_1001077	Ga0209025_100107718	211
320	3300025295	Ga0209564_1000878	Ga0209564_100087813	211
321	3300025295	Ga0209564_1001207	Ga0209564_100120713	211
322	3300025295	Ga0209564_1001260	Ga0209564_10012606	211
323	3300025297	Ga0209758_1044704	Ga0209758_10447042	211
324	3300025298	Ga0209050_1008757	Ga0209050_10087574	211
325	3300025299	Ga0209256_1000061	Ga0209256_1000061146	211
326	3300025299	Ga0209256_1000846	Ga0209256_100084612	211
327	3300046660	Ga0495625_0012981	Ga0495625_0012981_497_1138	211
328	3300048917	Ga0496114_0004013	Ga0496114_0004013_3798_4448	211
329	iso_pu_bacteria	2887375801	2887377398	211
330	3300003187	JGI25151J46595_10024749	JGI25151J46595_100247492	212
331	3300006051	Ga0075364_10019655	Ga0075364_100196554	212
332	3300025294	Ga0209025_1000371	Ga0209025_100037150	212
333	3300025298	Ga0209050_1058260	Ga0209050_10582602	212
334	3300028794	Ga0307515_10006245	Ga0307515_100062459	212
335	3300031649	Ga0307514_10001051	Ga0307514_100010515	212
336	3300037471	Ga0395905_0255252	Ga0395905_0255252_215_862	212
337	3300037471	Ga0395905_0769692	Ga0395905_0769692_94_741	212
338	3300044719	Ga0466971_0231198	Ga0466971_0231198_215_865	212
339	3300044901	Ga0466960_0035225	Ga0466960_0035225_495_1145	212
340	3300046457	Ga0495590_0056921	Ga0495590_0056921_599_1240	212
341	3300049571	Ga0501034_0000447	Ga0501034_0000447_28599_29243	212
342	3300050491	nmdc:mga00v17_11474_c1	nmdc:mga00v17_11474_c1_4057_4701	212
343	3300053161	Ga0500634_0024337	Ga0500634_0024337_1500_2144	212
344	iso_pu_bacteria	2834641062	2834643548	212
345	iso_pu_bacteria	8003400568	8003405286	212
346	3300046665	Ga0495661_0004430	Ga0495661_0004430_3873_4526	213
347	3300048925	Ga0496122_0161493	Ga0496122_0161493_53_703	213
348	3300028794	Ga0307515_10005239	Ga0307515_1000523914	214
349	3300031456	Ga0307513_10103580	Ga0307513_101035804	214
350	3300031649	Ga0307514_10003111	Ga0307514_1000311112	214
351	3300033180	Ga0307510_10169582	Ga0307510_101695822	214
352	3300044765	Ga0466970_0121706	Ga0466970_0121706_212_892	214
353	3300044842	Ga0466957_0070213	Ga0466957_0070213_25_693	214
354	3300044842	Ga0466957_0143670	Ga0466957_0143670_534_1214	214
355	3300045836	Ga0466958_0157297	Ga0466958_0157297_387_1067	214
356	3300046491	Ga0495584_0001679	Ga0495584_0001679_6181_6849	214
357	3300046501	Ga0495607_0211302	Ga0495607_0211302_229_909	214
358	3300046522	Ga0495643_0022469	Ga0495643_0022469_1440_2108	214
359	3300046528	Ga0495642_0073131	Ga0495642_0073131_328_996	214
360	3300046665	Ga0495661_0082038	Ga0495661_0082038_596_1276	214
361	3300046810	Ga0495660_0004028	Ga0495660_0004028_4412_5080	214
362	3300039447	Ga0436361_0674317	Ga0436361_0674317_405_1064	216
363	3300046491	Ga0495584_0079221	Ga0495584_0079221_90_764	216
364	3300046500	Ga0495596_0001148	Ga0495596_0001148_6944_7618	216
365	3300046522	Ga0495643_0026955	Ga0495643_0026955_2466_3140	216
366	3300046528	Ga0495642_0004145	Ga0495642_0004145_1491_2165	216
367	3300046558	Ga0495633_0016088	Ga0495633_0016088_1578_2252	216
368	3300046615	Ga0495656_0022528	Ga0495656_0022528_1581_2255	216
369	3300046616	Ga0495668_0075944	Ga0495668_0075944_1144_1818	216
370	3300046665	Ga0495661_0005278	Ga0495661_0005278_6485_7159	216
371	3300046665	Ga0495661_0153898	Ga0495661_0153898_312_986	216
372	3300046684	Ga0495669_0032434	Ga0495669_0032434_543_1217	216
373	3300047443	Ga0495687_032014	Ga0495687_032014_631_1305	216
374	3300047445	Ga0495677_0041977	Ga0495677_0041977_321_995	216
375	iso_pu_bacteria	2511231003	2511248399	216
376	iso_pu_bacteria	2599185178	2599445499	216
377	iso_pu_bacteria	2818991445	2819592261	216
378	iso_pu_bacteria	2900577576	2900581114	216
379	iso_pu_bacteria	2928058823	2928062832	216
