F454447

General Info

Members Datasets Scaffolds Average Seq Length
493 228 482 201

Family's Representative Sequence

Representative Sequence 3300030731|Ga0316177_1035720|Ga0316177_10357204
Length 201
Sequence MKFFGIVFSFLLISATVCAQKSQRIFNGKDLSGWTIYGTEKWFVENGELVCESGPDKAYGYLGTEKPYKNFVLDLDFKQEANGNSGVFIRSSIDGVDITGWQVEVAPVNHHTGGIYESGPNGRQWLIKPKPADEAVLKQGEWNHLRIKAEGNQVTSWLNGKQMVHLDDEKVGLGEGFIALQIHSGGGIKVRWKDIKIEELK

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
4 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
5 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
6 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
7 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
8 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
9 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
10 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
11 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
140 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
141 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
142 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
143 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
144 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
157 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
161 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
162 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
163 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
164 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
165 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
166 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
169 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
170 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
171 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
172 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
173 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
174 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
175 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
196 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
197 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
198 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
199 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
200 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
201 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
202 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
203 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
204 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
205 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
206 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
207 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
208 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
211 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
221 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
222 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
223 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
224 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
225 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
226 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
227 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
228 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 0
Isolates 2.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.64
Nodule 0
Rhizoplane 0.61
Rhizosphere 91.89
Stem 0
Stem Tuber 0
Unclassified 4.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001970 3300002459 Bacteria 4191
2 rootH1_10059693 3300003316 Unclassified 4253
3 rootH2_10004559 3300003320 Bacteria 142332
4 rootH2_10137598 3300003320 Bacteria 1609
5 Ga0065165_1000131 3300005262 Bacteria 128880
6 Ga0065712_10005047 3300005290 Bacteria 3056
7 Ga0065712_10076506 3300005290 Bacteria 3642
8 Ga0065712_10087423 3300005290 Bacteria 2574
9 Ga0070676_10006110 3300005328 Bacteria 6430
10 Ga0070690_100049983 3300005330 Bacteria 2667
11 Ga0070670_100013520 3300005331 Bacteria 6993
12 Ga0070670_100167052 3300005331 Bacteria 1908
13 Ga0070670_100187851 3300005331 Unclassified 1794
14 Ga0070670_100283199 3300005331 Bacteria 1447
15 Ga0070677_10042935 3300005333 Bacteria 1793
16 Ga0070677_10164956 3300005333 Bacteria 1042
17 Ga0068869_100081945 3300005334 Bacteria 2410
18 Ga0068869_100083641 3300005334 Unclassified 2387
19 Ga0068869_100146512 3300005334 Bacteria 1828
20 Ga0068869_100421527 3300005334 Bacteria 1101
21 Ga0070666_10015874 3300005335 Bacteria 4811
22 Ga0070666_10524384 3300005335 Bacteria 860
23 Ga0068868_100009004 3300005338 Bacteria 7165
24 Ga0068868_100033023 3300005338 Bacteria 3986
25 Ga0070689_100110207 3300005340 Bacteria 2188
26 Ga0070689_100137126 3300005340 Bacteria 1965
27 Ga0070689_100688930 3300005340 Bacteria 891
28 Ga0070687_100384823 3300005343 Bacteria 915
29 Ga0070668_100009723 3300005347 Bacteria 7130
30 Ga0070668_100064972 3300005347 Bacteria 2830
31 Ga0070668_100204695 3300005347 Bacteria 1621
32 Ga0070668_100403747 3300005347 Bacteria 1167
33 Ga0070669_100028809 3300005353 Unclassified 4000
34 Ga0070669_100126632 3300005353 Bacteria 1955
35 Ga0070669_100584979 3300005353 Unclassified 934
36 Ga0070669_100743558 3300005353 Bacteria 831
37 Ga0070669_100887394 3300005353 Bacteria 761
38 Ga0070675_100045511 3300005354 Unclassified 3591
39 Ga0070675_100074023 3300005354 Bacteria 2828
40 Ga0070675_100105464 3300005354 Bacteria 2378
41 Ga0070675_100241006 3300005354 Bacteria 1580
42 Ga0070675_100263894 3300005354 Bacteria 1510
43 Ga0070671_100074972 3300005355 Bacteria 2826
44 Ga0070671_100241438 3300005355 Unclassified 1534
45 Ga0070671_100738339 3300005355 Bacteria 855
46 Ga0070674_100030209 3300005356 Bacteria 3578
47 Ga0070674_100123141 3300005356 Bacteria 1922
48 Ga0070673_100021950 3300005364 Unclassified 4639
49 Ga0070673_100121543 3300005364 Bacteria 2179
50 Ga0070673_100343619 3300005364 Bacteria 1323
51 Ga0070673_100470219 3300005364 Bacteria 1133
52 Ga0070688_100038599 3300005365 Bacteria 2918
53 Ga0070688_100049703 3300005365 Bacteria 2610
54 Ga0070667_100011174 3300005367 Bacteria 7428
55 Ga0070667_100055367 3300005367 Bacteria 3350
56 Ga0070667_100691808 3300005367 Bacteria 943
57 Ga0070714_100462900 3300005435 Bacteria 1206
58 Ga0070700_100145348 3300005441 Bacteria 1616
59 Ga0070694_100397679 3300005444 Bacteria 1078
60 Ga0070678_100174269 3300005456 Bacteria 1755
61 Ga0070678_100571230 3300005456 Unclassified 1006
62 Ga0070662_100011878 3300005457 Bacteria 5759
63 Ga0070662_100056769 3300005457 Bacteria 2843
64 Ga0070662_100134698 3300005457 Unclassified 1909
65 Ga0068867_100139423 3300005459 Bacteria 1894
66 Ga0068867_100225428 3300005459 Bacteria 1512
67 Ga0068867_100415201 3300005459 Bacteria 1139
68 Ga0068867_100958080 3300005459 Unclassified 773
