F454490

General Info

Members Datasets Scaffolds Average Seq Length
493 257 986 67

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0009673|Ga0501036_0009673_4444_4692
Length 82
Sequence VRITPRSGHGKERIMGRIRVGRPDVRPDTPTHVPGLHQGNYGPYRRQPGHHRDGTSDARRSTGIHWKKHDAIMKTMPNISPG

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
115 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
183 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
195 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
196 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
197 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
198 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
199 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
200 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
201 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.05
Metatranscriptomes 10.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 5.88
Rhizosphere 90.87
Stem 0
Stem Tuber 0
Unclassified 12.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0009673 3300049572 Bacteria 7932
2 MBSR1b_contig_1594211 2162886012 Unclassified 984
3 MBSR1b_contig_6396654 2162886012 Unclassified 1437
4 JGI25153J46596_10131710 3300003215 Unclassified 553
5 rootL2_10006344 3300003322 Bacteria 2250
6 rootH1_10389504 3300003323 Bacteria 1505
7 Ga0058863_11800350 3300004799 Unclassified 763
8 Ga0058863_11910298 3300004799 Unclassified 829
9 Ga0058861_11722610 3300004800 Unclassified 534
10 Ga0058862_12495806 3300004803 Unclassified 679
11 Ga0065712_10391882 3300005290 Unclassified 740
12 Ga0065715_10015352 3300005293 Bacteria 2007
13 Ga0070658_10318157 3300005327 Bacteria 1329
14 Ga0070676_10822355 3300005328 Bacteria 687
15 Ga0070683_100291791 3300005329 Bacteria 1551
16 Ga0070683_100939685 3300005329 Bacteria 830
17 Ga0070690_100167383 3300005330 Bacteria 1510
18 Ga0070670_102244539 3300005331 Bacteria 503
19 Ga0068869_100610843 3300005334 Bacteria 922
20 Ga0070680_101086096 3300005336 Unclassified 691
21 Ga0070682_100506039 3300005337 Bacteria 937
22 Ga0070682_100789350 3300005337 Archaea 770
23 Ga0070682_101487787 3300005337 Bacteria 582
24 Ga0068868_100091119 3300005338 Bacteria 2456
25 Ga0068868_100173160 3300005338 Bacteria 1787
26 Ga0068868_101375571 3300005338 Bacteria 658
27 Ga0070660_100087410 3300005339 Bacteria 2454
28 Ga0070660_100409478 3300005339 Bacteria 1122
29 Ga0070689_100081711 3300005340 Bacteria 2537
30 Ga0070689_100173857 3300005340 Unclassified 1746
31 Ga0070689_101131343 3300005340 Bacteria 701
32 Ga0070691_10349358 3300005341 Bacteria 821
33 Ga0070687_100146129 3300005343 Bacteria 1382
34 Ga0070661_100261890 3300005344 Bacteria 1337
35 Ga0070692_10145409 3300005345 Bacteria 1346
36 Ga0070668_100128140 3300005347 Bacteria 2034
37 Ga0070669_100761903 3300005353 Bacteria 821
38 Ga0070675_100169852 3300005354 Bacteria 1880
39 Ga0070671_101116993 3300005355 Bacteria 692
40 Ga0070673_100851536 3300005364 Bacteria 844
41 Ga0070688_100071662 3300005365 Bacteria 2219
42 Ga0070659_100121793 3300005366 Bacteria 2114
43 Ga0070659_100573033 3300005366 Bacteria 968
44 Ga0070667_100737798 3300005367 Unclassified 912
45 Ga0070714_101717587 3300005435 Unclassified 613
46 Ga0070713_101666123 3300005436 Unclassified 619
47 Ga0070701_10545743 3300005438 Bacteria 760
48 Ga0070711_100287081 3300005439 Bacteria 1304
49 Ga0070700_100096531 3300005441 Bacteria 1939
50 Ga0070700_100309965 3300005441 Bacteria 1155
51 Ga0070694_101031227 3300005444 Bacteria 684
52 Ga0070708_102210763 3300005445 Bacteria 508
53 Ga0070663_100498488 3300005455 Bacteria 1011
54 Ga0070678_100575641 3300005456 Bacteria 1003
55 Ga0070662_101122458 3300005457 Bacteria 675
56 Ga0068867_100139929 3300005459 Bacteria 1891
57 Ga0070685_10106331 3300005466 Unclassified 1722
58 Ga0070679_100110954 3300005530 Bacteria 2729
59 Ga0070679_100170161 3300005530 Bacteria 2152
60 Ga0070679_101112575 3300005530 Bacteria 735
61 Ga0070684_100146192 3300005535 Bacteria 2140
62 Ga0070684_100779004 3300005535 Bacteria 894
63 Ga0070684_101518467 3300005535 Unclassified 631
64 Ga0070697_100482738 3300005536 Bacteria 1082
65 Ga0070697_101449769 3300005536 Bacteria 613
66 Ga0068853_100161563 3300005539 Bacteria 2022
67 Ga0070672_100283728 3300005543 Unclassified 1401
68 Ga0070686_100057145 3300005544 Bacteria 2505
69 Ga0070695_101016197 3300005545 Bacteria 675
70 Ga0070696_100090643 3300005546 Unclassified 2176
71 Ga0070693_100268614 3300005547 Bacteria 1138
72 Ga0070693_100526507 3300005547 Bacteria 842
