F454493

General Info

Members Datasets Scaffolds Average Seq Length
493 272 986 207

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0150872|Ga0501071_0150872_140_826
Length 228
Sequence LGILTIGGGLLERPTGKEEDRAVETAVTSDPQLIRRMLAGDERAFDAFFNAYFPRVYRFALPRLNGDVDATREVVQATLEKAMRKLESYRGESGLFTWICQICRNEIVDYIRARRRMRHVVLIDDEPELRAAIESIEAPEEFDLAKSYGRAESARIVRVVLDRLPSTYGDALEWKYIEGQSVEAIGKRLGIGTIAAQSLLARARRAFREGLEAVFGADVSDVASGLGT

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
160 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
161 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
162 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
163 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
177 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
178 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
183 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
186 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
189 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
190 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
191 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
192 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
193 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
194 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
195 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
198 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
199 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
200 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
201 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
204 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
205 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
255 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
256 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
257 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
258 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
259 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
260 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
261 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
262 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
263 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
264 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
265 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
266 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
267 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
268 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
269 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.46
Nodule 0
Rhizoplane 1.83
Rhizosphere 91.68
Stem 0
Stem Tuber 0
Unclassified 23.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0150872 3300049587 Unclassified 1734
2 SwRhRL2b_contig_3698141 2162886007 Bacteria 1209
3 rootL2_10298356 3300003322 Bacteria 2421
4 Ga0058860_12124329 3300004801 Bacteria 2269
5 Ga0065704_10083563 3300005289 Bacteria 3448
6 Ga0065704_10140470 3300005289 Unclassified 1523
7 Ga0065712_10291990 3300005290 Unclassified 874
8 Ga0065715_10265027 3300005293 Bacteria 1127
9 Ga0065707_10081853 3300005295 Bacteria 33687
10 Ga0065707_10109610 3300005295 Unclassified 2463
11 Ga0070658_10684847 3300005327 Bacteria 890
12 Ga0070676_10002929 3300005328 Bacteria 8813
13 Ga0070683_100141216 3300005329 Bacteria 2282
14 Ga0070690_100001080 3300005330 Bacteria 13989
15 Ga0070670_100166557 3300005331 Unclassified 1911
16 Ga0070677_10089885 3300005333 Unclassified 1333
17 Ga0068869_100000378 3300005334 Bacteria 24145
18 Ga0068869_100085253 3300005334 Bacteria 2366
19 Ga0070666_10104483 3300005335 Bacteria 1955
20 Ga0070666_10320413 3300005335 Bacteria 1106
21 Ga0070680_100006468 3300005336 Bacteria 8909
22 Ga0070680_100527580 3300005336 Bacteria 1011
23 Ga0070682_100052663 3300005337 Bacteria 2548
24 Ga0068868_100085863 3300005338 Bacteria 2529
25 Ga0068868_100730741 3300005338 Unclassified 888
26 Ga0070689_100004860 3300005340 Bacteria 9122
27 Ga0070689_100008614 3300005340 Bacteria 7192
28 Ga0070687_100151670 3300005343 Bacteria 1361
29 Ga0070661_100100560 3300005344 Bacteria 2150
30 Ga0070668_100027804 3300005347 Bacteria 4293
31 Ga0070668_100288866 3300005347 Bacteria 1372
32 Ga0070668_100646210 3300005347 Unclassified 929
33 Ga0070669_100052835 3300005353 Bacteria 2974
34 Ga0070669_100340001 3300005353 Bacteria 1216
35 Ga0070675_100004499 3300005354 Bacteria 10648
36 Ga0070675_100042114 3300005354 Bacteria 3730
37 Ga0070675_100813777 3300005354 Bacteria 854
38 Ga0070671_100250312 3300005355 Unclassified 1505
39 Ga0070674_100348893 3300005356 Bacteria 1195
40 Ga0070673_100322873 3300005364 Bacteria 1364
41 Ga0070673_100334495 3300005364 Bacteria 1340
42 Ga0070688_100010348 3300005365 Bacteria 5140
43 Ga0070659_100160988 3300005366 Unclassified 1835