69 Ga0068867_101089998 3300005459 Bacteria 729
70 Ga0070685_10024298 3300005466 Bacteria 3326
71 Ga0070698_100000936 3300005471 Bacteria 31949
72 Ga0070698_100003346 3300005471 Bacteria 17650
73 Ga0070698_100014293 3300005471 Bacteria 8393
74 Ga0070699_100076523 3300005518 Bacteria 2913
75 Ga0070699_101039162 3300005518 Bacteria 751
76 Ga0070672_100147810 3300005543 Bacteria 1942
77 Ga0070672_100195138 3300005543 Bacteria 1691
78 Ga0070672_100509860 3300005543 Unclassified 1041
79 Ga0070672_100950395 3300005543 Unclassified 760
80 Ga0070665_100103681 3300005548 Bacteria 2847
81 Ga0070704_100110823 3300005549 Bacteria 2088
82 Ga0070704_100366766 3300005549 Bacteria 1220
83 Ga0068855_100005467 3300005563 Bacteria 15499
84 Ga0070664_100058510 3300005564 Unclassified 3278
85 Ga0070664_100162688 3300005564 Unclassified 1975
86 Ga0070664_100690568 3300005564 Bacteria 950
87 Ga0068857_100049074 3300005577 Bacteria 3745
88 Ga0068857_100130769 3300005577 Bacteria 2264
89 Ga0068857_100167682 3300005577 Unclassified 1995
90 Ga0068857_100996914 3300005577 Unclassified 806
91 Ga0068854_100062197 3300005578 Bacteria 2706
92 Ga0068854_100165370 3300005578 Bacteria 1717
93 Ga0068854_100335309 3300005578 Bacteria 1233
94 Ga0068856_100425702 3300005614 Bacteria 1347
95 Ga0068852_100251547 3300005616 Bacteria 1693
96 Ga0068859_100058490 3300005617 Bacteria 3883
97 Ga0068859_100115351 3300005617 Unclassified 2751
98 Ga0068859_100134348 3300005617 Bacteria 2546
99 Ga0068859_100180003 3300005617 Bacteria 2196
100 Ga0068864_100014604 3300005618 Bacteria 6524
101 Ga0068864_100055423 3300005618 Bacteria 3423
102 Ga0068864_100480145 3300005618 Bacteria 1193
103 Ga0068864_101017384 3300005618 Bacteria 822
104 Ga0068866_10031547 3300005718 Unclassified 2554
105 Ga0068866_10203644 3300005718 Unclassified 1184
106 Ga0068861_100041391 3300005719 Bacteria 3451
107 Ga0068861_100390170 3300005719 Bacteria 1233
108 Ga0068861_100707625 3300005719 Unclassified 937
109 Ga0068851_10217811 3300005834 Bacteria 1071
110 Ga0068851_10302404 3300005834 Bacteria 920
111 Ga0068851_10518251 3300005834 Bacteria 717
112 Ga0068870_10041730 3300005840 Bacteria 2386
113 Ga0068870_10046656 3300005840 Bacteria 2273
114 Ga0068870_10124074 3300005840 Unclassified 1491
115 Ga0068870_10489173 3300005840 Bacteria 818
116 Ga0068863_100031816 3300005841 Bacteria 5033
117 Ga0068863_100053646 3300005841 Bacteria 3821
118 Ga0068863_100107909 3300005841 Bacteria 2650
119 Ga0068858_100047763 3300005842 Bacteria 3967
120 Ga0068858_100433464 3300005842 Bacteria 1265
121 Ga0068860_100002698 3300005843 Bacteria 18476
122 Ga0068860_100007550 3300005843 Bacteria 10878
123 Ga0068860_100020882 3300005843 Bacteria 6344
124 Ga0068860_100346578 3300005843 Bacteria 1461
125 Ga0068862_100017563 3300005844 Bacteria 5958
126 Ga0068862_100039409 3300005844 Bacteria 4012
127 Ga0068862_100151762 3300005844 Bacteria 2062
128 Ga0075366_10064218 3300006195 Bacteria 2183
129 Ga0097621_100087732 3300006237 Bacteria 2598
130 Ga0097621_100869736 3300006237 Bacteria 838
131 Ga0068871_100042277 3300006358 Bacteria 3658
132 Ga0068871_100155240 3300006358 Bacteria 1954
133 Ga0068871_100164548 3300006358 Unclassified 1898
134 Ga0068871_100216918 3300006358 Bacteria 1656
135 Ga0068871_100256158 3300006358 Unclassified 1525
136 Ga0075428_100004467 3300006844 Bacteria 15439
137 Ga0075428_100015432 3300006844 Bacteria 8467
138 Ga0075428_100104814 3300006844 Bacteria 3084
139 Ga0075428_100142451 3300006844 Bacteria 2606
140 Ga0075430_100022971 3300006846 Bacteria 5304
141 Ga0075430_100157126 3300006846 Bacteria 1893
142 Ga0075429_100004646 3300006880 Bacteria 11808
143 Ga0075429_100781209 3300006880 Bacteria 836
144 Ga0068865_100019152 3300006881 Bacteria 4427
145 Ga0068865_100163274 3300006881 Unclassified 1701
146 Ga0068865_100241311 3300006881 Bacteria 1422
147 Ga0097620_100058494 3300006931 Bacteria 3883
148 Ga0097620_100115352 3300006931 Unclassified 2751
149 Ga0097620_100134346 3300006931 Bacteria 2546
150 Ga0097620_100180001 3300006931 Bacteria 2196
151 Ga0111539_10089892 3300009094 Bacteria 3609
152 Ga0111539_10267442 3300009094 Bacteria 1990
153 Ga0111539_10377562 3300009094 Bacteria 1650
154 Ga0111539_11157915 3300009094 Bacteria 898
155 Ga0111539_11292891 3300009094 Unclassified 847
156 Ga0105247_10445341 3300009101 Unclassified 932
157 Ga0114129_10143067 3300009147 Bacteria 3277
158 Ga0114129_10495392 3300009147 Unclassified 1597
159 Ga0105241_10015860 3300009174 Bacteria 5519
160 Ga0105241_10294534 3300009174 Unclassified 1390
161 Ga0105242_10009711 3300009176 Bacteria 7373
162 Ga0105242_10010772 3300009176 Bacteria 7019
163 Ga0105242_10016512 3300009176 Bacteria 5739
164 Ga0105242_10245503 3300009176 Bacteria 1611
165 Ga0105248_10648310 3300009177 Unclassified 1191
166 Ga0105249_10001693 3300009553 Bacteria 19305
167 Ga0105249_10009116 3300009553 Bacteria 8679
168 Ga0105249_10065955 3300009553 Bacteria 3332
169 Ga0105249_10087604 3300009553 Bacteria 2906
170 Ga0105249_10130285 3300009553 Bacteria 2400
171 Ga0105249_10267677 3300009553 Bacteria 1701
172 Ga0105249_10394035 3300009553 Bacteria 1414
173 Ga0105249_10411103 3300009553 Bacteria 1385
174 Ga0105249_10857969 3300009553 Bacteria 974
175 Ga0105239_10009758 3300010375 Bacteria 10793
176 Ga0105239_11008133 3300010375 Unclassified 957
177 Ga0105246_10022468 3300011119 Bacteria 4069
178 Ga0105246_10402146 3300011119 Unclassified 1137
179 Ga0157371_10000418 3300013102 Bacteria 52571
180 Ga0157371_10230105 3300013102 Bacteria 1332
181 Ga0157371_10664977 3300013102 Bacteria 778
182 Ga0157370_10031223 3300013104 Bacteria 5213
183 Ga0157370_10279993 3300013104 Bacteria 1541
184 Ga0157370_10316278 3300013104 Bacteria 1440
185 Ga0157370_10512171 3300013104 Bacteria 1102
186 Ga0157369_10268728 3300013105 Unclassified 1777
187 Ga0157374_10065650 3300013296 Bacteria 3409
188 Ga0157374_10210426 3300013296 Bacteria 1907
189 Ga0157374_10245048 3300013296 Bacteria 1763
190 Ga0157378_10012920 3300013297 Bacteria 7307
191 Ga0157378_10015360 3300013297 Bacteria 6706
192 Ga0157378_12084224 3300013297 Bacteria 618
193 Ga0163162_10000306 3300013306 Bacteria 45352
194 Ga0163162_10043510 3300013306 Unclassified 4497
195 Ga0163162_10046007 3300013306 Bacteria 4374
196 Ga0163162_10145438 3300013306 Unclassified 2486
197 Ga0163162_10159287 3300013306 Unclassified 2379
198 Ga0163162_10202637 3300013306 Bacteria 2113
199 Ga0163162_10202753 3300013306 Unclassified 2113
200 Ga0163162_10788087 3300013306 Bacteria 1068
201 Ga0163162_11175886 3300013306 Bacteria 870
202 Ga0157372_10205352 3300013307 Unclassified 2283
203 Ga0157375_10074844 3300013308 Bacteria 3409
204 Ga0157375_10092676 3300013308 Bacteria 3085
205 Ga0157375_10411199 3300013308 Bacteria 1519
206 Ga0157375_10545720 3300013308 Bacteria 1321