73 Ga0070665_102045597 3300005548 Bacteria 578
74 Ga0070704_100310923 3300005549 Bacteria 1317
75 Ga0070664_100092640 3300005564 Bacteria 2617
76 Ga0068854_100392983 3300005578 Unclassified 1146
77 Ga0070702_100076134 3300005615 Bacteria 1996
78 Ga0068852_100259229 3300005616 Bacteria 1669
79 Ga0068852_100602626 3300005616 Bacteria 1103
80 Ga0068859_100555250 3300005617 Bacteria 1243
81 Ga0068864_100747009 3300005618 Bacteria 958
82 Ga0068866_10132412 3300005718 Unclassified 1420
83 Ga0068861_100034856 3300005719 Bacteria 3724
84 Ga0068863_101794830 3300005841 Bacteria 623
85 Ga0068858_100206028 3300005842 Bacteria 1861
86 Ga0068860_100838696 3300005843 Bacteria 934
87 Ga0068862_100117195 3300005844 Bacteria 2343
88 Ga0081455_10532937 3300005937 Bacteria 781
89 Ga0075363_100729856 3300006048 Unclassified 599
90 Ga0070715_10200272 3300006163 Archaea 1014
91 Ga0070716_100286884 3300006173 Bacteria 1139
92 Ga0070712_100056394 3300006175 Bacteria 2756
93 Ga0097621_100458949 3300006237 Unclassified 1149
94 Ga0075370_10968410 3300006353 Bacteria 521
95 Ga0075431_101067810 3300006847 Bacteria 773
96 Ga0075433_10441653 3300006852 Unclassified 1147
97 Ga0075433_10662522 3300006852 Bacteria 915
98 Ga0075434_100361148 3300006871 Unclassified 1473
99 Ga0075434_100651257 3300006871 Bacteria 1072
100 Ga0068865_100547040 3300006881 Bacteria 972
101 Ga0097620_100555244 3300006931 Bacteria 1243
102 Ga0075435_100125846 3300007076 Bacteria 2142
103 Ga0105251_10214510 3300009011 Bacteria 866
104 Ga0105240_11980277 3300009093 Bacteria 605
105 Ga0111539_10390053 3300009094 Unclassified 1622
106 Ga0105245_10062924 3300009098 Bacteria 3349
107 Ga0105245_10566719 3300009098 Bacteria 1159
108 Ga0105245_11318548 3300009098 Unclassified 771
109 Ga0105247_10000380 3300009101 Bacteria 37771
110 Ga0105247_10260341 3300009101 Bacteria 1189
111 Ga0105243_10073223 3300009148 Bacteria 2775
112 Ga0105243_10668287 3300009148 Bacteria 1009
113 Ga0105243_11099168 3300009148 Bacteria 803
114 Ga0105243_11444101 3300009148 Bacteria 710
115 Ga0105241_10793118 3300009174 Bacteria 872
116 Ga0105241_11324238 3300009174 Unclassified 687
117 Ga0105242_11206206 3300009176 Bacteria 776
118 Ga0105248_10001043 3300009177 Bacteria 30664
119 Ga0105248_10548507 3300009177 Unclassified 1304
120 Ga0105237_10703913 3300009545 Bacteria 1017
121 Ga0105237_11754829 3300009545 Bacteria 628
122 Ga0105238_10311057 3300009551 Bacteria 1560
123 Ga0105238_10357704 3300009551 Bacteria 1449
124 Ga0105238_12916370 3300009551 Bacteria 514
125 Ga0105249_10370469 3300009553 Bacteria 1456
126 Ga0105033_103020 3300009986 Bacteria 1405
127 Ga0105239_10352659 3300010375 Bacteria 1661
128 Ga0105246_10375380 3300011119 Bacteria 1173
129 Ga0157373_11155141 3300013100 Bacteria 582
130 Ga0157371_11078729 3300013102 Bacteria 615
131 Ga0157369_10497339 3300013105 Bacteria 1261
132 Ga0157369_11071288 3300013105 Archaea 824
133 Ga0157374_10363545 3300013296 Bacteria 1439
134 Ga0157374_10668896 3300013296 Bacteria 1050
135 Ga0157374_10996010 3300013296 Archaea 857
136 Ga0157378_10687061 3300013297 Bacteria 1042
137 Ga0163162_11683856 3300013306 Bacteria 724
138 Ga0157372_10202862 3300013307 Bacteria 2297
139 Ga0157372_10203778 3300013307 Bacteria 2292
140 Ga0157372_10206441 3300013307 Bacteria 2277
141 Ga0157372_10287296 3300013307 Bacteria 1913
142 Ga0157372_12187631 3300013307 Bacteria 635
143 Ga0157375_12500761 3300013308 Bacteria 617
144 Ga0163163_10009597 3300014325 Bacteria 8647
145 Ga0163163_10573160 3300014325 Unclassified 1192
146 Ga0163163_10654166 3300014325 Bacteria 1114
147 Ga0163163_12857578 3300014325 Bacteria 539
148 Ga0163163_12920784 3300014325 Bacteria 533
149 Ga0157380_10076248 3300014326 Bacteria 2728
150 Ga0157380_10698862 3300014326 Bacteria 1019
151 Ga0157380_11098309 3300014326 Unclassified 834
152 Ga0182008_10703397 3300014497 Bacteria 577
153 Ga0157377_10041076 3300014745 Bacteria 2565
154 Ga0157377_10139767 3300014745 Bacteria 1487
155 Ga0157379_10019042 3300014968 Bacteria 6060
156 Ga0157379_10170835 3300014968 Unclassified 1963
157 Ga0157376_10139065 3300014969 Bacteria 2176
158 Ga0197907_10052619 3300020069 Bacteria 1089
159 Ga0197907_10239898 3300020069 Unclassified 872
160 Ga0197907_10277569 3300020069 Bacteria 752
161 Ga0197907_10354071 3300020069 Bacteria 1107
162 Ga0197907_10404619 3300020069 Bacteria 526
163 Ga0197907_10439377 3300020069 Bacteria 555
164 Ga0197907_11121681 3300020069 Bacteria 1102
165 Ga0206356_10319493 3300020070 Bacteria 1132