380	3300006051	Ga0075364_10103295	Ga0075364_101032953	217
381	3300037312	Ga0395899_0000598	Ga0395899_0000598_19451_20116	217
382	3300037312	Ga0395899_0129385	Ga0395899_0129385_375_1061	217
383	3300037418	Ga0395900_0058275	Ga0395900_0058275_2742_3407	217
384	3300044658	Ga0466972_0000262	Ga0466972_0000262_28660_29325	217
385	3300044683	Ga0466965_0049862	Ga0466965_0049862_833_1498	217
386	3300044684	Ga0466966_0004556	Ga0466966_0004556_2404_3069	217
387	3300044719	Ga0466971_0041696	Ga0466971_0041696_132_797	217
388	3300046525	Ga0495663_0000857	Ga0495663_0000857_4698_5357	217
389	3300048090	Ga0495615_0000493	Ga0495615_0000493_1693_2352	217
390	3300049459	Ga0495678_010050	Ga0495678_010050_2112_2771	217
391	3300049571	Ga0501034_0327768	Ga0501034_0327768_384_1070	217
392	3300061719	Ga0466962_0036490	Ga0466962_0036490_464_1129	217
393	3300005353	Ga0070669_100514187	Ga0070669_1005141872	218
394	3300025923	Ga0207681_10509892	Ga0207681_105098922	218
395	3300046458	Ga0495591_007902	Ga0495591_007902_1673_2335	218
396	3300046460	Ga0495638_0022191	Ga0495638_0022191_1029_1691	218
397	3300046471	Ga0495650_0012554	Ga0495650_0012554_1712_2374	218
398	3300046474	Ga0495605_0007989	Ga0495605_0007989_2587_3249	218
399	3300046474	Ga0495605_0008250	Ga0495605_0008250_3533_4225	218
400	3300046491	Ga0495584_0004394	Ga0495584_0004394_2839_3531	218
401	3300046492	Ga0495585_0036172	Ga0495585_0036172_532_1194	218
402	3300046500	Ga0495596_0004622	Ga0495596_0004622_3307_3999	218
403	3300046500	Ga0495596_0008967	Ga0495596_0008967_2712_3374	218
404	3300046500	Ga0495596_0028863	Ga0495596_0028863_1421_2083	218
405	3300046501	Ga0495607_0005309	Ga0495607_0005309_5631_6293	218
406	3300046513	Ga0495616_0008939	Ga0495616_0008939_2602_3264	218
407	3300046518	Ga0495631_0021112	Ga0495631_0021112_2262_2924	218
408	3300046518	Ga0495631_0094288	Ga0495631_0094288_156_818	218
409	3300046519	Ga0495632_0021928	Ga0495632_0021928_76_738	218
410	3300046523	Ga0495644_0023122	Ga0495644_0023122_1352_2014	218
411	3300046524	Ga0495648_0008764	Ga0495648_0008764_2917_3579	218
412	3300046526	Ga0495666_0031026	Ga0495666_0031026_355_1011	218
413	3300046531	Ga0495665_0063667	Ga0495665_0063667_1148_1804	218
414	3300046538	Ga0495609_0020049	Ga0495609_0020049_2318_2980	218
415	3300046616	Ga0495668_0086716	Ga0495668_0086716_575_1267	218
416	3300046648	Ga0495611_0007822	Ga0495611_0007822_1947_2609	218
417	3300046660	Ga0495625_0008511	Ga0495625_0008511_3085_3744	218
418	3300046665	Ga0495661_0014046	Ga0495661_0014046_2271_2933	218
419	3300046674	Ga0495588_0000563	Ga0495588_0000563_13348_14040	218
420	3300046679	Ga0495623_0276310	Ga0495623_0276310_36_692	218
421	3300046680	Ga0495646_0239154	Ga0495646_0239154_139_795	218
422	3300046684	Ga0495669_0080372	Ga0495669_0080372_791_1453	218
423	3300046694	Ga0495649_0008012	Ga0495649_0008012_2569_3231	218
424	3300046694	Ga0495649_0027491	Ga0495649_0027491_1976_2632	218
425	3300046794	Ga0495589_0006168	Ga0495589_0006168_3064_3726	218
426	3300046810	Ga0495660_0015670	Ga0495660_0015670_2594_3256	218
427	3300047321	Ga0495676_0000092	Ga0495676_0000092_34103_34795	218
428	3300047323	Ga0495683_0013463	Ga0495683_0013463_2797_3468	218
429	3300047469	Ga0495673_0006697	Ga0495673_0006697_3091_3759	218
430	3300047472	Ga0495686_0000337	Ga0495686_0000337_4137_4814	218
431	3300047472	Ga0495686_0000479	Ga0495686_0000479_34553_35215	218
432	3300048091	Ga0495626_0046517	Ga0495626_0046517_777_1439	218
433	3300048927	Ga0496124_0250150	Ga0496124_0250150_580_1242	218
434	3300048928	Ga0496125_0015215	Ga0496125_0015215_3047_3709	218
435	3300049459	Ga0495678_009040	Ga0495678_009040_3911_4573	218
436	3300049460	Ga0495682_0000874	Ga0495682_0000874_299_961	218