207 Ga0157375_10886715 3300013308 Bacteria 1037
208 Ga0163163_10234326 3300014325 Unclassified 1885
209 Ga0163163_10407812 3300014325 Unclassified 1417
210 Ga0163163_10599013 3300014325 Bacteria 1165
211 Ga0157380_10000502 3300014326 Bacteria 23918
212 Ga0157380_10003817 3300014326 Bacteria 10373
213 Ga0157380_10165508 3300014326 Bacteria 1926
214 Ga0157380_10368701 3300014326 Bacteria 1350
215 Ga0157380_10463675 3300014326 Bacteria 1220
216 Ga0157377_10003971 3300014745 Bacteria 6747
217 Ga0157377_10062119 3300014745 Bacteria 2137
218 Ga0157377_10268738 3300014745 Bacteria 1113
219 Ga0157376_10019851 3300014969 Bacteria 5188
220 Ga0157376_10109864 3300014969 Bacteria 2425
221 Ga0157376_11282475 3300014969 Bacteria 762
222 Ga0182007_10023907 3300015262 Bacteria 2144
223 Ga0182007_10039406 3300015262 Bacteria 1581
224 Ga0163161_10024742 3300017792 Bacteria 4244
225 Ga0163161_10048521 3300017792 Bacteria 3066
226 Ga0163161_10163971 3300017792 Unclassified 1696
227 Ga0213876_10173431 3300021384 Bacteria 1147
228 Ga0209676_1000332 3300025292 Bacteria 90798
229 Ga0207682_10080582 3300025893 Bacteria 1394
230 Ga0207642_10008779 3300025899 Unclassified 3488
231 Ga0207642_10019944 3300025899 Unclassified 2607
232 Ga0207688_10011474 3300025901 Bacteria 4823
233 Ga0207680_10495365 3300025903 Bacteria 870
234 Ga0207645_10000487 3300025907 Bacteria 32876
235 Ga0207645_10007389 3300025907 Bacteria 7770
236 Ga0207645_10119454 3300025907 Bacteria 1710
237 Ga0207643_10008261 3300025908 Bacteria 5588
238 Ga0207643_10178488 3300025908 Bacteria 1284
239 Ga0207643_10407947 3300025908 Bacteria 860
240 Ga0207654_10195566 3300025911 Bacteria 1328
241 Ga0207671_10276853 3300025914 Unclassified 1323
242 Ga0207662_10098218 3300025918 Bacteria 1811
243 Ga0207681_10018827 3300025923 Bacteria 4355
244 Ga0207681_10030329 3300025923 Bacteria 3525
245 Ga0207681_10047771 3300025923 Bacteria 2886
246 Ga0207681_10055571 3300025923 Bacteria 2697
247 Ga0207681_10400029 3300025923 Bacteria 1109
248 Ga0207650_10054453 3300025925 Bacteria 2967
249 Ga0207650_10079901 3300025925 Bacteria 2478
250 Ga0207650_10101492 3300025925 Unclassified 2215
251 Ga0207659_10058452 3300025926 Bacteria 2768
252 Ga0207659_10117548 3300025926 Bacteria 2032
253 Ga0207659_10513619 3300025926 Bacteria 1015
254 Ga0207659_10562799 3300025926 Bacteria 970
255 Ga0207659_10726709 3300025926 Unclassified 851
256 Ga0207644_10454329 3300025931 Bacteria 1053
257 Ga0207706_10009705 3300025933 Bacteria 8834
258 Ga0207706_10037886 3300025933 Bacteria 4279
259 Ga0207686_10053180 3300025934 Unclassified 2530
260 Ga0207686_10102387 3300025934 Bacteria 1914
261 Ga0207686_10314242 3300025934 Bacteria 1168
262 Ga0207686_10757557 3300025934 Bacteria 775
263 Ga0207670_10097054 3300025936 Bacteria 2097
264 Ga0207670_10219871 3300025936 Bacteria 1453
265 Ga0207669_10243016 3300025937 Bacteria 1336
266 Ga0207704_10026651 3300025938 Unclassified 3174
267 Ga0207704_10108682 3300025938 Unclassified 1869
268 Ga0207704_10223905 3300025938 Bacteria 1394
269 Ga0207691_10034558 3300025940 Bacteria 4700
270 Ga0207691_10051734 3300025940 Bacteria 3754
271 Ga0207691_10077813 3300025940 Bacteria 2987
272 Ga0207691_11020503 3300025940 Bacteria 690
273 Ga0207711_10507563 3300025941 Unclassified 1124
274 Ga0207689_10004250 3300025942 Bacteria 13023
275 Ga0207689_10046819 3300025942 Bacteria 3573
276 Ga0207689_10088855 3300025942 Bacteria 2538
277 Ga0207689_10112309 3300025942 Bacteria 2240
278 Ga0207689_10173103 3300025942 Unclassified 1780
279 Ga0207689_10770958 3300025942 Unclassified 812
280 Ga0207679_10117716 3300025945 Unclassified 2109
281 Ga0207679_10271881 3300025945 Unclassified 1450
282 Ga0207679_10435692 3300025945 Bacteria 1160
283 Ga0207667_10003830 3300025949 Bacteria 18496
284 Ga0207651_10033507 3300025960 Bacteria 3314
285 Ga0207651_10225138 3300025960 Bacteria 1519
286 Ga0207651_10228855 3300025960 Bacteria 1508
287 Ga0207651_10620138 3300025960 Bacteria 947
288 Ga0207712_10001641 3300025961 Bacteria 15072
289 Ga0207712_10015848 3300025961 Bacteria 4870
290 Ga0207712_10040599 3300025961 Bacteria 3195
291 Ga0207712_10099709 3300025961 Bacteria 2157
292 Ga0207712_10101469 3300025961 Bacteria 2140
293 Ga0207712_10624227 3300025961 Bacteria 934
294 Ga0207668_10026335 3300025972 Unclassified 3775
295 Ga0207668_10074048 3300025972 Bacteria 2443
296 Ga0207640_10071946 3300025981 Bacteria 2331
297 Ga0207640_10776978 3300025981 Bacteria 828
298 Ga0207658_10042012 3300025986 Unclassified 3314
299 Ga0207658_10080438 3300025986 Bacteria 2496
300 Ga0207658_10471649 3300025986 Bacteria 1114
301 Ga0207658_10609948 3300025986 Bacteria 981
302 Ga0207658_10892878 3300025986 Unclassified 809
303 Ga0207703_10239034 3300026035 Unclassified 1632
304 Ga0207703_10399010 3300026035 Unclassified 1276
305 Ga0207639_10055701 3300026041 Unclassified 3027
306 Ga0207708_10083116 3300026075 Unclassified 2461
307 Ga0207702_10549709 3300026078 Bacteria 1129
308 Ga0207641_10000730 3300026088 Bacteria 35276
309 Ga0207641_10023068 3300026088 Bacteria 5127
310 Ga0207641_10051494 3300026088 Bacteria 3487
311 Ga0207641_10403080 3300026088 Bacteria 1314
312 Ga0207641_11442085 3300026088 Bacteria 690
313 Ga0207648_10002702 3300026089 Bacteria 18874
314 Ga0207648_10010266 3300026089 Bacteria 8891
315 Ga0207648_10126973 3300026089 Bacteria 2244
316 Ga0207648_10236127 3300026089 Bacteria 1627
317 Ga0207648_10325209 3300026089 Bacteria 1382
318 Ga0207648_10363530 3300026089 Bacteria 1306
319 Ga0207676_10080959 3300026095 Unclassified 2637
320 Ga0207674_10023613 3300026116 Bacteria 6583
321 Ga0207674_10198775 3300026116 Unclassified 1954
322 Ga0207674_10470419 3300026116 Bacteria 1215
323 Ga0207675_100009244 3300026118 Bacteria 9244
324 Ga0207675_100032433 3300026118 Bacteria 4866
325 Ga0207675_100249191 3300026118 Bacteria 1718
326 Ga0207675_100482660 3300026118 Unclassified 1232
327 Ga0207675_100602575 3300026118 Unclassified 1102
328 Ga0207683_10002626 3300026121 Bacteria 15705
329 Ga0207683_10073095 3300026121 Bacteria 3033
330 Ga0207683_10132289 3300026121 Bacteria 2244
331 Ga0207683_10230089 3300026121 Bacteria 1690
332 Ga0207683_10295342 3300026121 Unclassified 1482
333 Ga0207683_10870495 3300026121 Unclassified 836
334 Ga0207698_10109131 3300026142 Bacteria 2315
335 Ga0207698_10235422 3300026142 Bacteria 1665
336 Ga0207698_10819928 3300026142 Bacteria 934
337 Ga0207428_10090060 3300027907 Bacteria 2383
338 Ga0268266_10113262 3300028379 Bacteria 2405
339 Ga0268265_10143612 3300028380 Bacteria 2002
340 Ga0268265_10207802 3300028380 Bacteria 1703
341 Ga0268265_10237563 3300028380 Bacteria 1606
342 Ga0268265_10443534 3300028380 Bacteria 1210
343 Ga0268265_10937761 3300028380 Bacteria 852
344 Ga0268264_10002276 3300028381 Bacteria 17012
345 Ga0268264_10010665 3300028381 Bacteria 7592