166 Ga0206356_10673976 3300020070 Bacteria 641
167 Ga0206356_11165048 3300020070 Bacteria 779
168 Ga0206356_11628301 3300020070 Bacteria 1544
169 Ga0206356_11810485 3300020070 Unclassified 638
170 Ga0206349_1099539 3300020075 Bacteria 1708
171 Ga0206349_1176283 3300020075 Bacteria 1018
172 Ga0206349_1712597 3300020075 Unclassified 543
173 Ga0206349_1726847 3300020075 Bacteria 1373
174 Ga0206355_1091603 3300020076 Unclassified 706
175 Ga0206355_1328780 3300020076 Unclassified 532
176 Ga0206355_1631286 3300020076 Bacteria 636
177 Ga0206351_10341414 3300020077 Bacteria 752
178 Ga0206351_10386403 3300020077 Bacteria 812
179 Ga0206351_10409940 3300020077 Bacteria 1612
180 Ga0206351_10704070 3300020077 Bacteria 1133
181 Ga0206352_10474224 3300020078 Bacteria 1015
182 Ga0206352_10611977 3300020078 Bacteria 1036
183 Ga0206352_11239353 3300020078 Bacteria 893
184 Ga0206350_10062506 3300020080 Bacteria 1430
185 Ga0206350_10137746 3300020080 Bacteria 654
186 Ga0206350_10745363 3300020080 Unclassified 781
187 Ga0206350_10958941 3300020080 Bacteria 698
188 Ga0206350_11343456 3300020080 Bacteria 763
189 Ga0206350_11531472 3300020080 Bacteria 1240
190 Ga0206350_11656528 3300020080 Bacteria 1000
191 Ga0206354_10733030 3300020081 Bacteria 582
192 Ga0206354_11335191 3300020081 Bacteria 1206
193 Ga0206354_11693364 3300020081 Bacteria 2303
194 Ga0206353_10048678 3300020082 Bacteria 669
195 Ga0206353_10793471 3300020082 Bacteria 651
196 Ga0206353_11376751 3300020082 Bacteria 2219
197 Ga0154015_1685123 3300020610 Bacteria 595
198 Ga0213875_10001479 3300021388 Bacteria 15143
199 Ga0224712_10000702 3300022467 Bacteria 6916
200 Ga0224712_10017845 3300022467 Bacteria 2360
201 Ga0224712_10042224 3300022467 Bacteria 1727
202 Ga0224712_10090924 3300022467 Bacteria 1278
203 Ga0224712_10105034 3300022467 Bacteria 1204
204 Ga0224712_10140587 3300022467 Bacteria 1062
205 Ga0224712_10373295 3300022467 Unclassified 677
206 Ga0256743_112224 3300023436 Unclassified 539
207 Ga0209758_1002970 3300025297 Bacteria 16256
208 Ga0207426_1010742 3300025302 Bacteria 3536
209 Ga0207642_10132322 3300025899 Bacteria 1303
210 Ga0207710_10000255 3300025900 Bacteria 44364
211 Ga0207710_10139726 3300025900 Bacteria 1169
212 Ga0207688_10008184 3300025901 Bacteria 5683
213 Ga0207688_10082963 3300025901 Bacteria 1832
214 Ga0207643_10007299 3300025908 Bacteria 5930
215 Ga0207654_10893143 3300025911 Bacteria 644
216 Ga0207695_11137852 3300025913 Bacteria 660
217 Ga0207671_10619016 3300025914 Bacteria 863
218 Ga0207693_10072359 3300025915 Unclassified 2699
219 Ga0207663_10854263 3300025916 Bacteria 726
220 Ga0207660_11630609 3300025917 Bacteria 520
221 Ga0207662_10023563 3300025918 Bacteria 3538
222 Ga0207662_10651417 3300025918 Unclassified 736
223 Ga0207657_10064104 3300025919 Bacteria 3138
224 Ga0207657_10259101 3300025919 Bacteria 1384
225 Ga0207649_10301000 3300025920 Bacteria 1172
226 Ga0207649_11117334 3300025920 Bacteria 622
227 Ga0207652_10053726 3300025921 Bacteria 3460
228 Ga0207652_11164266 3300025921 Bacteria 672
229 Ga0207694_10272968 3300025924 Bacteria 1387
230 Ga0207694_10301708 3300025924 Bacteria 1319
231 Ga0207694_10670353 3300025924 Bacteria 874
232 Ga0207650_10692528 3300025925 Bacteria 861
233 Ga0207659_10085049 3300025926 Bacteria 2349
234 Ga0207687_10047048 3300025927 Bacteria 2989
235 Ga0207687_10412694 3300025927 Bacteria 1113
236 Ga0207664_11108859 3300025929 Bacteria 707
237 Ga0207644_11582722 3300025931 Bacteria 550
238 Ga0207690_10274263 3300025932 Bacteria 1311
239 Ga0207690_10376543 3300025932 Unclassified 1127
240 Ga0207690_10716850 3300025932 Bacteria 823
241 Ga0207706_10046635 3300025933 Bacteria 3837
242 Ga0207686_10149470 3300025934 Bacteria 1624
243 Ga0207686_10790063 3300025934 Bacteria 760
244 Ga0207709_10068267 3300025935 Bacteria 2247
245 Ga0207709_10070313 3300025935 Bacteria 2219
246 Ga0207670_10154988 3300025936 Bacteria 1704
247 Ga0207670_10448895 3300025936 Bacteria 1039
248 Ga0207670_10482921 3300025936 Unclassified 1004
249 Ga0207669_10220215 3300025937 Unclassified 1392
250 Ga0207704_10068369 3300025938 Bacteria 2239
251 Ga0207704_10091010 3300025938 Unclassified 2004
252 Ga0207665_10156744 3300025939 Bacteria 1635
253 Ga0207691_10419469 3300025940 Unclassified 1140
254 Ga0207711_10012079 3300025941 Bacteria 7179
255 Ga0207689_10087285 3300025942 Bacteria 2563
256 Ga0207661_10379506 3300025944 Bacteria 1279
257 Ga0207661_10912951 3300025944 Bacteria 809
258 Ga0207661_11592047 3300025944 Unclassified 598