44 Ga0070667_100000184 3300005367 Bacteria 75408
45 Ga0070667_100619866 3300005367 Bacteria 997
46 Ga0070667_101058412 3300005367 Bacteria 758
47 Ga0070713_100054022 3300005436 Unclassified 3331
48 Ga0070705_100368008 3300005440 Bacteria 1054
49 Ga0070705_100451738 3300005440 Bacteria 964
50 Ga0070700_100152257 3300005441 Bacteria 1583
51 Ga0070700_100163239 3300005441 Bacteria 1536
52 Ga0070700_100454096 3300005441 Bacteria 976
53 Ga0070694_100389585 3300005444 Bacteria 1088
54 Ga0070663_100442053 3300005455 Bacteria 1070
55 Ga0070663_100462259 3300005455 Bacteria 1048
56 Ga0070662_100007151 3300005457 Bacteria 7229
57 Ga0070662_100318360 3300005457 Bacteria 1268
58 Ga0070662_100466633 3300005457 Unclassified 1050
59 Ga0070681_10000323 3300005458 Bacteria 38975
60 Ga0070681_10007110 3300005458 Bacteria 10899
61 Ga0070681_10020994 3300005458 Bacteria 6543
62 Ga0070681_10023146 3300005458 Bacteria 6249
63 Ga0068867_100042697 3300005459 Unclassified 3318
64 Ga0070685_10013620 3300005466 Bacteria 4294
65 Ga0070679_100001069 3300005530 Bacteria 23921
66 Ga0070679_100015949 3300005530 Bacteria 7233
67 Ga0070679_100018417 3300005530 Bacteria 6776
68 Ga0070679_100139127 3300005530 Unclassified 2408
69 Ga0070679_100471372 3300005530 Bacteria 1200
70 Ga0070684_100085354 3300005535 Bacteria 2800
71 Ga0068853_100087229 3300005539 Unclassified 2738
72 Ga0070672_100311215 3300005543 Bacteria 1337
73 Ga0070672_100572439 3300005543 Unclassified 982
74 Ga0070672_100900596 3300005543 Bacteria 781
75 Ga0070686_100031491 3300005544 Bacteria 3243
76 Ga0070695_100302520 3300005545 Unclassified 1183
77 Ga0070696_100320092 3300005546 Unclassified 1193
78 Ga0070696_100629455 3300005546 Bacteria 868
79 Ga0070693_100431136 3300005547 Bacteria 921
80 Ga0070665_100007847 3300005548 Bacteria 10826
81 Ga0070665_100013616 3300005548 Bacteria 8180
82 Ga0068855_100005217 3300005563 Bacteria 15847
83 Ga0068855_100014584 3300005563 Bacteria 9465
84 Ga0070664_100004338 3300005564 Bacteria 11403
85 Ga0070664_100007840 3300005564 Bacteria 8624
86 Ga0070664_100091216 3300005564 Bacteria 2638
87 Ga0068857_100004255 3300005577 Bacteria 12063
88 Ga0068857_100016803 3300005577 Bacteria 6411
89 Ga0068857_100075477 3300005577 Bacteria 3006
90 Ga0068857_100239950 3300005577 Bacteria 1659
91 Ga0068856_100032740 3300005614 Bacteria 5091
92 Ga0070702_100114524 3300005615 Bacteria 1678
93 Ga0070702_100115229 3300005615 Unclassified 1673
94 Ga0068852_100902334 3300005616 Bacteria 901
95 Ga0068859_100002788 3300005617 Bacteria 17702
96 Ga0068859_100342345 3300005617 Unclassified 1589
97 Ga0068859_101122707 3300005617 Unclassified 865
98 Ga0068864_100002940 3300005618 Bacteria 14089
99 Ga0068864_100265807 3300005618 Bacteria 1597
100 Ga0068864_100434849 3300005618 Unclassified 1252
101 Ga0068861_100000625 3300005719 Bacteria 20920
102 Ga0068861_100184961 3300005719 Bacteria 1737
103 Ga0068861_100214154 3300005719 Bacteria 1624
104 Ga0068861_100528724 3300005719 Unclassified 1071
105 Ga0068870_10093366 3300005840 Bacteria 1687
106 Ga0068863_100005489 3300005841 Bacteria 12481
107 Ga0068863_100157827 3300005841 Unclassified 2172
108 Ga0068858_100298986 3300005842 Unclassified 1535
109 Ga0068858_100332191 3300005842 Bacteria 1454
110 Ga0068858_100449688 3300005842 Unclassified 1241
111 Ga0068860_100045086 3300005843 Bacteria 4204
112 Ga0068860_100770275 3300005843 Bacteria 975
113 Ga0068862_100004063 3300005844 Bacteria 12406
114 Ga0068862_100025276 3300005844 Bacteria 4986
115 Ga0068862_100047140 3300005844 Unclassified 3677
116 Ga0068862_100447727 3300005844 Bacteria 1217
117 Ga0081455_10000356 3300005937 Bacteria 60378
118 Ga0081539_10000055 3300005985 Bacteria 257359
119 Ga0097621_100476303 3300006237 Bacteria 1128
120 Ga0068871_100460691 3300006358 Bacteria 1141
121 Ga0075428_100019662 3300006844 Bacteria 7472
122 Ga0075428_100198789 3300006844 Bacteria 2168
123 Ga0075430_100003183 3300006846 Bacteria 13751
124 Ga0075430_100222329 3300006846 Bacteria 1567
125 Ga0075431_100001535 3300006847 Bacteria 21396
126 Ga0075431_100013346 3300006847 Bacteria 8301
127 Ga0075431_100044421 3300006847 Bacteria 4584
128 Ga0075431_100058986 3300006847 Bacteria 3961
129 Ga0075433_10000413 3300006852 Bacteria 27217
130 Ga0075433_10928478 3300006852 Unclassified 759
131 Ga0075434_100007326 3300006871 Bacteria 10210
132 Ga0075429_100005655 3300006880 Bacteria 10781
133 Ga0075429_100013726 3300006880 Bacteria 7023
134 Ga0068865_100757025 3300006881 Bacteria 835
135 Ga0097620_100002788 3300006931 Bacteria 17702
136 Ga0097620_100342352 3300006931 Unclassified 1589
137 Ga0097620_101122701 3300006931 Unclassified 865
138 Ga0075435_100065534 3300007076 Bacteria 2953
139 Ga0105240_10010120 3300009093 Bacteria 13272
140 Ga0105240_10044126 3300009093 Bacteria 5668
141 Ga0105240_11234827 3300009093 Unclassified 790