346 Ga0268264_10125773 3300028381 Bacteria 2265
347 Ga0268264_10401157 3300028381 Bacteria 1318
348 Ga0307515_10000469 3300028794 Bacteria 96345
349 Ga0307515_10052864 3300028794 Bacteria 6011
350 Ga0307512_10200357 3300030522 Bacteria 1082
351 Ga0316177_1035720 3300030731 Bacteria 7719
352 Ga0316176_1136190 3300030732 Bacteria 18590
353 Ga0316183_1141180 3300030742 Bacteria 31751
354 Ga0316181_1017039 3300030744 Bacteria 26728
355 Ga0316182_1216377 3300030745 Unclassified 1587
356 Ga0307513_10088351 3300031456 Bacteria 3168
357 Ga0307513_10198793 3300031456 Unclassified 1848
358 Ga0307513_10394059 3300031456 Bacteria 1121
359 Ga0307509_10738882 3300031507 Bacteria 650
360 Ga0316576_10443172 3300031727 Unclassified 960
361 Ga0307405_10094196 3300031731 Bacteria 1991
362 Ga0307405_10193166 3300031731 Unclassified 1472
363 Ga0307413_10599859 3300031824 Bacteria 901
364 Ga0307413_10732248 3300031824 Bacteria 825
365 Ga0307406_10921130 3300031901 Unclassified 745
366 Ga0307412_10018016 3300031911 Unclassified 4239
367 Ga0307412_10161666 3300031911 Unclassified 1665
368 Ga0307412_10163950 3300031911 Bacteria 1655
369 Ga0307412_10204327 3300031911 Bacteria 1502
370 Ga0307416_100216461 3300032002 Bacteria 1833
371 Ga0307414_10000235 3300032004 Bacteria 35379
372 Ga0307414_10012260 3300032004 Bacteria 5062
373 Ga0307414_10015588 3300032004 Bacteria 4590
374 Ga0307414_10019006 3300032004 Bacteria 4248
375 Ga0307414_10228121 3300032004 Bacteria 1534
376 Ga0307414_10274986 3300032004 Bacteria 1412
377 Ga0307414_10375282 3300032004 Bacteria 1228
378 Ga0307414_10400306 3300032004 Bacteria 1192
379 Ga0307414_10567551 3300032004 Bacteria 1013
380 Ga0307414_10697951 3300032004 Bacteria 918
381 Ga0307414_10806055 3300032004 Bacteria 856
382 Ga0307411_10148209 3300032005 Bacteria 1740
383 Ga0307415_100080937 3300032126 Unclassified 2319
384 Ga0373952_0126379 3300035092 Bacteria 698
385 Ga0316574_0042233 3300035398 Bacteria 2813
386 Ga0373925_0839478 3300037068 Bacteria 757
387 Ga0395905_0519905 3300037471 Unclassified 1091
388 Ga0439436_0011406 3300041404 Bacteria 2699
389 Ga0439439_0007467 3300041406 Bacteria 2559
390 Ga0451802_0145012 3300041460 Bacteria 1634
391 Ga0451833_0388626 3300041491 Bacteria 1144
392 Ga0451837_0928200 3300041494 Bacteria 1249
393 Ga0451841_0438562 3300041498 Unclassified 990
394 Ga0451851_0497521 3300041507 Unclassified 1007
395 Ga0451853_2297526 3300041512 Bacteria 1344
396 Ga0451853_3199655 3300041512 Bacteria 1209
397 Ga0439431_0000842 3300041997 Bacteria 6620
398 Ga0439442_007186 3300042002 Bacteria 2240
399 Ga0439449_0003965 3300042007 Bacteria 5725
400 Ga0439457_007191 3300042014 Bacteria 2684
401 Ga0439462_0017750 3300042015 Bacteria 1844
402 Ga0450923_027111 3300042125 Unclassified 1150
403 Ga0450898_021630 3300042134 Bacteria 1134
404 Ga0450899_009111 3300042135 Bacteria 1091
405 Ga0451577_0008277 3300042876 Bacteria 10128
406 Ga0451577_0009201 3300042876 Bacteria 9528
407 Ga0451577_0217388 3300042876 Bacteria 1727
408 Ga0466969_0079520 3300044656 Bacteria 1567
409 Ga0466972_0002404 3300044658 Bacteria 9228
410 Ga0453683_0001234 3300044673 Bacteria 22905
411 Ga0453684_0001120 3300044712 Bacteria 83961
412 Ga0453684_0002756 3300044712 Bacteria 41615
413 Ga0453684_0050678 3300044712 Bacteria 5457
414 Ga0453684_1110198 3300044712 Bacteria 835
415 Ga0453684_1336444 3300044712 Bacteria 746
416 Ga0453684_1495297 3300044712 Bacteria 697
417 Ga0451576_0129396 3300045051 Bacteria 2631
418 Ga0451576_0147451 3300045051 Unclassified 2454
419 Ga0451576_0446811 3300045051 Bacteria 1357
420 Ga0495643_0045179 3300046522 Unclassified 2392
421 Ga0495668_0019141 3300046616 Bacteria 3950
422 Ga0495611_0000042 3300046648 Bacteria 94996
423 Ga0495687_000227 3300047443 Bacteria 79368
424 Ga0496100_0119859 3300048903 Bacteria 1839
425 Ga0496114_0040216 3300048917 Bacteria 3870
426 Ga0501292_044685 3300049515 Unclassified 773
427 Ga0501033_0375491 3300049570 Bacteria 994
428 Ga0501034_0008020 3300049571 Bacteria 11209
429 Ga0501034_0101863 3300049571 Bacteria 2865
430 Ga0501034_0200248 3300049571 Bacteria 1955
431 Ga0501037_0017669 3300049573 Bacteria 5250
432 Ga0501038_0012471 3300049574 Bacteria 7766
433 Ga0501039_0098591 3300049575 Bacteria 2280
434 Ga0501047_0014354 3300049581 Bacteria 7531
435 Ga0501201_000138 3300049651 Bacteria 6100
436 Ga0501202_002041 3300049652 Bacteria 3338
437 Ga0501207_000634 3300049654 Bacteria 4077
438 Ga0501217_008337 3300049661 Bacteria 2237
439 Ga0501223_001562 3300049663 Bacteria 5275
440 Ga0501223_017404 3300049663 Bacteria 1419
441 Ga0501233_042501 3300049668 Unclassified 1073
442 Ga0501235_007538 3300049669 Bacteria 2369
443 Ga0501240_021657 3300049673 Bacteria 973
444 Ga0501243_001425 3300049675 Bacteria 3425
445 Ga0501246_021882 3300049676 Unclassified 667
446 Ga0501251_001896 3300049681 Bacteria 1981
447 Ga0501257_000854 3300049686 Bacteria 6116
448 Ga0501259_003795 3300049688 Bacteria 2401
449 Ga0501259_005544 3300049688 Bacteria 2001
450 Ga0501221_001693 3300049704 Bacteria 3668
451 Ga0501221_027270 3300049704 Unclassified 1167
452 Ga0501225_0001386 3300049705 Bacteria 7570
453 Ga0501225_0005483 3300049705 Bacteria 3722
454 Ga0501225_0116676 3300049705 Unclassified 790
455 Ga0501234_006603 3300049707 Bacteria 1814
456 Ga0501279_003071 3300049775 Bacteria 2169
457 Ga0501035_0014403 3300049822 Bacteria 7299
458 Ga0501044_0029068 3300049823 Bacteria 5830
459 Ga0501044_0264556 3300049823 Bacteria 1657
460 nmdc:mga07m45_228987_c1 3300050496 Bacteria 1081
461 nmdc:mga05p37_16038_c1 3300050507 Bacteria 9016
462 nmdc:mga05p37_468521_c1 3300050507 Unclassified 1454
463 nmdc:mga05p37_564788_c1 3300050507 Unclassified 1292
464 nmdc:mga09592_231850_c1 3300050508 Bacteria 1600
465 nmdc:mga09592_61351_c1 3300050508 Bacteria 3180
466 nmdc:mga09592_7117_c1 3300050508 Bacteria 9094
467 nmdc:mga0qj67_246894_c1 3300050509 Bacteria 1448
468 nmdc:mga06r32_456939_c1 3300050510 Unclassified 1256
469 nmdc:mga08y16_245760_c1 3300050511 Unclassified 1849
470 nmdc:mga08y16_290611_c1 3300050511 Bacteria 1685
471 nmdc:mga08y16_71550_c1 3300050511 Bacteria 3614
472 nmdc:mga08y16_90988_c1 3300050511 Bacteria 3180
473 nmdc:mga08y16_959855_c1 3300050511 Bacteria 837
474 Ga0500644_0025600 3300053088 Bacteria 1818
475 Ga0500583_0000080 3300053092 Bacteria 55700
476 Ga0500556_0105042 3300053104 Bacteria 1091
477 Ga0500652_087676 3300053131 Bacteria 1299
478 Ga0500588_0227933 3300053146 Unclassified 696
479 Ga0500589_029891 3300053147 Bacteria 2536
480 Ga0500622_0015185 3300053156 Bacteria 4129
481 Ga0500645_070590 3300053730 Bacteria 1003
482 Ga0500661_018544 3300055283 Bacteria 1240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_101089998 Ga0068867_1010899981 189
2 3300013306 Ga0163162_10145438 Ga0163162_101454384 189