259 Ga0207679_12093924 3300025945 Bacteria 514
260 Ga0207667_10892758 3300025949 Bacteria 881
261 Ga0207667_12049006 3300025949 Bacteria 532
262 Ga0207651_11470690 3300025960 Bacteria 613
263 Ga0207712_10700831 3300025961 Bacteria 884
264 Ga0207668_10158434 3300025972 Bacteria 1761
265 Ga0207640_10460362 3300025981 Bacteria 1050
266 Ga0207658_11100628 3300025986 Unclassified 726
267 Ga0207677_10071072 3300026023 Bacteria 2455
268 Ga0207677_10074421 3300026023 Bacteria 2410
269 Ga0207677_11256241 3300026023 Bacteria 679
270 Ga0207677_11470879 3300026023 Bacteria 629
271 Ga0207703_10181310 3300026035 Unclassified 1858
272 Ga0207703_10220118 3300026035 Bacteria 1697
273 Ga0207703_10970550 3300026035 Unclassified 815
274 Ga0207639_10868842 3300026041 Bacteria 842
275 Ga0207678_10080242 3300026067 Bacteria 2794
276 Ga0207678_10251367 3300026067 Bacteria 1514
277 Ga0207678_10632916 3300026067 Bacteria 939
278 Ga0207708_10076439 3300026075 Bacteria 2569
279 Ga0207708_11007283 3300026075 Bacteria 724
280 Ga0207702_10884995 3300026078 Bacteria 885
281 Ga0207641_11915599 3300026088 Bacteria 594
282 Ga0207648_10028801 3300026089 Bacteria 4924
283 Ga0207648_10113294 3300026089 Bacteria 2382
284 Ga0207648_10641721 3300026089 Bacteria 981
285 Ga0207676_10117774 3300026095 Bacteria 2234
286 Ga0207676_10292558 3300026095 Bacteria 1484
287 Ga0207674_10768002 3300026116 Bacteria 930
288 Ga0207675_100111531 3300026118 Bacteria 2581
289 Ga0207675_100735834 3300026118 Bacteria 997
290 Ga0207683_11178347 3300026121 Bacteria 710
291 Ga0207698_10844631 3300026142 Bacteria 920
292 Ga0207698_12481767 3300026142 Bacteria 529
293 Ga0207698_12639331 3300026142 Bacteria 511
294 Ga0268265_10172498 3300028380 Unclassified 1850
295 Ga0268264_12623927 3300028381 Bacteria 508
296 Ga0307518_10587857 3300031838 Bacteria 537
297 Ga0307416_101022181 3300032002 Bacteria 930
298 Ga0373958_0200986 3300034819 Bacteria 522
299 Ga0373938_0186874 3300034957 Bacteria 568
300 Ga0373939_0443628 3300035114 Bacteria 545
301 Ga0373931_0160480 3300035691 Bacteria 1318
302 Ga0395900_0115876 3300037418 Bacteria 2750
303 Ga0395900_0365824 3300037418 Bacteria 1413
304 Ga0395900_0575140 3300037418 Bacteria 1069
305 Ga0395898_0051306 3300037466 Bacteria 4034
306 Ga0395898_0082192 3300037466 Bacteria 3105
307 Ga0395898_0093952 3300037466 Bacteria 2882
308 Ga0395898_1023495 3300037466 Bacteria 761
309 Ga0395905_0114767 3300037471 Bacteria 2531
310 Ga0436364_0066545 3300037853 Bacteria 21602
311 Ga0395901_0035710 3300038443 Bacteria 5136
312 Ga0395901_0199911 3300038443 Bacteria 2095
313 Ga0395901_0736866 3300038443 Bacteria 980
314 Ga0242420_054464 3300038996 Bacteria 788
315 Ga0436365_0104316 3300039437 Unclassified 1442
316 Ga0436365_0186934 3300039437 Bacteria 730
317 Ga0436363_0179962 3300039450 Bacteria 768
318 Ga0439439_0099458 3300041406 Bacteria 800
319 Ga0439433_0014650 3300041999 Bacteria 1727
320 Ga0439442_035622 3300042002 Bacteria 1041
321 Ga0439449_0001400 3300042007 Bacteria 9429
322 Ga0439449_0105198 3300042007 Bacteria 1044
323 Ga0439450_137919 3300042008 Bacteria 635
324 Ga0439457_000015 3300042014 Bacteria 36298
325 Ga0439457_000315 3300042014 Bacteria 13342
326 Ga0439462_0042356 3300042015 Bacteria 1216
327 Ga0466969_0002682 3300044656 Bacteria 9513
328 Ga0466969_0011978 3300044656 Bacteria 4586
329 Ga0466969_0014193 3300044656 Bacteria 4188
330 Ga0466969_0041178 3300044656 Bacteria 2312
331 Ga0466972_0015272 3300044658 Bacteria 3839
332 Ga0466972_0028587 3300044658 Bacteria 2749
333 Ga0466972_0127993 3300044658 Bacteria 1196
334 Ga0466972_0156651 3300044658 Bacteria 1070
335 Ga0466972_0178611 3300044658 Bacteria 996
336 Ga0466972_0282024 3300044658 Bacteria 776
337 Ga0466965_0107304 3300044683 Bacteria 1433
338 Ga0466965_0145693 3300044683 Bacteria 1235
339 Ga0466965_0431832 3300044683 Bacteria 731
340 Ga0466965_0449590 3300044683 Bacteria 717
341 Ga0466966_0001075 3300044684 Bacteria 17442
342 Ga0466966_0011342 3300044684 Bacteria 5910
343 Ga0466966_0012946 3300044684 Bacteria 5522
344 Ga0466966_0014573 3300044684 Bacteria 5204
345 Ga0466966_0014699 3300044684 Bacteria 5180
346 Ga0466966_0774138 3300044684 Unclassified 578
347 Ga0466961_0013790 3300044693 Bacteria 5180
348 Ga0466961_0016598 3300044693 Bacteria 4734
349 Ga0466961_0017616 3300044693 Bacteria 4589
350 Ga0466961_0058346 3300044693 Bacteria 2456
351 Ga0466961_0123564 3300044693 Bacteria 1624
352 Ga0466961_0126352 3300044693 Bacteria 1604
353 Ga0466961_0127137 3300044693 Bacteria 1598