142 Ga0111539_10005547 3300009094 Bacteria 16314
143 Ga0111539_10010763 3300009094 Bacteria 11513
144 Ga0111539_10053264 3300009094 Bacteria 4816
145 Ga0111539_10065620 3300009094 Bacteria 4288
146 Ga0111539_10091736 3300009094 Unclassified 3569
147 Ga0111539_10110830 3300009094 Unclassified 3221
148 Ga0105247_10053997 3300009101 Bacteria 2479
149 Ga0105247_10069414 3300009101 Bacteria 2199
150 Ga0114129_10004781 3300009147 Bacteria 19140
151 Ga0114129_10025018 3300009147 Bacteria 8464
152 Ga0114129_10126357 3300009147 Bacteria 3515
153 Ga0114129_11504448 3300009147 Bacteria 827
154 Ga0105243_10047059 3300009148 Unclassified 3395
155 Ga0105241_10307775 3300009174 Bacteria 1362
156 Ga0105242_10903988 3300009176 Unclassified 883
157 Ga0105248_10003655 3300009177 Bacteria 17069
158 Ga0105248_10024115 3300009177 Bacteria 6761
159 Ga0105248_10130937 3300009177 Bacteria 2830
160 Ga0105237_10121880 3300009545 Bacteria 2602
161 Ga0105238_10003589 3300009551 Bacteria 15466
162 Ga0105238_10021150 3300009551 Bacteria 6631
163 Ga0105238_10050807 3300009551 Unclassified 4173
164 Ga0105238_10083071 3300009551 Bacteria 3193
165 Ga0105238_10507883 3300009551 Unclassified 1207
166 Ga0105249_10006084 3300009553 Bacteria 10461
167 Ga0105249_10063778 3300009553 Bacteria 3386
168 Ga0105249_11249222 3300009553 Bacteria 814
169 Ga0105239_10203296 3300010375 Bacteria 2219
170 Ga0105239_11038335 3300010375 Bacteria 943
171 Ga0105246_10662424 3300011119 Bacteria 910
172 Ga0157373_10472204 3300013100 Bacteria 904
173 Ga0157370_10020164 3300013104 Bacteria 6664
174 Ga0157370_10409312 3300013104 Bacteria 1248
175 Ga0157369_10007162 3300013105 Bacteria 12855
176 Ga0157374_10268521 3300013296 Bacteria 1682
177 Ga0157378_10271758 3300013297 Bacteria 1630
178 Ga0157378_10678784 3300013297 Bacteria 1048
179 Ga0163162_10053172 3300013306 Bacteria 4070
180 Ga0163162_10211241 3300013306 Bacteria 2070
181 Ga0163162_10548521 3300013306 Bacteria 1284
182 Ga0157375_10033104 3300013308 Bacteria 4908
183 Ga0157375_10040119 3300013308 Bacteria 4511
184 Ga0157375_10040740 3300013308 Bacteria 4481
185 Ga0163163_10005174 3300014325 Bacteria 11249
186 Ga0163163_10016480 3300014325 Bacteria 6871
187 Ga0163163_10038738 3300014325 Bacteria 4647
188 Ga0157380_10001416 3300014326 Bacteria 15688
189 Ga0157380_10002475 3300014326 Bacteria 12451
190 Ga0157380_10084961 3300014326 Bacteria 2596
191 Ga0157380_11167413 3300014326 Bacteria 812
192 Ga0157377_10006188 3300014745 Bacteria 5689
193 Ga0157379_10113067 3300014968 Bacteria 2440
194 Ga0157376_10109644 3300014969 Bacteria 2427
195 Ga0206356_11724706 3300020070 Unclassified 1438
196 Ga0224712_10149350 3300022467 Bacteria 1034
197 Ga0207710_10182745 3300025900 Unclassified 1029
198 Ga0207710_10191006 3300025900 Unclassified 1008
199 Ga0207688_10087436 3300025901 Bacteria 1787
200 Ga0207680_10063527 3300025903 Bacteria 2260
201 Ga0207645_10010605 3300025907 Bacteria 6321
202 Ga0207643_10092889 3300025908 Bacteria 1761
203 Ga0207705_10482720 3300025909 Bacteria 962
204 Ga0207707_10000221 3300025912 Bacteria 61275
205 Ga0207707_10004019 3300025912 Bacteria 13052
206 Ga0207707_10016975 3300025912 Bacteria 6342
207 Ga0207707_10336415 3300025912 Bacteria 1302
208 Ga0207707_10423431 3300025912 Bacteria 1141
209 Ga0207695_10045623 3300025913 Bacteria 4651
210 Ga0207671_10040089 3300025914 Bacteria 3467
211 Ga0207660_10005539 3300025917 Bacteria 8203
212 Ga0207660_10010574 3300025917 Bacteria 5993
213 Ga0207660_10147137 3300025917 Unclassified 1806
214 Ga0207662_10234208 3300025918 Bacteria 1200
215 Ga0207649_10002589 3300025920 Bacteria 10050
216 Ga0207652_10005613 3300025921 Bacteria 10176
217 Ga0207652_10006708 3300025921 Bacteria 9274
218 Ga0207652_10120641 3300025921 Unclassified 2332
219 Ga0207652_10151045 3300025921 Bacteria 2080
220 Ga0207652_10446129 3300025921 Bacteria 1166
221 Ga0207681_10044544 3300025923 Bacteria 2974
222 Ga0207681_10263519 3300025923 Unclassified 1350
223 Ga0207681_10264282 3300025923 Bacteria 1348
224 Ga0207681_10378703 3300025923 Bacteria 1139
225 Ga0207694_10008823 3300025924 Bacteria 7606
226 Ga0207694_10093786 3300025924 Bacteria 2371
227 Ga0207694_10139913 3300025924 Bacteria 1946
228 Ga0207694_10473622 3300025924 Unclassified 1047
229 Ga0207650_10122553 3300025925 Bacteria 2026
230 Ga0207659_10004551 3300025926 Bacteria 8387
231 Ga0207700_10169735 3300025928 Unclassified 1819
232 Ga0207690_10122652 3300025932 Unclassified 1890
233 Ga0207706_10005594 3300025933 Bacteria 11710
234 Ga0207706_10088155 3300025933 Bacteria 2728
235 Ga0207706_10270934 3300025933 Bacteria 1482
236 Ga0207670_10022830 3300025936 Bacteria 3884
237 Ga0207669_10484440 3300025937 Unclassified 987
238 Ga0207704_10632786 3300025938 Bacteria 879
239 Ga0207691_10369615 3300025940 Bacteria 1225