3 iso_pu_bacteria 2884634485 2884636248 189
4 3300003320 rootH2_10004559 rootH2_1000455972 190
5 3300005331 Ga0070670_100013520 Ga0070670_1000135208 190
6 3300005334 Ga0068869_100081945 Ga0068869_1000819452 190
7 3300005354 Ga0070675_100105464 Ga0070675_1001054642 190
8 3300005549 Ga0070704_100110823 Ga0070704_1001108233 190
9 3300014326 Ga0157380_10368701 Ga0157380_103687013 190
10 3300055283 Ga0500661_018544 Ga0500661_018544_417_1007 190
11 3300005290 Ga0065712_10087423 Ga0065712_100874231 191
12 3300005330 Ga0070690_100049983 Ga0070690_1000499832 191
13 3300005331 Ga0070670_100283199 Ga0070670_1002831992 191
14 3300005340 Ga0070689_100137126 Ga0070689_1001371261 191
15 3300005347 Ga0070668_100064972 Ga0070668_1000649722 191
16 3300005354 Ga0070675_100074023 Ga0070675_1000740231 191
17 3300005364 Ga0070673_100121543 Ga0070673_1001215432 191
18 3300005365 Ga0070688_100038599 Ga0070688_1000385992 191
19 3300005444 Ga0070694_100397679 Ga0070694_1003976791 191
20 3300005457 Ga0070662_100056769 Ga0070662_1000567692 191
21 3300005549 Ga0070704_100366766 Ga0070704_1003667662 191
22 3300005564 Ga0070664_100690568 Ga0070664_1006905682 191
23 3300005577 Ga0068857_100049074 Ga0068857_1000490743 191
24 3300005840 Ga0068870_10046656 Ga0068870_100466562 191
25 3300005842 Ga0068858_100433464 Ga0068858_1004334642 191
26 3300005843 Ga0068860_100346578 Ga0068860_1003465782 191
27 3300005844 Ga0068862_100039409 Ga0068862_1000394092 191
28 3300006881 Ga0068865_100241311 Ga0068865_1002413112 191
29 3300009094 Ga0111539_10089892 Ga0111539_100898922 191
30 3300009176 Ga0105242_10010772 Ga0105242_100107727 191
31 3300009553 Ga0105249_10087604 Ga0105249_100876042 191
32 3300009553 Ga0105249_10394035 Ga0105249_103940352 191
33 3300013102 Ga0157371_10664977 Ga0157371_106649772 191
34 3300013308 Ga0157375_10545720 Ga0157375_105457201 191
35 3300014326 Ga0157380_10003817 Ga0157380_1000381710 191
36 3300014745 Ga0157377_10003971 Ga0157377_100039711 191
37 3300025907 Ga0207645_10007389 Ga0207645_100073894 191
38 3300025908 Ga0207643_10008261 Ga0207643_100082615 191
39 3300025923 Ga0207681_10018827 Ga0207681_100188272 191
40 3300025933 Ga0207706_10037886 Ga0207706_100378862 191
41 3300025934 Ga0207686_10102387 Ga0207686_101023872 191
42 3300025938 Ga0207704_10223905 Ga0207704_102239052 191
43 3300025940 Ga0207691_10034558 Ga0207691_100345585 191
44 3300025945 Ga0207679_10435692 Ga0207679_104356922 191
45 3300025960 Ga0207651_10228855 Ga0207651_102288552 191
46 3300025961 Ga0207712_10099709 Ga0207712_100997092 191
47 3300025961 Ga0207712_10101469 Ga0207712_101014691 191
48 3300025972 Ga0207668_10074048 Ga0207668_100740483 191
49 3300025986 Ga0207658_10892878 Ga0207658_108928781 191
50 3300026116 Ga0207674_10023613 Ga0207674_100236139 191
51 3300026118 Ga0207675_100009244 Ga0207675_1000092442 191
52 3300028380 Ga0268265_10143612 Ga0268265_101436123 191
53 3300028380 Ga0268265_10207802 Ga0268265_102078022 191
54 3300028381 Ga0268264_10401157 Ga0268264_104011572 191
55 3300028794 Ga0307515_10052864 Ga0307515_100528642 191
56 3300031456 Ga0307513_10198793 Ga0307513_101987932 191
57 3300049686 Ga0501257_000854 Ga0501257_000854_5238_5828 191
58 3300050511 nmdc:mga08y16_90988_c1 nmdc:mga08y16_90988_c1_1560_2147 191
59 iso_pu_bacteria 2738541278 2738727689 191
60 iso_pu_bacteria 2840677318 2840678145 191
61 iso_pu_bacteria 2842903701 2842908032 191
62 iso_pu_bacteria 2883068021 2883070652 191
63 iso_pu_bacteria 2884791551 2884797494 191
64 iso_pu_bacteria 2896085136 2896085963 191
65 iso_pu_bacteria 2896109856 2896115508 191
66 3300005335 Ga0070666_10524384 Ga0070666_105243841 192
67 3300006844 Ga0075428_100015432 Ga0075428_1000154324 192
68 3300006846 Ga0075430_100157126 Ga0075430_1001571261 192
69 3300006880 Ga0075429_100781209 Ga0075429_1007812091 192
70 3300025903 Ga0207680_10495365 Ga0207680_104953651 192
71 3300026089 Ga0207648_10325209 Ga0207648_103252092 192
72 3300027907 Ga0207428_10090060 Ga0207428_100900604 192
73 3300041491 Ga0451833_0388626 Ga0451833_0388626_509_1108 192
74 3300049571 Ga0501034_0101863 Ga0501034_0101863_366_959 192
75 3300050508 nmdc:mga09592_231850_c1 nmdc:mga09592_231850_c1_943_1548 192
76 3300050511 nmdc:mga08y16_71550_c1 nmdc:mga08y16_71550_c1_2545_3150 192
77 3300053088 Ga0500644_0025600 Ga0500644_0025600_361_957 192
78 3300053131 Ga0500652_087676 Ga0500652_087676_173_769 192
79 3300053156 Ga0500622_0015185 Ga0500622_0015185_2938_3534 192
80 iso_pu_bacteria 2818991460 2819677575 192
81 iso_pu_bacteria 2910245624 2910246610 192
82 3300005333 Ga0070677_10164956 Ga0070677_101649561 193
83 3300005356 Ga0070674_100030209 Ga0070674_1000302091 193
84 3300005459 Ga0068867_100958080 Ga0068867_1009580801 193
85 3300005834 Ga0068851_10217811 Ga0068851_102178112 193
86 3300005843 Ga0068860_100002698 Ga0068860_10000269815 193
87 3300006237 Ga0097621_100869736 Ga0097621_1008697362 193
88 3300006358 Ga0068871_100216918 Ga0068871_1002169183 193
89 3300009094 Ga0111539_11157915 Ga0111539_111579151 193
90 3300013296 Ga0157374_10245048 Ga0157374_102450482 193
91 3300013306 Ga0163162_10000306 Ga0163162_1000030624 193
92 3300014326 Ga0157380_10000502 Ga0157380_100005028 193
93 3300014969 Ga0157376_11282475 Ga0157376_112824751 193
94 3300025893 Ga0207682_10080582 Ga0207682_100805821 193
95 3300026089 Ga0207648_10363530 Ga0207648_103635303 193
96 3300026121 Ga0207683_10870495 Ga0207683_108704952 193
97 3300028381 Ga0268264_10002276 Ga0268264_1000227616 193
98 3300032004 Ga0307414_10000235 Ga0307414_1000023534 193
99 3300032004 Ga0307414_10015588 Ga0307414_100155882 193
100 3300032004 Ga0307414_10375282 Ga0307414_103752821 193
101 3300032004 Ga0307414_10567551 Ga0307414_105675511 193
102 3300035398 Ga0316574_0042233 Ga0316574_0042233_1039_1650 193
103 3300041494 Ga0451837_0928200 Ga0451837_0928200_349_945 193
104 3300042002 Ga0439442_007186 Ga0439442_007186_1388_2029 193
105 3300042007 Ga0439449_0003965 Ga0439449_0003965_4791_5432 193
106 3300042134 Ga0450898_021630 Ga0450898_021630_496_1089 193
107 3300042135 Ga0450899_009111 Ga0450899_009111_460_1053 193
108 3300042876 Ga0451577_0008277 Ga0451577_0008277_5565_6164 193
109 3300044673 Ga0453683_0001234 Ga0453683_0001234_275_874 193
110 3300044712 Ga0453684_0001120 Ga0453684_0001120_49461_50060 193
111 3300044712 Ga0453684_1110198 Ga0453684_1110198_92_691 193
112 3300045051 Ga0451576_0129396 Ga0451576_0129396_598_1197 193
113 3300045051 Ga0451576_0147451 Ga0451576_0147451_1354_1950 193
114 3300046522 Ga0495643_0045179 Ga0495643_0045179_1170_1763 193
115 3300049570 Ga0501033_0375491 Ga0501033_0375491_86_682 193
116 3300049571 Ga0501034_0008020 Ga0501034_0008020_5914_6510 193
117 3300049573 Ga0501037_0017669 Ga0501037_0017669_1636_2232 193
118 3300049574 Ga0501038_0012471 Ga0501038_0012471_6666_7262 193