354 Ga0466963_0001113 3300044694 Bacteria 14029
355 Ga0466963_0066653 3300044694 Bacteria 2415
356 Ga0466963_0128447 3300044694 Bacteria 1749
357 Ga0466963_0180079 3300044694 Bacteria 1475
358 Ga0466963_0262498 3300044694 Bacteria 1212
359 Ga0466963_0636993 3300044694 Bacteria 753
360 Ga0466963_0694109 3300044694 Bacteria 718
361 Ga0466964_0007038 3300044706 Bacteria 4208
362 Ga0466964_0032357 3300044706 Bacteria 2078
363 Ga0466971_0001719 3300044719 Bacteria 9276
364 Ga0466971_0002747 3300044719 Bacteria 7435
365 Ga0466971_0173224 3300044719 Bacteria 1013
366 Ga0466971_0498437 3300044719 Unclassified 601
367 Ga0466968_0002391 3300044735 Bacteria 6878
368 Ga0466968_0002439 3300044735 Bacteria 6816
369 Ga0466968_0373080 3300044735 Bacteria 696
370 Ga0466968_0440704 3300044735 Bacteria 643
371 Ga0466968_0643816 3300044735 Bacteria 538
372 Ga0466970_0001120 3300044765 Bacteria 12980
373 Ga0466970_0079906 3300044765 Bacteria 1766
374 Ga0466970_0297501 3300044765 Bacteria 910
375 Ga0466970_0883644 3300044765 Bacteria 525
376 Ga0466957_0004755 3300044842 Bacteria 7598
377 Ga0466957_0005366 3300044842 Bacteria 7194
378 Ga0466957_0015109 3300044842 Bacteria 4506
379 Ga0466957_0147528 3300044842 Bacteria 1519
380 Ga0466960_0010601 3300044901 Bacteria 3830
381 Ga0466960_0039887 3300044901 Bacteria 2217
382 Ga0466960_0046686 3300044901 Bacteria 2075
383 Ga0466960_0211959 3300044901 Bacteria 1062
384 Ga0466960_0720349 3300044901 Bacteria 600
385 Ga0466960_0882204 3300044901 Bacteria 545
386 Ga0466960_0908814 3300044901 Bacteria 537
387 Ga0466960_1000156 3300044901 Bacteria 514
388 Ga0466959_0008215 3300045049 Bacteria 7364
389 Ga0466959_0011586 3300045049 Bacteria 6337
390 Ga0466959_0045233 3300045049 Bacteria 3242
391 Ga0466959_0092819 3300045049 Bacteria 2167
392 Ga0466959_0149366 3300045049 Bacteria 1648
393 Ga0466959_0172184 3300045049 Bacteria 1518
394 Ga0466959_0251184 3300045049 Bacteria 1219
395 Ga0466959_1044906 3300045049 Bacteria 544
396 Ga0451576_0162058 3300045051 Bacteria 2334
397 Ga0466958_0000552 3300045836 Bacteria 15938
398 Ga0466958_0000861 3300045836 Bacteria 13526
399 Ga0466958_0043204 3300045836 Bacteria 2714
400 Ga0466958_0210312 3300045836 Bacteria 1239
401 Ga0466958_0296224 3300045836 Bacteria 1038
402 Ga0466958_0360689 3300045836 Bacteria 936
403 Ga0466958_0452675 3300045836 Bacteria 831
404 Ga0466958_0691821 3300045836 Bacteria 664
405 Ga0466967_0003425 3300045976 Bacteria 10349
406 Ga0466967_0007241 3300045976 Bacteria 7977
407 Ga0466967_0024463 3300045976 Bacteria 4966
408 Ga0466967_0066473 3300045976 Bacteria 3213
409 Ga0466967_0068581 3300045976 Bacteria 3167
410 Ga0466967_0145620 3300045976 Bacteria 2210
411 Ga0466967_0149862 3300045976 Bacteria 2179
412 Ga0466967_0239110 3300045976 Bacteria 1732
413 Ga0466967_0267243 3300045976 Bacteria 1638
414 Ga0466967_0283592 3300045976 Bacteria 1590
415 Ga0466967_0470441 3300045976 Bacteria 1230
416 Ga0466967_0509964 3300045976 Bacteria 1181
417 Ga0466967_0520351 3300045976 Bacteria 1169
418 Ga0466967_0649411 3300045976 Bacteria 1043
419 Ga0466967_1229558 3300045976 Bacteria 746
420 Ga0466967_1427859 3300045976 Bacteria 689
421 Ga0495603_0562745 3300046455 Bacteria 653
422 Ga0495658_1041335 3300046683 Bacteria 522
423 Ga0496100_0288439 3300048903 Bacteria 1225
424 Ga0496100_0457032 3300048903 Bacteria 979
425 Ga0496100_0974460 3300048903 Bacteria 667
426 Ga0496100_1453466 3300048903 Bacteria 541
427 Ga0496101_0170997 3300048904 Bacteria 1670
428 Ga0496101_0457235 3300048904 Bacteria 1007
429 Ga0496101_0514902 3300048904 Bacteria 945
430 Ga0496102_0302553 3300048905 Bacteria 1507
431 Ga0496102_0697044 3300048905 Unclassified 938
432 Ga0496103_0051013 3300048906 Bacteria 2560
433 Ga0496103_0291434 3300048906 Unclassified 1050
434 Ga0496104_0153807 3300048907 Bacteria 2208
435 Ga0496105_0103575 3300048908 Bacteria 2350
436 Ga0496106_0054067 3300048909 Bacteria 3033
437 Ga0496106_0070567 3300048909 Bacteria 2668
438 Ga0496107_0143907 3300048910 Bacteria 1762
439 Ga0496107_0350579 3300048910 Bacteria 1098
440 Ga0496107_1297065 3300048910 Unclassified 521
441 Ga0496108_0923061 3300048911 Bacteria 748
442 Ga0496109_0747769 3300048912 Bacteria 915
443 Ga0496109_1182683 3300048912 Bacteria 701
444 Ga0496109_1528210 3300048912 Bacteria 602
445 Ga0496110_0493175 3300048913 Bacteria 1115
446 Ga0496111_0278564 3300048914 Bacteria 1240
447 Ga0496112_0442045 3300048915 Bacteria 1238
448 Ga0496113_0032207 3300048916 Bacteria 3809
449 Ga0496114_1188904 3300048917 Bacteria 648