240 Ga0207691_10426046 3300025940 Bacteria 1130
241 Ga0207711_10255254 3300025941 Unclassified 1611
242 Ga0207711_10267438 3300025941 Bacteria 1572
243 Ga0207689_10002103 3300025942 Bacteria 18751
244 Ga0207689_10062352 3300025942 Bacteria 3066
245 Ga0207689_10173590 3300025942 Bacteria 1777
246 Ga0207679_10005491 3300025945 Bacteria 7947
247 Ga0207667_10007520 3300025949 Bacteria 13077
248 Ga0207651_10071003 3300025960 Unclassified 2466
249 Ga0207651_10267254 3300025960 Bacteria 1407
250 Ga0207712_10033372 3300025961 Unclassified 3479
251 Ga0207712_10223619 3300025961 Bacteria 1506
252 Ga0207668_10002558 3300025972 Bacteria 10628
253 Ga0207668_10459818 3300025972 Bacteria 1088
254 Ga0207640_10235786 3300025981 Bacteria 1411
255 Ga0207640_10341685 3300025981 Unclassified 1199
256 Ga0207658_10001013 3300025986 Bacteria 22929
257 Ga0207703_10371108 3300026035 Unclassified 1322
258 Ga0207639_10509524 3300026041 Bacteria 1101
259 Ga0207678_10703029 3300026067 Bacteria 890
260 Ga0207678_10770276 3300026067 Unclassified 849
261 Ga0207708_10009704 3300026075 Bacteria 7142
262 Ga0207708_10350422 3300026075 Bacteria 1211
263 Ga0207708_10579834 3300026075 Bacteria 948
264 Ga0207641_10019712 3300026088 Bacteria 5537
265 Ga0207648_10059163 3300026089 Unclassified 3342
266 Ga0207676_10003329 3300026095 Bacteria 11401
267 Ga0207674_10028437 3300026116 Bacteria 5900
268 Ga0207674_10081247 3300026116 Unclassified 3243
269 Ga0207674_10145028 3300026116 Unclassified 2333
270 Ga0207674_10506588 3300026116 Bacteria 1166
271 Ga0207675_100002001 3300026118 Bacteria 20330
272 Ga0207675_100003583 3300026118 Bacteria 15137
273 Ga0207675_100109089 3300026118 Bacteria 2611
274 Ga0207675_100127598 3300026118 Bacteria 2410
275 Ga0207675_100282089 3300026118 Unclassified 1614
276 Ga0207698_10683319 3300026142 Bacteria 1020
277 Ga0207698_10987059 3300026142 Bacteria 852
278 Ga0209970_1028166 3300027614 Bacteria 969
279 Ga0210002_1007940 3300027617 Bacteria 1613
280 Ga0209998_10074458 3300027717 Bacteria 815
281 Ga0209974_10036860 3300027876 Bacteria 1624
282 Ga0207428_10007733 3300027907 Bacteria 9779
283 Ga0207428_10026632 3300027907 Bacteria 4823
284 Ga0207428_10055804 3300027907 Bacteria 3139
285 Ga0207428_10618740 3300027907 Bacteria 779
286 Ga0268266_10009645 3300028379 Bacteria 8490
287 Ga0268266_10242187 3300028379 Bacteria 1665
288 Ga0268265_10003492 3300028380 Bacteria 11258
289 Ga0268265_10004790 3300028380 Bacteria 9326
290 Ga0268265_10169994 3300028380 Bacteria 1862
291 Ga0268265_10855318 3300028380 Bacteria 890
292 Ga0268264_10113175 3300028381 Bacteria 2380
293 Ga0268264_10211150 3300028381 Bacteria 1782
294 Ga0307517_10244707 3300028786 Unclassified 1060
295 Ga0307513_10033406 3300031456 Bacteria 5783
296 Ga0307509_10016405 3300031507 Bacteria 8573
297 Ga0307509_10421754 3300031507 Bacteria 1035
298 Ga0307408_100009712 3300031548 Bacteria 6340
299 Ga0307408_100038324 3300031548 Bacteria 3381
300 Ga0307408_100233706 3300031548 Bacteria 1507
301 Ga0307514_10279520 3300031649 Unclassified 957
302 Ga0316575_10209200 3300031665 Unclassified 813
303 Ga0316579_10004958 3300031691 Bacteria 5334
304 Ga0316576_10010792 3300031727 Bacteria 5951
305 Ga0316576_10041563 3300031727 Bacteria 3310
306 Ga0316578_10030934 3300031728 Bacteria 3046
307 Ga0316578_10033945 3300031728 Bacteria 2927
308 Ga0307405_10174062 3300031731 Unclassified 1538
309 Ga0307405_10389680 3300031731 Unclassified 1087
310 Ga0316577_10035216 3300031733 Bacteria 2797
311 Ga0307413_10492463 3300031824 Unclassified 982
312 Ga0307413_10642431 3300031824 Unclassified 874
313 Ga0307410_10013123 3300031852 Bacteria 4821
314 Ga0307410_10062772 3300031852 Unclassified 2547
315 Ga0307406_10361159 3300031901 Bacteria 1138
316 Ga0307406_10489517 3300031901 Bacteria 995
317 Ga0307406_10985536 3300031901 Unclassified 722
318 Ga0307407_10367359 3300031903 Unclassified 1023
319 Ga0307407_10383743 3300031903 Unclassified 1004
320 Ga0307412_10024635 3300031911 Bacteria 3716
321 Ga0307412_10105260 3300031911 Bacteria 2004
322 Ga0307412_10255350 3300031911 Bacteria 1363
323 Ga0307412_10489743 3300031911 Bacteria 1021
324 Ga0307409_100170129 3300031995 Bacteria 1917
325 Ga0307409_100385708 3300031995 Bacteria 1333
326 Ga0307416_100070122 3300032002 Unclassified 2904
327 Ga0307416_100172574 3300032002 Unclassified 2015
328 Ga0307416_100214367 3300032002 Bacteria 1840
329 Ga0307414_10941909 3300032004 Unclassified 793
330 Ga0307411_10014510 3300032005 Bacteria 4387
331 Ga0307411_10122953 3300032005 Unclassified 1881
332 Ga0307411_10135085 3300032005 Bacteria 1809
333 Ga0307411_10145511 3300032005 Bacteria 1754
334 Ga0307415_100397318 3300032126 Unclassified 1176
335 Ga0316580_10000357 3300032139 Bacteria 10106
336 Ga0373958_0008717 3300034819 Bacteria 1651
337 Ga0373941_0094127 3300035115 Unclassified 1033