119 3300049575 Ga0501039_0098591 Ga0501039_0098591_1586_2182 193
120 3300049581 Ga0501047_0014354 Ga0501047_0014354_6713_7309 193
121 3300049822 Ga0501035_0014403 Ga0501035_0014403_182_778 193
122 3300049823 Ga0501044_0029068 Ga0501044_0029068_4660_5256 193
123 3300049823 Ga0501044_0264556 Ga0501044_0264556_539_1135 193
124 3300050511 nmdc:mga08y16_959855_c1 nmdc:mga08y16_959855_c1_135_728 193
125 iso_pu_bacteria 2522125168 2522549455 193
126 3300005262 Ga0065165_1000131 Ga0065165_100013181 194
127 3300005290 Ga0065712_10076506 Ga0065712_100765061 194
128 3300005331 Ga0070670_100187851 Ga0070670_1001878512 194
129 3300005333 Ga0070677_10042935 Ga0070677_100429352 194
130 3300005334 Ga0068869_100083641 Ga0068869_1000836415 194
131 3300005338 Ga0068868_100009004 Ga0068868_1000090047 194
132 3300005340 Ga0070689_100688930 Ga0070689_1006889301 194
133 3300005343 Ga0070687_100384823 Ga0070687_1003848232 194
134 3300005347 Ga0070668_100009723 Ga0070668_1000097238 194
135 3300005353 Ga0070669_100028809 Ga0070669_1000288096 194
136 3300005353 Ga0070669_100743558 Ga0070669_1007435582 194
137 3300005353 Ga0070669_100887394 Ga0070669_1008873941 194
138 3300005354 Ga0070675_100045511 Ga0070675_1000455111 194
139 3300005354 Ga0070675_100241006 Ga0070675_1002410063 194
140 3300005355 Ga0070671_100074972 Ga0070671_1000749722 194
141 3300005355 Ga0070671_100738339 Ga0070671_1007383391 194
142 3300005356 Ga0070674_100123141 Ga0070674_1001231411 194
143 3300005364 Ga0070673_100021950 Ga0070673_1000219506 194
144 3300005365 Ga0070688_100049703 Ga0070688_1000497032 194
145 3300005367 Ga0070667_100011174 Ga0070667_1000111742 194
146 3300005367 Ga0070667_100691808 Ga0070667_1006918081 194
147 3300005435 Ga0070714_100462900 Ga0070714_1004629002 194
148 3300005456 Ga0070678_100174269 Ga0070678_1001742691 194
149 3300005457 Ga0070662_100134698 Ga0070662_1001346981 194
150 3300005459 Ga0068867_100225428 Ga0068867_1002254283 194
151 3300005466 Ga0070685_10024298 Ga0070685_100242982 194
152 3300005518 Ga0070699_100076523 Ga0070699_1000765233 194
153 3300005543 Ga0070672_100195138 Ga0070672_1001951383 194
154 3300005543 Ga0070672_100509860 Ga0070672_1005098602 194
155 3300005543 Ga0070672_100950395 Ga0070672_1009503951 194
156 3300005548 Ga0070665_100103681 Ga0070665_1001036812 194
157 3300005578 Ga0068854_100165370 Ga0068854_1001653703 194
158 3300005616 Ga0068852_100251547 Ga0068852_1002515471 194
159 3300005617 Ga0068859_100115351 Ga0068859_1001153516 194
160 3300005617 Ga0068859_100134348 Ga0068859_1001343482 194
161 3300005617 Ga0068859_100180003 Ga0068859_1001800032 194
162 3300005618 Ga0068864_100480145 Ga0068864_1004801452 194
163 3300005718 Ga0068866_10031547 Ga0068866_100315474 194
164 3300005719 Ga0068861_100041391 Ga0068861_1000413913 194
165 3300005719 Ga0068861_100390170 Ga0068861_1003901702 194
166 3300005834 Ga0068851_10518251 Ga0068851_105182511 194
167 3300005840 Ga0068870_10489173 Ga0068870_104891731 194
168 3300005841 Ga0068863_100031816 Ga0068863_1000318162 194
169 3300005841 Ga0068863_100053646 Ga0068863_1000536463 194
170 3300005842 Ga0068858_100047763 Ga0068858_1000477633 194
171 3300005843 Ga0068860_100007550 Ga0068860_1000075503 194
172 3300005844 Ga0068862_100017563 Ga0068862_1000175635 194
173 3300006358 Ga0068871_100164548 Ga0068871_1001645483 194
174 3300006881 Ga0068865_100019152 Ga0068865_1000191527 194
175 3300006881 Ga0068865_100163274 Ga0068865_1001632741 194
176 3300006931 Ga0097620_100115352 Ga0097620_1001153526 194
177 3300006931 Ga0097620_100134346 Ga0097620_1001343463 194
178 3300006931 Ga0097620_100180001 Ga0097620_1001800012 194
179 3300009094 Ga0111539_10267442 Ga0111539_102674422 194
180 3300009176 Ga0105242_10009711 Ga0105242_100097116 194
181 3300009176 Ga0105242_10245503 Ga0105242_102455032 194
182 3300009553 Ga0105249_10001693 Ga0105249_100016934 194
183 3300009553 Ga0105249_10065955 Ga0105249_100659552 194
184 3300009553 Ga0105249_10857969 Ga0105249_108579691 194
185 3300011119 Ga0105246_10022468 Ga0105246_100224685 194
186 3300013102 Ga0157371_10000418 Ga0157371_1000041840 194
187 3300013102 Ga0157371_10230105 Ga0157371_102301052 194
188 3300013104 Ga0157370_10031223 Ga0157370_100312234 194
189 3300013104 Ga0157370_10279993 Ga0157370_102799932 194
190 3300013104 Ga0157370_10316278 Ga0157370_103162782 194
191 3300013104 Ga0157370_10512171 Ga0157370_105121712 194
192 3300013296 Ga0157374_10210426 Ga0157374_102104262 194
193 3300013297 Ga0157378_10015360 Ga0157378_100153604 194
194 3300013297 Ga0157378_12084224 Ga0157378_120842241 194
195 3300013306 Ga0163162_10046007 Ga0163162_100460072 194
196 3300013306 Ga0163162_10202637 Ga0163162_102026372 194
197 3300013306 Ga0163162_11175886 Ga0163162_111758861 194
198 3300013308 Ga0157375_10092676 Ga0157375_100926762 194
199 3300014325 Ga0163163_10599013 Ga0163163_105990132 194
200 3300014745 Ga0157377_10062119 Ga0157377_100621192 194
201 3300017792 Ga0163161_10024742 Ga0163161_100247422 194
202 3300017792 Ga0163161_10163971 Ga0163161_101639712 194
203 3300021384 Ga0213876_10173431 Ga0213876_101734312 194
204 3300025292 Ga0209676_1000332 Ga0209676_100033275 194
205 3300025899 Ga0207642_10008779 Ga0207642_100087792 194
206 3300025901 Ga0207688_10011474 Ga0207688_100114742 194
207 3300025907 Ga0207645_10000487 Ga0207645_1000048719 194
208 3300025907 Ga0207645_10119454 Ga0207645_101194542 194
209 3300025923 Ga0207681_10030329 Ga0207681_100303294 194
210 3300025923 Ga0207681_10055571 Ga0207681_100555713 194
211 3300025925 Ga0207650_10101492 Ga0207650_101014922 194
212 3300025926 Ga0207659_10058452 Ga0207659_100584522 194
213 3300025926 Ga0207659_10562799 Ga0207659_105627992 194
214 3300025926 Ga0207659_10726709 Ga0207659_107267092 194
215 3300025931 Ga0207644_10454329 Ga0207644_104543291 194
216 3300025934 Ga0207686_10053180 Ga0207686_100531804 194
217 3300025934 Ga0207686_10314242 Ga0207686_103142422 194
218 3300025934 Ga0207686_10757557 Ga0207686_107575571 194
219 3300025936 Ga0207670_10219871 Ga0207670_102198712 194
220 3300025938 Ga0207704_10026651 Ga0207704_100266515 194
221 3300025938 Ga0207704_10108682 Ga0207704_101086822 194
222 3300025942 Ga0207689_10004250 Ga0207689_100042504 194
223 3300025960 Ga0207651_10620138 Ga0207651_106201382 194
224 3300025961 Ga0207712_10001641 Ga0207712_100016414 194
225 3300025961 Ga0207712_10040599 Ga0207712_100405992 194
226 3300025986 Ga0207658_10080438 Ga0207658_100804382 194
227 3300025986 Ga0207658_10609948 Ga0207658_106099481 194
228 3300026041 Ga0207639_10055701 Ga0207639_100557012 194
229 3300026088 Ga0207641_10000730 Ga0207641_1000073018 194
230 3300026088 Ga0207641_10051494 Ga0207641_100514943 194
231 3300026089 Ga0207648_10002702 Ga0207648_100027028 194
232 3300026089 Ga0207648_10126973 Ga0207648_101269731 194