450 Ga0496115_0271104 3300048918 Bacteria 1394
451 Ga0496115_0620785 3300048918 Bacteria 857
452 Ga0496119_0002367 3300048922 Bacteria 20732
453 Ga0496120_0001702 3300048923 Bacteria 25185
454 Ga0501033_0000834 3300049570 Bacteria 28110
455 Ga0501033_0014013 3300049570 Bacteria 6098
456 Ga0501033_0254052 3300049570 Bacteria 1245
457 Ga0501033_0275195 3300049570 Bacteria 1189
458 Ga0501034_0004476 3300049571 Bacteria 15538
459 Ga0501034_0044251 3300049571 Bacteria 4503
460 Ga0501036_0000850 3300049572 Bacteria 22727
461 Ga0501037_0332179 3300049573 Bacteria 1051
462 Ga0501037_0344898 3300049573 Bacteria 1028
463 Ga0501038_0463046 3300049574 Unclassified 973
464 Ga0501039_0008638 3300049575 Bacteria 7761
465 Ga0501039_0450665 3300049575 Bacteria 1010
466 Ga0501043_0002966 3300049579 Bacteria 14142
467 Ga0501043_1271388 3300049579 Bacteria 514
468 Ga0501046_1119187 3300049580 Bacteria 543
469 Ga0501047_0092421 3300049581 Bacteria 2904
470 Ga0501047_0362087 3300049581 Bacteria 1286
471 Ga0501069_0645949 3300049585 Unclassified 636
472 Ga0501070_0000538 3300049586 Bacteria 34720
473 Ga0501073_0464329 3300049589 Bacteria 875
474 Ga0501074_0001520 3300049590 Bacteria 15684
475 Ga0501035_0000293 3300049822 Bacteria 59348
476 Ga0501035_0466630 3300049822 Bacteria 1043
477 Ga0501044_0001706 3300049823 Bacteria 25778
478 Ga0501044_0009275 3300049823 Bacteria 10742
479 nmdc:mga03n38_287016_c1 3300050490 Bacteria 880
480 nmdc:mga08y16_221826_c1 3300050511 Bacteria 1957
481 nmdc:mga0n895_1500426_c1 3300050512 Unclassified 640
482 nmdc:mga0n895_333201_c1 3300050512 Bacteria 1537
483 nmdc:mga0n895_617637_c1 3300050512 Bacteria 1085
484 nmdc:mga0n895_702340_c1 3300050512 Unclassified 1007
485 nmdc:mga0rr50_512302_c1 3300050513 Bacteria 1020
486 Ga0587073_0200682 3300059492 Bacteria 598
487 Ga0587083_0174100 3300059505 Bacteria 598
488 Ga0466962_0015264 3300061719 Bacteria 3703
489 Ga0466962_0017352 3300061719 Bacteria 3466
490 Ga0466962_0021819 3300061719 Bacteria 3074
491 Ga0466962_0060823 3300061719 Bacteria 1803
492 Ga0466962_0160588 3300061719 Bacteria 1092
493 Ga0466962_0179514 3300061719 Bacteria 1032
494 Ga0501036_0009673
495 MBSR1b_contig_1594211
496 MBSR1b_contig_6396654
497 JGI25153J46596_10131710
498 rootL2_10006344
499 rootH1_10389504
500 Ga0058863_11800350
501 Ga0058863_11910298
502 Ga0058861_11722610
503 Ga0058862_12495806
504 Ga0065712_10391882
505 Ga0065715_10015352
506 Ga0070658_10318157
507 Ga0070676_10822355
508 Ga0070683_100291791
509 Ga0070683_100939685
510 Ga0070690_100167383
511 Ga0070670_102244539
512 Ga0068869_100610843
513 Ga0070680_101086096
514 Ga0070682_100506039
515 Ga0070682_100789350
516 Ga0070682_101487787
517 Ga0068868_100091119
518 Ga0068868_100173160
519 Ga0068868_101375571
520 Ga0070660_100087410
521 Ga0070660_100409478
522 Ga0070689_100081711
523 Ga0070689_100173857
524 Ga0070689_101131343
525 Ga0070691_10349358
526 Ga0070687_100146129
527 Ga0070661_100261890
528 Ga0070692_10145409
529 Ga0070668_100128140
530 Ga0070669_100761903
531 Ga0070675_100169852
532 Ga0070671_101116993
533 Ga0070673_100851536
534 Ga0070688_100071662
535 Ga0070659_100121793
536 Ga0070659_100573033
537 Ga0070667_100737798
538 Ga0070714_101717587
539 Ga0070713_101666123
540 Ga0070701_10545743
541 Ga0070711_100287081
542 Ga0070700_100096531
543 Ga0070700_100309965
544 Ga0070694_101031227
545 Ga0070708_102210763
546 Ga0070663_100498488
547 Ga0070678_100575641
548 Ga0070662_101122458
549 Ga0068867_100139929
550 Ga0070685_10106331
551 Ga0070679_100110954
552 Ga0070679_100170161
553 Ga0070679_101112575
554 Ga0070684_100146192
555 Ga0070684_100779004
556 Ga0070684_101518467
557 Ga0070697_100482738
558 Ga0070697_101449769
559 Ga0068853_100161563
560 Ga0070672_100283728
561 Ga0070686_100057145
562 Ga0070695_101016197
563 Ga0070696_100090643
564 Ga0070693_100268614
565 Ga0070693_100526507
566 Ga0070665_102045597
567 Ga0070704_100310923
568 Ga0070664_100092640
569 Ga0068854_100392983
570 Ga0070702_100076134
571 Ga0068852_100259229
572 Ga0068852_100602626
573 Ga0068859_100555250
574 Ga0068864_100747009
575 Ga0068866_10132412
576 Ga0068861_100034856
577 Ga0068863_101794830
578 Ga0068858_100206028
579 Ga0068860_100838696
580 Ga0068862_100117195
581 Ga0081455_10532937
582 Ga0075363_100729856
583 Ga0070715_10200272
584 Ga0070716_100286884
585 Ga0070712_100056394
586 Ga0097621_100458949
587 Ga0075370_10968410
588 Ga0075431_101067810
589 Ga0075433_10441653
590 Ga0075433_10662522
591 Ga0075434_100361148