338 Ga0373946_0156055 3300035171 Unclassified 1068
339 Ga0316574_0007301 3300035398 Bacteria 6048
340 Ga0316574_0219148 3300035398 Bacteria 1219
341 Ga0373931_0681374 3300035691 Unclassified 678
342 Ga0316582_0062324 3300036647 Unclassified 2394
343 Ga0316582_0077163 3300036647 Unclassified 2168
344 Ga0316584_0021120 3300036712 Bacteria 4727
345 Ga0316584_0199327 3300036712 Unclassified 1477
346 Ga0373925_0362512 3300037068 Bacteria 1178
347 Ga0439439_0041138 3300041406 Bacteria 1198
348 Ga0439431_0079204 3300041997 Unclassified 884
349 Ga0439448_0035346 3300042005 Bacteria 1600
350 Ga0439448_0110984 3300042005 Bacteria 937
351 Ga0450920_000273 3300042122 Bacteria 7759
352 Ga0450920_013335 3300042122 Unclassified 1547
353 Ga0450923_000581 3300042125 Bacteria 4158
354 Ga0450895_001249 3300042132 Bacteria 1733
355 Ga0450899_002737 3300042135 Bacteria 1906
356 Ga0450900_019152 3300042136 Bacteria 943
357 Ga0450910_018647 3300042147 Bacteria 1038
358 Ga0439446_0024949 3300042156 Unclassified 1708
359 Ga0439446_0040749 3300042156 Bacteria 1367
360 Ga0450908_000783 3300042184 Bacteria 6088
361 Ga0439434_0000836 3300042435 Bacteria 8867
362 Ga0439435_0002142 3300042436 Bacteria 3846
363 Ga0439444_0003357 3300042437 Unclassified 2259
364 Ga0439459_0064873 3300042438 Bacteria 833
365 Ga0439464_0075950 3300042439 Bacteria 999
366 Ga0450916_004104 3300042530 Bacteria 1629
367 Ga0451577_0018004 3300042876 Bacteria 6513
368 Ga0451577_0035709 3300042876 Bacteria 4477
369 Ga0451577_0071477 3300042876 Bacteria 3094
370 Ga0451577_0763478 3300042876 Unclassified 874
371 Ga0466972_0102744 3300044658 Bacteria 1352
372 Ga0453683_0013884 3300044673 Bacteria 5240
373 Ga0466965_0170881 3300044683 Bacteria 1143
374 Ga0453684_0011221 3300044712 Bacteria 15082
375 Ga0453684_0081627 3300044712 Bacteria 4032
376 Ga0453684_0293901 3300044712 Unclassified 1848
377 Ga0453684_0570020 3300044712 Bacteria 1245
378 Ga0453684_0768039 3300044712 Bacteria 1042
379 Ga0453684_0929618 3300044712 Bacteria 929
380 Ga0466968_0118598 3300044735 Bacteria 1196
381 Ga0466957_0602856 3300044842 Unclassified 769
382 Ga0451576_0010131 3300045051 Bacteria 10851
383 Ga0451576_0011274 3300045051 Bacteria 10175
384 Ga0451576_0014759 3300045051 Bacteria 8684
385 Ga0451576_0015233 3300045051 Bacteria 8525
386 Ga0451576_0111793 3300045051 Bacteria 2843
387 Ga0451576_0886811 3300045051 Bacteria 936
388 Ga0495617_127393 3300046452 Bacteria 818
389 Ga0495638_0001523 3300046460 Bacteria 20866
390 Ga0495650_0055729 3300046471 Unclassified 1607
391 Ga0495632_0106342 3300046519 Unclassified 1320
392 Ga0495632_0193600 3300046519 Unclassified 928
393 Ga0495632_0232378 3300046519 Bacteria 831
394 Ga0495668_0432888 3300046616 Unclassified 724
395 Ga0495659_0090345 3300046664 Unclassified 1175
396 Ga0495669_0061232 3300046684 Bacteria 1703
397 Ga0496104_0356678 3300048907 Bacteria 1375
398 Ga0496106_0397806 3300048909 Bacteria 1107
399 Ga0496108_0270807 3300048911 Bacteria 1478
400 Ga0496110_0146530 3300048913 Unclassified 2136
401 Ga0496110_0296665 3300048913 Unclassified 1472
402 Ga0496112_0033043 3300048915 Bacteria 5025
403 Ga0496113_0394305 3300048916 Bacteria 1111
404 Ga0496114_0251599 3300048917 Bacteria 1555
405 Ga0496114_0595026 3300048917 Unclassified 975
406 Ga0496118_0203202 3300048921 Unclassified 1171
407 Ga0496121_0151800 3300048924 Bacteria 1703
408 Ga0496124_0245881 3300048927 Bacteria 1327
409 Ga0501031_0060505 3300049568 Bacteria 2468
410 Ga0501032_0028764 3300049569 Bacteria 3817
411 Ga0501033_0510205 3300049570 Unclassified 831
412 Ga0501034_0419921 3300049571 Bacteria 1259
413 Ga0501036_0007198 3300049572 Bacteria 9066
414 Ga0501036_0140365 3300049572 Unclassified 2039
415 Ga0501039_0010394 3300049575 Bacteria 7094
416 Ga0501039_0552797 3300049575 Bacteria 903
417 Ga0501040_0027095 3300049576 Bacteria 3857
418 Ga0501040_0581966 3300049576 Bacteria 808
419 Ga0501042_0000941 3300049578 Bacteria 16397
420 Ga0501048_0014215 3300049582 Bacteria 5896
421 Ga0501048_0743619 3300049582 Unclassified 704
422 Ga0501068_0043235 3300049584 Bacteria 2710
423 Ga0501070_0462690 3300049586 Bacteria 1022
424 Ga0501071_0014458 3300049587 Bacteria 5398
425 Ga0501071_0051595 3300049587 Unclassified 2965
426 Ga0501071_0092241 3300049587 Bacteria 2226
427 Ga0501075_0021048 3300049591 Unclassified 4752
428 Ga0501075_0158524 3300049591 Bacteria 1726
429 Ga0501076_0020301 3300049592 Bacteria 5085
430 Ga0501077_0349003 3300049593 Unclassified 944
431 Ga0501079_0046574 3300049741 Bacteria 3346
432 Ga0501079_0078086 3300049741 Bacteria 2561
433 Ga0501079_0118235 3300049741 Bacteria 2060
434 Ga0501079_0140618 3300049741 Unclassified 1880
435 Ga0501081_0057777 3300049743 Bacteria 2683
436 Ga0501081_0071698 3300049743 Bacteria 2415
437 Ga0501081_0155467 3300049743 Bacteria 1645