233 3300026118 Ga0207675_100032433 Ga0207675_1000324332 194
234 3300026121 Ga0207683_10002626 Ga0207683_1000262611 194
235 3300026121 Ga0207683_10132289 Ga0207683_101322893 194
236 3300026142 Ga0207698_10109131 Ga0207698_101091313 194
237 3300026142 Ga0207698_10235422 Ga0207698_102354222 194
238 3300026142 Ga0207698_10819928 Ga0207698_108199281 194
239 3300028379 Ga0268266_10113262 Ga0268266_101132623 194
240 3300028380 Ga0268265_10237563 Ga0268265_102375631 194
241 3300028380 Ga0268265_10443534 Ga0268265_104435342 194
242 3300028380 Ga0268265_10937761 Ga0268265_109377612 194
243 3300028381 Ga0268264_10125773 Ga0268264_101257732 194
244 3300031727 Ga0316576_10443172 Ga0316576_104431722 194
245 3300031731 Ga0307405_10094196 Ga0307405_100941962 194
246 3300031824 Ga0307413_10599859 Ga0307413_105998592 194
247 3300031824 Ga0307413_10732248 Ga0307413_107322481 194
248 3300031911 Ga0307412_10163950 Ga0307412_101639502 194
249 3300031911 Ga0307412_10204327 Ga0307412_102043272 194
250 3300032004 Ga0307414_10019006 Ga0307414_100190062 194
251 3300032004 Ga0307414_10806055 Ga0307414_108060551 194
252 3300032005 Ga0307411_10148209 Ga0307411_101482092 194
253 3300042876 Ga0451577_0009201 Ga0451577_0009201_509_1114 194
254 3300044658 Ga0466972_0002404 Ga0466972_0002404_3337_3936 194
255 3300044712 Ga0453684_0002756 Ga0453684_0002756_509_1114 194
256 3300044712 Ga0453684_1336444 Ga0453684_1336444_77_673 194
257 3300044712 Ga0453684_1495297 Ga0453684_1495297_44_676 194
258 3300045051 Ga0451576_0446811 Ga0451576_0446811_160_765 194
259 3300049515 Ga0501292_044685 Ga0501292_044685_133_729 194
260 3300049651 Ga0501201_000138 Ga0501201_000138_3449_4045 194
261 3300049652 Ga0501202_002041 Ga0501202_002041_843_1439 194
262 3300049654 Ga0501207_000634 Ga0501207_000634_1867_2463 194
263 3300049661 Ga0501217_008337 Ga0501217_008337_480_1076 194
264 3300049663 Ga0501223_001562 Ga0501223_001562_2849_3445 194
265 3300049663 Ga0501223_017404 Ga0501223_017404_596_1192 194
266 3300049668 Ga0501233_042501 Ga0501233_042501_316_912 194
267 3300049669 Ga0501235_007538 Ga0501235_007538_1667_2263 194
268 3300049673 Ga0501240_021657 Ga0501240_021657_163_870 194
269 3300049675 Ga0501243_001425 Ga0501243_001425_1641_2237 194
270 3300049676 Ga0501246_021882 Ga0501246_021882_61_657 194
271 3300049681 Ga0501251_001896 Ga0501251_001896_1189_1785 194
272 3300049688 Ga0501259_003795 Ga0501259_003795_718_1314 194
273 3300049688 Ga0501259_005544 Ga0501259_005544_1320_1916 194
274 3300049704 Ga0501221_001693 Ga0501221_001693_1415_2011 194
275 3300049704 Ga0501221_027270 Ga0501221_027270_369_1064 194
276 3300049705 Ga0501225_0001386 Ga0501225_0001386_1606_2202 194
277 3300049705 Ga0501225_0116676 Ga0501225_0116676_119_715 194
278 3300049707 Ga0501234_006603 Ga0501234_006603_14_610 194
279 3300049775 Ga0501279_003071 Ga0501279_003071_682_1278 194
280 3300050496 nmdc:mga07m45_228987_c1 nmdc:mga07m45_228987_c1_10_645 194
281 3300003316 rootH1_10059693 rootH1_100596933 195
282 3300003320 rootH2_10137598 rootH2_101375981 195
283 3300005290 Ga0065712_10005047 Ga0065712_100050474 195
284 3300005331 Ga0070670_100167052 Ga0070670_1001670523 195
285 3300005334 Ga0068869_100146512 Ga0068869_1001465121 195
286 3300005334 Ga0068869_100421527 Ga0068869_1004215272 195
287 3300005340 Ga0070689_100110207 Ga0070689_1001102072 195
288 3300005347 Ga0070668_100204695 Ga0070668_1002046952 195
289 3300005347 Ga0070668_100403747 Ga0070668_1004037472 195
290 3300005353 Ga0070669_100126632 Ga0070669_1001266323 195
291 3300005354 Ga0070675_100263894 Ga0070675_1002638942 195
292 3300005364 Ga0070673_100343619 Ga0070673_1003436192 195
293 3300005364 Ga0070673_100470219 Ga0070673_1004702192 195
294 3300005441 Ga0070700_100145348 Ga0070700_1001453482 195
295 3300005456 Ga0070678_100571230 Ga0070678_1005712302 195
296 3300005459 Ga0068867_100139423 Ga0068867_1001394232 195
297 3300005471 Ga0070698_100000936 Ga0070698_10000093614 195
298 3300005471 Ga0070698_100003346 Ga0070698_10000334618 195
299 3300005471 Ga0070698_100014293 Ga0070698_1000142932 195
300 3300005518 Ga0070699_101039162 Ga0070699_1010391622 195
301 3300005543 Ga0070672_100147810 Ga0070672_1001478102 195
302 3300005563 Ga0068855_100005467 Ga0068855_10000546715 195
303 3300005564 Ga0070664_100058510 Ga0070664_1000585103 195
304 3300005577 Ga0068857_100130769 Ga0068857_1001307692 195
305 3300005577 Ga0068857_100996914 Ga0068857_1009969141 195
306 3300005578 Ga0068854_100062197 Ga0068854_1000621972 195
307 3300005614 Ga0068856_100425702 Ga0068856_1004257021 195
308 3300005617 Ga0068859_100058490 Ga0068859_1000584902 195
309 3300005618 Ga0068864_100055423 Ga0068864_1000554234 195
310 3300005618 Ga0068864_101017384 Ga0068864_1010173841 195
311 3300005840 Ga0068870_10041730 Ga0068870_100417302 195
312 3300005840 Ga0068870_10124074 Ga0068870_101240743 195
313 3300005841 Ga0068863_100107909 Ga0068863_1001079092 195
314 3300005843 Ga0068860_100020882 Ga0068860_1000208827 195
315 3300005844 Ga0068862_100151762 Ga0068862_1001517623 195
316 3300006195 Ga0075366_10064218 Ga0075366_100642182 195
317 3300006358 Ga0068871_100042277 Ga0068871_1000422772 195
318 3300006358 Ga0068871_100155240 Ga0068871_1001552402 195
319 3300006844 Ga0075428_100004467 Ga0075428_10000446715 195
320 3300006844 Ga0075428_100104814 Ga0075428_1001048143 195
321 3300006844 Ga0075428_100142451 Ga0075428_1001424512 195
322 3300006846 Ga0075430_100022971 Ga0075430_1000229712 195
323 3300006880 Ga0075429_100004646 Ga0075429_10000464611 195
324 3300006931 Ga0097620_100058494 Ga0097620_1000584942 195
325 3300009094 Ga0111539_10377562 Ga0111539_103775622 195
326 3300009094 Ga0111539_11292891 Ga0111539_112928911 195
327 3300009147 Ga0114129_10143067 Ga0114129_101430672 195
328 3300009147 Ga0114129_10495392 Ga0114129_104953922 195
329 3300009174 Ga0105241_10015860 Ga0105241_100158602 195
330 3300009177 Ga0105248_10648310 Ga0105248_106483102 195
331 3300009553 Ga0105249_10130285 Ga0105249_101302852 195
332 3300009553 Ga0105249_10267677 Ga0105249_102676772 195
333 3300009553 Ga0105249_10411103 Ga0105249_104111032 195
334 3300010375 Ga0105239_10009758 Ga0105239_100097584 195
335 3300010375 Ga0105239_11008133 Ga0105239_110081331 195
336 3300013105 Ga0157369_10268728 Ga0157369_102687282 195
337 3300013297 Ga0157378_10012920 Ga0157378_100129202 195
338 3300013306 Ga0163162_10159287 Ga0163162_101592872 195
339 3300013306 Ga0163162_10788087 Ga0163162_107880871 195
340 3300013307 Ga0157372_10205352 Ga0157372_102053522 195
341 3300013308 Ga0157375_10886715 Ga0157375_108867151 195
342 3300014326 Ga0157380_10165508 Ga0157380_101655082 195
343 3300014326 Ga0157380_10463675 Ga0157380_104636752 195
344 3300015262 Ga0182007_10023907 Ga0182007_100239072 195
345 3300015262 Ga0182007_10039406 Ga0182007_100394061 195