592 Ga0075434_100651257
593 Ga0068865_100547040
594 Ga0097620_100555244
595 Ga0075435_100125846
596 Ga0105251_10214510
597 Ga0105240_11980277
598 Ga0111539_10390053
599 Ga0105245_10062924
600 Ga0105245_10566719
601 Ga0105245_11318548
602 Ga0105247_10000380
603 Ga0105247_10260341
604 Ga0105243_10073223
605 Ga0105243_10668287
606 Ga0105243_11099168
607 Ga0105243_11444101
608 Ga0105241_10793118
609 Ga0105241_11324238
610 Ga0105242_11206206
611 Ga0105248_10001043
612 Ga0105248_10548507
613 Ga0105237_10703913
614 Ga0105237_11754829
615 Ga0105238_10311057
616 Ga0105238_10357704
617 Ga0105238_12916370
618 Ga0105249_10370469
619 Ga0105033_103020
620 Ga0105239_10352659
621 Ga0105246_10375380
622 Ga0157373_11155141
623 Ga0157371_11078729
624 Ga0157369_10497339
625 Ga0157369_11071288
626 Ga0157374_10363545
627 Ga0157374_10668896
628 Ga0157374_10996010
629 Ga0157378_10687061
630 Ga0163162_11683856
631 Ga0157372_10202862
632 Ga0157372_10203778
633 Ga0157372_10206441
634 Ga0157372_10287296
635 Ga0157372_12187631
636 Ga0157375_12500761
637 Ga0163163_10009597
638 Ga0163163_10573160
639 Ga0163163_10654166
640 Ga0163163_12857578
641 Ga0163163_12920784
642 Ga0157380_10076248
643 Ga0157380_10698862
644 Ga0157380_11098309
645 Ga0182008_10703397
646 Ga0157377_10041076
647 Ga0157377_10139767
648 Ga0157379_10019042
649 Ga0157379_10170835
650 Ga0157376_10139065
651 Ga0197907_10052619
652 Ga0197907_10239898
653 Ga0197907_10277569
654 Ga0197907_10354071
655 Ga0197907_10404619
656 Ga0197907_10439377
657 Ga0197907_11121681
658 Ga0206356_10319493
659 Ga0206356_10673976
660 Ga0206356_11165048
661 Ga0206356_11628301
662 Ga0206356_11810485
663 Ga0206349_1099539
664 Ga0206349_1176283
665 Ga0206349_1712597
666 Ga0206349_1726847
667 Ga0206355_1091603
668 Ga0206355_1328780
669 Ga0206355_1631286
670 Ga0206351_10341414
671 Ga0206351_10386403
672 Ga0206351_10409940
673 Ga0206351_10704070
674 Ga0206352_10474224
675 Ga0206352_10611977
676 Ga0206352_11239353
677 Ga0206350_10062506
678 Ga0206350_10137746
679 Ga0206350_10745363
680 Ga0206350_10958941
681 Ga0206350_11343456
682 Ga0206350_11531472
683 Ga0206350_11656528
684 Ga0206354_10733030
685 Ga0206354_11335191
686 Ga0206354_11693364
687 Ga0206353_10048678
688 Ga0206353_10793471
689 Ga0206353_11376751
690 Ga0154015_1685123
691 Ga0213875_10001479
692 Ga0224712_10000702
693 Ga0224712_10017845
694 Ga0224712_10042224
695 Ga0224712_10090924
696 Ga0224712_10105034
697 Ga0224712_10140587
698 Ga0224712_10373295
699 Ga0256743_112224
700 Ga0209758_1002970
701 Ga0207426_1010742
702 Ga0207642_10132322
703 Ga0207710_10000255
704 Ga0207710_10139726
705 Ga0207688_10008184
706 Ga0207688_10082963
707 Ga0207643_10007299
708 Ga0207654_10893143
709 Ga0207695_11137852
710 Ga0207671_10619016
711 Ga0207693_10072359
712 Ga0207663_10854263
713 Ga0207660_11630609
714 Ga0207662_10023563
715 Ga0207662_10651417
716 Ga0207657_10064104
717 Ga0207657_10259101
718 Ga0207649_10301000
719 Ga0207649_11117334
720 Ga0207652_10053726
721 Ga0207652_11164266
722 Ga0207694_10272968
723 Ga0207694_10301708
724 Ga0207694_10670353
725 Ga0207650_10692528
726 Ga0207659_10085049
727 Ga0207687_10047048
728 Ga0207687_10412694
729 Ga0207664_11108859
730 Ga0207644_11582722
731 Ga0207690_10274263
732 Ga0207690_10376543
733 Ga0207690_10716850
734 Ga0207706_10046635
735 Ga0207686_10149470
736 Ga0207686_10790063
737 Ga0207709_10068267
738 Ga0207709_10070313
739 Ga0207670_10154988
740 Ga0207670_10448895
741 Ga0207670_10482921
742 Ga0207669_10220215
743 Ga0207704_10068369
744 Ga0207704_10091010
745 Ga0207665_10156744
746 Ga0207691_10419469
747 Ga0207711_10012079
748 Ga0207689_10087285
749 Ga0207661_10379506
750 Ga0207661_10912951
751 Ga0207661_11592047
752 Ga0207679_12093924
753 Ga0207667_10892758
754 Ga0207667_12049006
755 Ga0207651_11470690
756 Ga0207712_10700831
757 Ga0207668_10158434
758 Ga0207640_10460362
759 Ga0207658_11100628
760 Ga0207677_10071072
761 Ga0207677_10074421
762 Ga0207677_11256241
763 Ga0207677_11470879
764 Ga0207703_10181310
765 Ga0207703_10220118
766 Ga0207703_10970550
767 Ga0207639_10868842
768 Ga0207678_10080242
769 Ga0207678_10251367
770 Ga0207678_10632916
771 Ga0207708_10076439
772 Ga0207708_11007283
773 Ga0207702_10884995
774 Ga0207641_11915599
775 Ga0207648_10028801
776 Ga0207648_10113294
777 Ga0207648_10641721
778 Ga0207676_10117774
779 Ga0207676_10292558
780 Ga0207674_10768002
781 Ga0207675_100111531
782 Ga0207675_100735834
783 Ga0207683_11178347
784 Ga0207698_10844631
785 Ga0207698_12481767
786 Ga0207698_12639331
787 Ga0268265_10172498