438 Ga0501083_0191757 3300049744 Bacteria 1334
439 Ga0501035_0039354 3300049822 Bacteria 4279
440 Ga0501044_0653770 3300049823 Bacteria 940
441 Ga0501045_0115817 3300049824 Bacteria 1988
442 nmdc:mga05p37_20767_c1 3300050507 Bacteria 7948
443 nmdc:mga05p37_334642_c1 3300050507 Bacteria 1787
444 nmdc:mga05p37_99853_c1 3300050507 Bacteria 3574
445 nmdc:mga09592_12469_c1 3300050508 Bacteria 6925
446 nmdc:mga09592_126927_c1 3300050508 Bacteria 2193
447 nmdc:mga09592_37275_c1 3300050508 Unclassified 4079
448 nmdc:mga09592_568321_c1 3300050508 Bacteria 973
449 nmdc:mga0qj67_187804_c1 3300050509 Bacteria 1679
450 nmdc:mga0qj67_4238_c1 3300050509 Bacteria 10394
451 nmdc:mga0qj67_451442_c1 3300050509 Bacteria 1035
452 nmdc:mga06r32_153849_c1 3300050510 Unclassified 2280
453 nmdc:mga06r32_4725_c1 3300050510 Bacteria 12249
454 nmdc:mga06r32_5407_c1 3300050510 Bacteria 11493
455 nmdc:mga06r32_843712_c1 3300050510 Bacteria 875
456 nmdc:mga08y16_103115_c1 3300050511 Bacteria 2970
457 nmdc:mga08y16_17472_c1 3300050511 Bacteria 7554
458 nmdc:mga08y16_25560_c1 3300050511 Bacteria 6229
459 nmdc:mga08y16_2737_c1 3300050511 Bacteria 18079
460 nmdc:mga08y16_316267_c1 3300050511 Bacteria 1608
461 nmdc:mga08y16_408390_c1 3300050511 Bacteria 1389
462 nmdc:mga0n895_10517_c1 3300050512 Bacteria 8184
463 nmdc:mga0a205_418539_c1 3300050515 Bacteria 1202
464 nmdc:mga0a205_73_c1 3300050515 Bacteria 55159
465 nmdc:mga0a205_897356_c1 3300050515 Unclassified 733
466 Ga0500644_0110428 3300053088 Bacteria 1058
467 Ga0500583_0134597 3300053092 Unclassified 1226
468 Ga0500651_0129981 3300053093 Unclassified 1524
469 Ga0500641_0129604 3300053096 Bacteria 1088
470 Ga0500641_0136142 3300053096 Unclassified 1060
471 Ga0500641_0186843 3300053096 Unclassified 888
472 Ga0500556_0000797 3300053104 Bacteria 18442
473 Ga0500556_0015745 3300053104 Unclassified 2340
474 Ga0500594_0015636 3300053118 Bacteria 1833
475 Ga0500617_172707 3300053124 Bacteria 828
476 Ga0500621_172997 3300053126 Bacteria 790
477 Ga0500642_0134275 3300053130 Bacteria 1160
478 Ga0500658_0034544 3300053134 Unclassified 1996
479 Ga0500577_0121188 3300053142 Bacteria 1089
480 Ga0500588_0009671 3300053146 Bacteria 2301
481 Ga0500588_0024498 3300053146 Unclassified 1666
482 Ga0500616_0000121 3300053153 Bacteria 141754
483 Ga0500616_0056741 3300053153 Bacteria 2043
484 Ga0500622_0001797 3300053156 Bacteria 16360
485 Ga0500622_0001808 3300053156 Bacteria 16311
486 Ga0500637_0240167 3300053178 Bacteria 1016
487 Ga0500611_132653 3300053727 Unclassified 672
488 Ga0501084_0069834 3300054114 Unclassified 2941
489 Ga0501082_0227529 3300060353 Unclassified 1623
490 Ga0501082_0263313 3300060353 Bacteria 1500
491 Ga0501082_0402443 3300060353 Bacteria 1195
492 Ga0501082_0714394 3300060353 Bacteria 877
493 Ga0530510_0108923 3300061734 Unclassified 2028
494 Ga0501071_0150872
495 SwRhRL2b_contig_3698141
496 rootL2_10298356
497 Ga0058860_12124329
498 Ga0065704_10083563
499 Ga0065704_10140470
500 Ga0065712_10291990
501 Ga0065715_10265027
502 Ga0065707_10081853
503 Ga0065707_10109610
504 Ga0070658_10684847
505 Ga0070676_10002929
506 Ga0070683_100141216
507 Ga0070690_100001080
508 Ga0070670_100166557
509 Ga0070677_10089885
510 Ga0068869_100000378
511 Ga0068869_100085253
512 Ga0070666_10104483
513 Ga0070666_10320413
514 Ga0070680_100006468
515 Ga0070680_100527580
516 Ga0070682_100052663
517 Ga0068868_100085863
518 Ga0068868_100730741
519 Ga0070689_100004860
520 Ga0070689_100008614
521 Ga0070687_100151670
522 Ga0070661_100100560
523 Ga0070668_100027804
524 Ga0070668_100288866
525 Ga0070668_100646210
526 Ga0070669_100052835
527 Ga0070669_100340001
528 Ga0070675_100004499
529 Ga0070675_100042114
530 Ga0070675_100813777
531 Ga0070671_100250312
532 Ga0070674_100348893
533 Ga0070673_100322873
534 Ga0070673_100334495
535 Ga0070688_100010348
536 Ga0070659_100160988
537 Ga0070667_100000184
538 Ga0070667_100619866
539 Ga0070667_101058412
540 Ga0070713_100054022
541 Ga0070705_100368008
542 Ga0070705_100451738
543 Ga0070700_100152257
544 Ga0070700_100163239
545 Ga0070700_100454096
546 Ga0070694_100389585
547 Ga0070663_100442053
548 Ga0070663_100462259
549 Ga0070662_100007151
550 Ga0070662_100318360
551 Ga0070662_100466633
552 Ga0070681_10000323
553 Ga0070681_10007110
554 Ga0070681_10020994
555 Ga0070681_10023146
556 Ga0068867_100042697
557 Ga0070685_10013620
558 Ga0070679_100001069
559 Ga0070679_100015949
560 Ga0070679_100018417
561 Ga0070679_100139127
562 Ga0070679_100471372
563 Ga0070684_100085354
564 Ga0068853_100087229
565 Ga0070672_100311215
566 Ga0070672_100572439
567 Ga0070672_100900596
568 Ga0070686_100031491
569 Ga0070695_100302520
570 Ga0070696_100320092
571 Ga0070696_100629455
572 Ga0070693_100431136
573 Ga0070665_100007847
574 Ga0070665_100013616
575 Ga0068855_100005217
576 Ga0068855_100014584