437	3300049460	Ga0495682_0002198	Ga0495682_0002198_756_1418	218
438	3300005366	Ga0070659_100002495	Ga0070659_10000249512	219
439	3300014497	Ga0182008_10024918	Ga0182008_100249182	219
440	3300015261	Ga0182006_1031139	Ga0182006_10311392	219
441	3300025932	Ga0207690_10003536	Ga0207690_100035362	219
442	3300044656	Ga0466969_0030196	Ga0466969_0030196_1984_2646	219
443	3300044658	Ga0466972_0117040	Ga0466972_0117040_482_1144	219
444	3300044666	Ga0466977_0142860	Ga0466977_0142860_716_1378	219
445	3300044672	Ga0466982_0009788	Ga0466982_0009788_1226_1888	219
446	3300044683	Ga0466965_0007291	Ga0466965_0007291_1940_2602	219
447	3300044693	Ga0466961_0000026	Ga0466961_0000026_37328_37990	219
448	3300044694	Ga0466963_0082779	Ga0466963_0082779_523_1185	219
449	3300044706	Ga0466964_0059771	Ga0466964_0059771_678_1340	219
450	3300044765	Ga0466970_0000060	Ga0466970_0000060_35744_36406	219
451	3300044901	Ga0466960_0005490	Ga0466960_0005490_3481_4143	219
452	3300045049	Ga0466959_0000129	Ga0466959_0000129_37052_37714	219
453	3300045976	Ga0466967_0078753	Ga0466967_0078753_826_1488	219
454	3300048919	Ga0496116_0180479	Ga0496116_0180479_287_958	219
455	3300048920	Ga0496117_0064092	Ga0496117_0064092_1434_2105	219
456	3300001915	JGI24741J21665_1000056	JGI24741J21665_100005614	220
457	3300001979	JGI24740J21852_10000969	JGI24740J21852_100009698	220
458	3300002704	JGI25155J39150_1000096	JGI25155J39150_10000962	220
459	3300002704	JGI25155J39150_1000135	JGI25155J39150_100013518	220
460	3300002705	JGI25156J39149_1000274	JGI25156J39149_100027417	220
461	3300002738	JGI25154J39366_1000146	JGI25154J39366_10001468	220
462	3300002738	JGI25154J39366_1000248	JGI25154J39366_100024818	220
463	3300002741	JGI25157J39369_1000225	JGI25157J39369_100022527	220
464	3300003323	rootH1_10148185	rootH1_101481852	220
465	3300003758	Ga0055532_1000015	Ga0055532_1000015235	220
466	3300005344	Ga0070661_100000063	Ga0070661_10000006315	220
467	3300005455	Ga0070663_100000006	Ga0070663_10000000678	220
468	3300005564	Ga0070664_100000002	Ga0070664_100000002187	220
469	3300005614	Ga0068856_100000028	Ga0068856_100000028120	220
470	3300009093	Ga0105240_10007856	Ga0105240_100078565	220
471	3300013100	Ga0157373_10003150	Ga0157373_100031506	220
472	3300013102	Ga0157371_10000123	Ga0157371_1000012369	220
473	3300013104	Ga0157370_10000013	Ga0157370_1000001352	220
474	3300014497	Ga0182008_10315792	Ga0182008_103157921	220
475	3300025206	Ga0209435_100021	Ga0209435_10002187	220
476	3300025206	Ga0209435_100057	Ga0209435_10005735	220
477	3300025229	Ga0209147_100004	Ga0209147_100004799	220
478	3300025242	Ga0209258_100083	Ga0209258_100083110	220
479	3300025246	Ga0209646_1000061	Ga0209646_1000061190	220
480	3300025246	Ga0209646_1000074	Ga0209646_100007487	220
481	3300025250	Ga0209026_1000058	Ga0209026_1000058116	220
482	3300025250	Ga0209026_1000462	Ga0209026_100046220	220
483	3300025256	Ga0209759_1000046	Ga0209759_1000046115	220
484	3300025256	Ga0209759_1000371	Ga0209759_100037142	220
485	3300025256	Ga0209759_1008760	Ga0209759_10087602	220
486	3300025913	Ga0207695_10031413	Ga0207695_100314133	220
487	3300025945	Ga0207679_10000001	Ga0207679_10000001358	220
488	3300026067	Ga0207678_10000001	Ga0207678_1000000176	220
489	3300026078	Ga0207702_10000009	Ga0207702_10000009152	220
490	3300026116	Ga0207674_10001809	Ga0207674_1000180927	220
491	3300044765	Ga0466970_0015516	Ga0466970_0015516_2797_3459	220
492	3300045049	Ga0466959_0010455	Ga0466959_0010455_3360_4022	220
493	3300048924	Ga0496121_0010557	Ga0496121_0010557_2956_3654	220
494	3300048928	Ga0496125_0003735	Ga0496125_0003735_8813_9475	220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00694