788 Ga0268264_12623927
789 Ga0307518_10587857
790 Ga0307416_101022181
791 Ga0373958_0200986
792 Ga0373938_0186874
793 Ga0373939_0443628
794 Ga0373931_0160480
795 Ga0395900_0115876
796 Ga0395900_0365824
797 Ga0395900_0575140
798 Ga0395898_0051306
799 Ga0395898_0082192
800 Ga0395898_0093952
801 Ga0395898_1023495
802 Ga0395905_0114767
803 Ga0436364_0066545
804 Ga0395901_0035710
805 Ga0395901_0199911
806 Ga0395901_0736866
807 Ga0242420_054464
808 Ga0436365_0104316
809 Ga0436365_0186934
810 Ga0436363_0179962
811 Ga0439439_0099458
812 Ga0439433_0014650
813 Ga0439442_035622
814 Ga0439449_0001400
815 Ga0439449_0105198
816 Ga0439450_137919
817 Ga0439457_000015
818 Ga0439457_000315
819 Ga0439462_0042356
820 Ga0466969_0002682
821 Ga0466969_0011978
822 Ga0466969_0014193
823 Ga0466969_0041178
824 Ga0466972_0015272
825 Ga0466972_0028587
826 Ga0466972_0127993
827 Ga0466972_0156651
828 Ga0466972_0178611
829 Ga0466972_0282024
830 Ga0466965_0107304
831 Ga0466965_0145693
832 Ga0466965_0431832
833 Ga0466965_0449590
834 Ga0466966_0001075
835 Ga0466966_0011342
836 Ga0466966_0012946
837 Ga0466966_0014573
838 Ga0466966_0014699
839 Ga0466966_0774138
840 Ga0466961_0013790
841 Ga0466961_0016598
842 Ga0466961_0017616
843 Ga0466961_0058346
844 Ga0466961_0123564
845 Ga0466961_0126352
846 Ga0466961_0127137
847 Ga0466963_0001113
848 Ga0466963_0066653
849 Ga0466963_0128447
850 Ga0466963_0180079
851 Ga0466963_0262498
852 Ga0466963_0636993
853 Ga0466963_0694109
854 Ga0466964_0007038
855 Ga0466964_0032357
856 Ga0466971_0001719
857 Ga0466971_0002747
858 Ga0466971_0173224
859 Ga0466971_0498437
860 Ga0466968_0002391
861 Ga0466968_0002439
862 Ga0466968_0373080
863 Ga0466968_0440704
864 Ga0466968_0643816
865 Ga0466970_0001120
866 Ga0466970_0079906
867 Ga0466970_0297501
868 Ga0466970_0883644
869 Ga0466957_0004755
870 Ga0466957_0005366
871 Ga0466957_0015109
872 Ga0466957_0147528
873 Ga0466960_0010601
874 Ga0466960_0039887
875 Ga0466960_0046686
876 Ga0466960_0211959
877 Ga0466960_0720349
878 Ga0466960_0882204
879 Ga0466960_0908814
880 Ga0466960_1000156
881 Ga0466959_0008215
882 Ga0466959_0011586
883 Ga0466959_0045233
884 Ga0466959_0092819
885 Ga0466959_0149366
886 Ga0466959_0172184
887 Ga0466959_0251184
888 Ga0466959_1044906
889 Ga0451576_0162058
890 Ga0466958_0000552
891 Ga0466958_0000861
892 Ga0466958_0043204
893 Ga0466958_0210312
894 Ga0466958_0296224
895 Ga0466958_0360689
896 Ga0466958_0452675
897 Ga0466958_0691821
898 Ga0466967_0003425
899 Ga0466967_0007241
900 Ga0466967_0024463
901 Ga0466967_0066473
902 Ga0466967_0068581
903 Ga0466967_0145620
904 Ga0466967_0149862
905 Ga0466967_0239110
906 Ga0466967_0267243
907 Ga0466967_0283592
908 Ga0466967_0470441
909 Ga0466967_0509964
910 Ga0466967_0520351
911 Ga0466967_0649411
912 Ga0466967_1229558
913 Ga0466967_1427859
914 Ga0495603_0562745
915 Ga0495658_1041335
916 Ga0496100_0288439
917 Ga0496100_0457032
918 Ga0496100_0974460
919 Ga0496100_1453466
920 Ga0496101_0170997
921 Ga0496101_0457235
922 Ga0496101_0514902
923 Ga0496102_0302553
924 Ga0496102_0697044
925 Ga0496103_0051013
926 Ga0496103_0291434
927 Ga0496104_0153807
928 Ga0496105_0103575
929 Ga0496106_0054067
930 Ga0496106_0070567
931 Ga0496107_0143907
932 Ga0496107_0350579
933 Ga0496107_1297065
934 Ga0496108_0923061
935 Ga0496109_0747769
936 Ga0496109_1182683
937 Ga0496109_1528210
938 Ga0496110_0493175
939 Ga0496111_0278564
940 Ga0496112_0442045
941 Ga0496113_0032207
942 Ga0496114_1188904
943 Ga0496115_0271104
944 Ga0496115_0620785
945 Ga0496119_0002367
946 Ga0496120_0001702
947 Ga0501033_0000834
948 Ga0501033_0014013
949 Ga0501033_0254052
950 Ga0501033_0275195
951 Ga0501034_0004476
952 Ga0501034_0044251
953 Ga0501036_0000850
954 Ga0501037_0332179
955 Ga0501037_0344898
956 Ga0501038_0463046
957 Ga0501039_0008638
958 Ga0501039_0450665
959 Ga0501043_0002966
960 Ga0501043_1271388
961 Ga0501046_1119187
962 Ga0501047_0092421
963 Ga0501047_0362087
964 Ga0501069_0645949
965 Ga0501070_0000538
966 Ga0501073_0464329
967 Ga0501074_0001520
968 Ga0501035_0000293
969 Ga0501035_0466630
970 Ga0501044_0001706
971 Ga0501044_0009275
972 nmdc:mga03n38_287016_c1
973 nmdc:mga08y16_221826_c1
974 nmdc:mga0n895_1500426_c1
975 nmdc:mga0n895_333201_c1
976 nmdc:mga0n895_617637_c1
977 nmdc:mga0n895_702340_c1
978 nmdc:mga0rr50_512302_c1
979 Ga0587073_0200682
980 Ga0587083_0174100
981 Ga0466962_0015264
982 Ga0466962_0017352
983 Ga0466962_0021819
984 Ga0466962_0060823
985 Ga0466962_0160588
986 Ga0466962_0179514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map