577 Ga0070664_100004338
578 Ga0070664_100007840
579 Ga0070664_100091216
580 Ga0068857_100004255
581 Ga0068857_100016803
582 Ga0068857_100075477
583 Ga0068857_100239950
584 Ga0068856_100032740
585 Ga0070702_100114524
586 Ga0070702_100115229
587 Ga0068852_100902334
588 Ga0068859_100002788
589 Ga0068859_100342345
590 Ga0068859_101122707
591 Ga0068864_100002940
592 Ga0068864_100265807
593 Ga0068864_100434849
594 Ga0068861_100000625
595 Ga0068861_100184961
596 Ga0068861_100214154
597 Ga0068861_100528724
598 Ga0068870_10093366
599 Ga0068863_100005489
600 Ga0068863_100157827
601 Ga0068858_100298986
602 Ga0068858_100332191
603 Ga0068858_100449688
604 Ga0068860_100045086
605 Ga0068860_100770275
606 Ga0068862_100004063
607 Ga0068862_100025276
608 Ga0068862_100047140
609 Ga0068862_100447727
610 Ga0081455_10000356
611 Ga0081539_10000055
612 Ga0097621_100476303
613 Ga0068871_100460691
614 Ga0075428_100019662
615 Ga0075428_100198789
616 Ga0075430_100003183
617 Ga0075430_100222329
618 Ga0075431_100001535
619 Ga0075431_100013346
620 Ga0075431_100044421
621 Ga0075431_100058986
622 Ga0075433_10000413
623 Ga0075433_10928478
624 Ga0075434_100007326
625 Ga0075429_100005655
626 Ga0075429_100013726
627 Ga0068865_100757025
628 Ga0097620_100002788
629 Ga0097620_100342352
630 Ga0097620_101122701
631 Ga0075435_100065534
632 Ga0105240_10010120
633 Ga0105240_10044126
634 Ga0105240_11234827
635 Ga0111539_10005547
636 Ga0111539_10010763
637 Ga0111539_10053264
638 Ga0111539_10065620
639 Ga0111539_10091736
640 Ga0111539_10110830
641 Ga0105247_10053997
642 Ga0105247_10069414
643 Ga0114129_10004781
644 Ga0114129_10025018
645 Ga0114129_10126357
646 Ga0114129_11504448
647 Ga0105243_10047059
648 Ga0105241_10307775
649 Ga0105242_10903988
650 Ga0105248_10003655
651 Ga0105248_10024115
652 Ga0105248_10130937
653 Ga0105237_10121880
654 Ga0105238_10003589
655 Ga0105238_10021150
656 Ga0105238_10050807
657 Ga0105238_10083071
658 Ga0105238_10507883
659 Ga0105249_10006084
660 Ga0105249_10063778
661 Ga0105249_11249222
662 Ga0105239_10203296
663 Ga0105239_11038335
664 Ga0105246_10662424
665 Ga0157373_10472204
666 Ga0157370_10020164
667 Ga0157370_10409312
668 Ga0157369_10007162
669 Ga0157374_10268521
670 Ga0157378_10271758
671 Ga0157378_10678784
672 Ga0163162_10053172
673 Ga0163162_10211241
674 Ga0163162_10548521
675 Ga0157375_10033104
676 Ga0157375_10040119
677 Ga0157375_10040740
678 Ga0163163_10005174
679 Ga0163163_10016480
680 Ga0163163_10038738
681 Ga0157380_10001416
682 Ga0157380_10002475
683 Ga0157380_10084961
684 Ga0157380_11167413
685 Ga0157377_10006188
686 Ga0157379_10113067
687 Ga0157376_10109644
688 Ga0206356_11724706
689 Ga0224712_10149350
690 Ga0207710_10182745
691 Ga0207710_10191006
692 Ga0207688_10087436
693 Ga0207680_10063527
694 Ga0207645_10010605
695 Ga0207643_10092889
696 Ga0207705_10482720
697 Ga0207707_10000221
698 Ga0207707_10004019
699 Ga0207707_10016975
700 Ga0207707_10336415
701 Ga0207707_10423431
702 Ga0207695_10045623
703 Ga0207671_10040089
704 Ga0207660_10005539
705 Ga0207660_10010574
706 Ga0207660_10147137
707 Ga0207662_10234208
708 Ga0207649_10002589
709 Ga0207652_10005613
710 Ga0207652_10006708
711 Ga0207652_10120641
712 Ga0207652_10151045
713 Ga0207652_10446129
714 Ga0207681_10044544
715 Ga0207681_10263519
716 Ga0207681_10264282
717 Ga0207681_10378703
718 Ga0207694_10008823
719 Ga0207694_10093786
720 Ga0207694_10139913
721 Ga0207694_10473622
722 Ga0207650_10122553
723 Ga0207659_10004551
724 Ga0207700_10169735
725 Ga0207690_10122652
726 Ga0207706_10005594
727 Ga0207706_10088155
728 Ga0207706_10270934
729 Ga0207670_10022830
730 Ga0207669_10484440
731 Ga0207704_10632786
732 Ga0207691_10369615
733 Ga0207691_10426046
734 Ga0207711_10255254
735 Ga0207711_10267438
736 Ga0207689_10002103
737 Ga0207689_10062352
738 Ga0207689_10173590
739 Ga0207679_10005491
740 Ga0207667_10007520
741 Ga0207651_10071003
742 Ga0207651_10267254
743 Ga0207712_10033372
744 Ga0207712_10223619
745 Ga0207668_10002558
746 Ga0207668_10459818
747 Ga0207640_10235786
748 Ga0207640_10341685
749 Ga0207658_10001013
750 Ga0207703_10371108
751 Ga0207639_10509524
752 Ga0207678_10703029
753 Ga0207678_10770276
754 Ga0207708_10009704
755 Ga0207708_10350422
756 Ga0207708_10579834
757 Ga0207641_10019712
758 Ga0207648_10059163
759 Ga0207676_10003329
760 Ga0207674_10028437
761 Ga0207674_10081247
762 Ga0207674_10145028
763 Ga0207674_10506588
764 Ga0207675_100002001
765 Ga0207675_100003583
766 Ga0207675_100109089
767 Ga0207675_100127598
768 Ga0207675_100282089
769 Ga0207698_10683319
770 Ga0207698_10987059
771 Ga0209970_1028166
772 Ga0210002_1007940
773 Ga0209998_10074458
774 Ga0209974_10036860
775 Ga0207428_10007733
776 Ga0207428_10026632
777 Ga0207428_10055804
778 Ga0207428_10618740
779 Ga0268266_10009645
780 Ga0268266_10242187
781 Ga0268265_10003492
782 Ga0268265_10004790