Aconitase_C

Aconitase C-terminal domain

15

136

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3q3w-assembly1.cif.gz_A	isopropylmalate isomerase small subunit from campylobacter jejuni.	0.9476	1	174
3h5j-assembly1.cif.gz_A	leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis	0.9453	5	174
3h5j-assembly1.cif.gz_A	leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis	0.9184	5	174
3q3w-assembly1.cif.gz_A	isopropylmalate isomerase small subunit from campylobacter jejuni.	0.9169	1	174
3h5e-assembly2.cif.gz_B	leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis	0.9135	5	161

ID	Description	Score	Start	End	Superfamily
af_O14289_535_712_3.20.19.10	Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4	0.9603	5	177	3.20.19.10
af_Q2FWK0_1_171_3.20.19.10	Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4	0.9556	5	174	3.20.19.10
3q3wA00	Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4	0.9519	6	174	3.20.19.10
3h5jA00	Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4	0.9453	5	174	3.20.19.10
af_O14289_535_712_3.20.19.10	Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4	0.9186	5	177	3.20.19.10

ID	Description	Score	Start	End	GO Terms
AF-A0A4U3APZ6-F1-model_v4	deleted	0.9839	42	122
AF-A0A840RQA2-F1-model_v4	3-isopropylmalate dehydratase (EC 4.2.1.33)	0.9825	7	110	GO:0003861 GO:0009098 GO:0009316
AF-A0A5R8QTF1-F1-model_v4	deleted	0.9778	9	129
AF-A0A7K2L3S6-F1-model_v4	3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (Isopropylmalate isomerase)	0.9746	9	131	GO:0003861 GO:0009098 GO:0009316
AF-A0A3D5PKX6-F1-model_v4	3-isopropylmalate dehydratase (EC 4.2.1.33)	0.9733	7	111	GO:0003861 GO:0009098 GO:0009316

Feature Viewer

pLDDT	pTM	Quality
92.95	0.85	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F454575

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00694

Aconitase_C

Aconitase C-terminal domain

15

136

0.94

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map