783 Ga0268265_10169994
784 Ga0268265_10855318
785 Ga0268264_10113175
786 Ga0268264_10211150
787 Ga0307517_10244707
788 Ga0307513_10033406
789 Ga0307509_10016405
790 Ga0307509_10421754
791 Ga0307408_100009712
792 Ga0307408_100038324
793 Ga0307408_100233706
794 Ga0307514_10279520
795 Ga0316575_10209200
796 Ga0316579_10004958
797 Ga0316576_10010792
798 Ga0316576_10041563
799 Ga0316578_10030934
800 Ga0316578_10033945
801 Ga0307405_10174062
802 Ga0307405_10389680
803 Ga0316577_10035216
804 Ga0307413_10492463
805 Ga0307413_10642431
806 Ga0307410_10013123
807 Ga0307410_10062772
808 Ga0307406_10361159
809 Ga0307406_10489517
810 Ga0307406_10985536
811 Ga0307407_10367359
812 Ga0307407_10383743
813 Ga0307412_10024635
814 Ga0307412_10105260
815 Ga0307412_10255350
816 Ga0307412_10489743
817 Ga0307409_100170129
818 Ga0307409_100385708
819 Ga0307416_100070122
820 Ga0307416_100172574
821 Ga0307416_100214367
822 Ga0307414_10941909
823 Ga0307411_10014510
824 Ga0307411_10122953
825 Ga0307411_10135085
826 Ga0307411_10145511
827 Ga0307415_100397318
828 Ga0316580_10000357
829 Ga0373958_0008717
830 Ga0373941_0094127
831 Ga0373946_0156055
832 Ga0316574_0007301
833 Ga0316574_0219148
834 Ga0373931_0681374
835 Ga0316582_0062324
836 Ga0316582_0077163
837 Ga0316584_0021120
838 Ga0316584_0199327
839 Ga0373925_0362512
840 Ga0439439_0041138
841 Ga0439431_0079204
842 Ga0439448_0035346
843 Ga0439448_0110984
844 Ga0450920_000273
845 Ga0450920_013335
846 Ga0450923_000581
847 Ga0450895_001249
848 Ga0450899_002737
849 Ga0450900_019152
850 Ga0450910_018647
851 Ga0439446_0024949
852 Ga0439446_0040749
853 Ga0450908_000783
854 Ga0439434_0000836
855 Ga0439435_0002142
856 Ga0439444_0003357
857 Ga0439459_0064873
858 Ga0439464_0075950
859 Ga0450916_004104
860 Ga0451577_0018004
861 Ga0451577_0035709
862 Ga0451577_0071477
863 Ga0451577_0763478
864 Ga0466972_0102744
865 Ga0453683_0013884
866 Ga0466965_0170881
867 Ga0453684_0011221
868 Ga0453684_0081627
869 Ga0453684_0293901
870 Ga0453684_0570020
871 Ga0453684_0768039
872 Ga0453684_0929618
873 Ga0466968_0118598
874 Ga0466957_0602856
875 Ga0451576_0010131
876 Ga0451576_0011274
877 Ga0451576_0014759
878 Ga0451576_0015233
879 Ga0451576_0111793
880 Ga0451576_0886811
881 Ga0495617_127393
882 Ga0495638_0001523
883 Ga0495650_0055729
884 Ga0495632_0106342
885 Ga0495632_0193600
886 Ga0495632_0232378
887 Ga0495668_0432888
888 Ga0495659_0090345
889 Ga0495669_0061232
890 Ga0496104_0356678
891 Ga0496106_0397806
892 Ga0496108_0270807
893 Ga0496110_0146530
894 Ga0496110_0296665
895 Ga0496112_0033043
896 Ga0496113_0394305
897 Ga0496114_0251599
898 Ga0496114_0595026
899 Ga0496118_0203202
900 Ga0496121_0151800
901 Ga0496124_0245881
902 Ga0501031_0060505
903 Ga0501032_0028764
904 Ga0501033_0510205
905 Ga0501034_0419921
906 Ga0501036_0007198
907 Ga0501036_0140365
908 Ga0501039_0010394
909 Ga0501039_0552797
910 Ga0501040_0027095
911 Ga0501040_0581966
912 Ga0501042_0000941
913 Ga0501048_0014215
914 Ga0501048_0743619
915 Ga0501068_0043235
916 Ga0501070_0462690
917 Ga0501071_0014458
918 Ga0501071_0051595
919 Ga0501071_0092241
920 Ga0501075_0021048
921 Ga0501075_0158524
922 Ga0501076_0020301
923 Ga0501077_0349003
924 Ga0501079_0046574
925 Ga0501079_0078086
926 Ga0501079_0118235
927 Ga0501079_0140618
928 Ga0501081_0057777
929 Ga0501081_0071698
930 Ga0501081_0155467
931 Ga0501083_0191757
932 Ga0501035_0039354
933 Ga0501044_0653770
934 Ga0501045_0115817
935 nmdc:mga05p37_20767_c1
936 nmdc:mga05p37_334642_c1
937 nmdc:mga05p37_99853_c1
938 nmdc:mga09592_12469_c1
939 nmdc:mga09592_126927_c1
940 nmdc:mga09592_37275_c1
941 nmdc:mga09592_568321_c1
942 nmdc:mga0qj67_187804_c1
943 nmdc:mga0qj67_4238_c1
944 nmdc:mga0qj67_451442_c1
945 nmdc:mga06r32_153849_c1
946 nmdc:mga06r32_4725_c1
947 nmdc:mga06r32_5407_c1
948 nmdc:mga06r32_843712_c1
949 nmdc:mga08y16_103115_c1
950 nmdc:mga08y16_17472_c1
951 nmdc:mga08y16_25560_c1
952 nmdc:mga08y16_2737_c1
953 nmdc:mga08y16_316267_c1
954 nmdc:mga08y16_408390_c1
955 nmdc:mga0n895_10517_c1
956 nmdc:mga0a205_418539_c1
957 nmdc:mga0a205_73_c1
958 nmdc:mga0a205_897356_c1
959 Ga0500644_0110428
960 Ga0500583_0134597
961 Ga0500651_0129981
962 Ga0500641_0129604
963 Ga0500641_0136142
964 Ga0500641_0186843
965 Ga0500556_0000797
966 Ga0500556_0015745
967 Ga0500594_0015636
968 Ga0500617_172707
969 Ga0500621_172997
970 Ga0500642_0134275
971 Ga0500658_0034544
972 Ga0500577_0121188
973 Ga0500588_0009671
974 Ga0500588_0024498
975 Ga0500616_0000121
976 Ga0500616_0056741
977 Ga0500622_0001797
978 Ga0500622_0001808
979 Ga0500637_0240167
980 Ga0500611_132653
981 Ga0501084_0069834
982 Ga0501082_0227529
983 Ga0501082_0263313
984 Ga0501082_0402443
985 Ga0501082_0714394
986 Ga0530510_0108923

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

154

207

0.95

PF04542

Sigma70_r2

Sigma-70 region 2

48

117

0.91

Map