346 3300025908 Ga0207643_10178488 Ga0207643_101784882 195
347 3300025908 Ga0207643_10407947 Ga0207643_104079472 195
348 3300025911 Ga0207654_10195566 Ga0207654_101955662 195
349 3300025914 Ga0207671_10276853 Ga0207671_102768532 195
350 3300025918 Ga0207662_10098218 Ga0207662_100982182 195
351 3300025923 Ga0207681_10047771 Ga0207681_100477713 195
352 3300025923 Ga0207681_10400029 Ga0207681_104000292 195
353 3300025925 Ga0207650_10054453 Ga0207650_100544532 195
354 3300025925 Ga0207650_10079901 Ga0207650_100799013 195
355 3300025926 Ga0207659_10117548 Ga0207659_101175482 195
356 3300025926 Ga0207659_10513619 Ga0207659_105136192 195
357 3300025936 Ga0207670_10097054 Ga0207670_100970543 195
358 3300025937 Ga0207669_10243016 Ga0207669_102430162 195
359 3300025940 Ga0207691_10051734 Ga0207691_100517343 195
360 3300025940 Ga0207691_10077813 Ga0207691_100778133 195
361 3300025942 Ga0207689_10046819 Ga0207689_100468194 195
362 3300025942 Ga0207689_10088855 Ga0207689_100888551 195
363 3300025942 Ga0207689_10173103 Ga0207689_101731032 195
364 3300025942 Ga0207689_10770958 Ga0207689_107709581 195
365 3300025945 Ga0207679_10117716 Ga0207679_101177162 195
366 3300025949 Ga0207667_10003830 Ga0207667_100038304 195
367 3300025960 Ga0207651_10033507 Ga0207651_100335074 195
368 3300025960 Ga0207651_10225138 Ga0207651_102251382 195
369 3300025961 Ga0207712_10624227 Ga0207712_106242271 195
370 3300025972 Ga0207668_10026335 Ga0207668_100263353 195
371 3300025981 Ga0207640_10776978 Ga0207640_107769781 195
372 3300025986 Ga0207658_10042012 Ga0207658_100420123 195
373 3300025986 Ga0207658_10471649 Ga0207658_104716492 195
374 3300026035 Ga0207703_10239034 Ga0207703_102390342 195
375 3300026075 Ga0207708_10083116 Ga0207708_100831162 195
376 3300026078 Ga0207702_10549709 Ga0207702_105497092 195
377 3300026088 Ga0207641_10023068 Ga0207641_100230686 195
378 3300026088 Ga0207641_10403080 Ga0207641_104030802 195
379 3300026088 Ga0207641_11442085 Ga0207641_114420851 195
380 3300026089 Ga0207648_10010266 Ga0207648_100102662 195
381 3300026095 Ga0207676_10080959 Ga0207676_100809593 195
382 3300026116 Ga0207674_10470419 Ga0207674_104704192 195
383 3300026118 Ga0207675_100249191 Ga0207675_1002491912 195
384 3300026118 Ga0207675_100602575 Ga0207675_1006025751 195
385 3300026121 Ga0207683_10073095 Ga0207683_100730952 195
386 3300026121 Ga0207683_10230089 Ga0207683_102300892 195
387 3300028381 Ga0268264_10010665 Ga0268264_100106652 195
388 3300028794 Ga0307515_10000469 Ga0307515_1000046922 195
389 3300030522 Ga0307512_10200357 Ga0307512_102003571 195
390 3300030731 Ga0316177_1035720 Ga0316177_10357204 195
391 3300030732 Ga0316176_1136190 Ga0316176_11361909 195
392 3300030742 Ga0316183_1141180 Ga0316183_114118012 195
393 3300030744 Ga0316181_1017039 Ga0316181_101703912 195
394 3300030745 Ga0316182_1216377 Ga0316182_12163772 195
395 3300031456 Ga0307513_10088351 Ga0307513_100883513 195
396 3300031456 Ga0307513_10394059 Ga0307513_103940591 195
397 3300031507 Ga0307509_10738882 Ga0307509_107388821 195
398 3300031731 Ga0307405_10193166 Ga0307405_101931662 195
399 3300031901 Ga0307406_10921130 Ga0307406_109211301 195
400 3300031911 Ga0307412_10018016 Ga0307412_100180164 195
401 3300031911 Ga0307412_10161666 Ga0307412_101616662 195
402 3300032002 Ga0307416_100216461 Ga0307416_1002164612 195
403 3300032004 Ga0307414_10012260 Ga0307414_100122603 195
404 3300032004 Ga0307414_10228121 Ga0307414_102281212 195
405 3300032004 Ga0307414_10274986 Ga0307414_102749862 195
406 3300032004 Ga0307414_10400306 Ga0307414_104003061 195
407 3300032004 Ga0307414_10697951 Ga0307414_106979512 195
408 3300032126 Ga0307415_100080937 Ga0307415_1000809373 195
409 3300037471 Ga0395905_0519905 Ga0395905_0519905_307_909 195
410 3300041404 Ga0439436_0011406 Ga0439436_0011406_1289_1888 195
411 3300041406 Ga0439439_0007467 Ga0439439_0007467_1716_2315 195
412 3300041460 Ga0451802_0145012 Ga0451802_0145012_174_773 195
413 3300041498 Ga0451841_0438562 Ga0451841_0438562_201_800 195
414 3300041512 Ga0451853_2297526 Ga0451853_2297526_479_1078 195
415 3300041512 Ga0451853_3199655 Ga0451853_3199655_498_1097 195
416 3300041997 Ga0439431_0000842 Ga0439431_0000842_850_1551 195
417 3300042014 Ga0439457_007191 Ga0439457_007191_487_1086 195
418 3300042015 Ga0439462_0017750 Ga0439462_0017750_763_1362 195
419 3300042125 Ga0450923_027111 Ga0450923_027111_454_1050 195
420 3300042876 Ga0451577_0217388 Ga0451577_0217388_594_1193 195
421 3300044656 Ga0466969_0079520 Ga0466969_0079520_629_1243 195
422 3300044712 Ga0453684_0050678 Ga0453684_0050678_2247_2846 195
423 3300046616 Ga0495668_0019141 Ga0495668_0019141_2541_3140 195
424 3300046648 Ga0495611_0000042 Ga0495611_0000042_88046_88648 195
425 3300047443 Ga0495687_000227 Ga0495687_000227_2904_3506 195
426 3300048903 Ga0496100_0119859 Ga0496100_0119859_233_832 195
427 3300048917 Ga0496114_0040216 Ga0496114_0040216_1205_1804 195
428 3300049571 Ga0501034_0200248 Ga0501034_0200248_534_1142 195
429 3300049705 Ga0501225_0005483 Ga0501225_0005483_2702_3301 195
430 3300050507 nmdc:mga05p37_16038_c1 nmdc:mga05p37_16038_c1_1067_1666 195
431 3300050507 nmdc:mga05p37_468521_c1 nmdc:mga05p37_468521_c1_25_624 195
432 3300050507 nmdc:mga05p37_564788_c1 nmdc:mga05p37_564788_c1_478_1122 195
433 3300050508 nmdc:mga09592_61351_c1 nmdc:mga09592_61351_c1_1150_1749 195
434 3300050508 nmdc:mga09592_7117_c1 nmdc:mga09592_7117_c1_656_1252 195
435 3300050509 nmdc:mga0qj67_246894_c1 nmdc:mga0qj67_246894_c1_251_847 195
436 3300050510 nmdc:mga06r32_456939_c1 nmdc:mga06r32_456939_c1_136_732 195
437 3300050511 nmdc:mga08y16_245760_c1 nmdc:mga08y16_245760_c1_1174_1773 195
438 3300050511 nmdc:mga08y16_290611_c1 nmdc:mga08y16_290611_c1_377_973 195
439 3300053092 Ga0500583_0000080 Ga0500583_0000080_15554_16153 195
440 3300053104 Ga0500556_0105042 Ga0500556_0105042_248_847 195
441 3300053146 Ga0500588_0227933 Ga0500588_0227933_46_645 195
442 3300053147 Ga0500589_029891 Ga0500589_029891_1405_2004 195
443 3300053730 Ga0500645_070590 Ga0500645_070590_281_874 195
444 3300002459 JGI24751J29686_10001970 JGI24751J29686_100019702 196
445 3300005328 Ga0070676_10006110 Ga0070676_100061109 196
446 3300005335 Ga0070666_10015874 Ga0070666_100158742 196
447 3300005338 Ga0068868_100033023 Ga0068868_1000330233 196
448 3300005353 Ga0070669_100584979 Ga0070669_1005849791 196
449 3300005355 Ga0070671_100241438 Ga0070671_1002414382 196
450 3300005367 Ga0070667_100055367 Ga0070667_1000553672 196
451 3300005457 Ga0070662_100011878 Ga0070662_1000118783 196
452 3300005459 Ga0068867_100415201 Ga0068867_1004152011 196
453 3300005564 Ga0070664_100162688 Ga0070664_1001626882 196
454 3300005577 Ga0068857_100167682 Ga0068857_1001676822 196
455 3300005578 Ga0068854_100335309 Ga0068854_1003353091 196
456 3300005618 Ga0068864_100014604 Ga0068864_1000146049 196
457 3300005718 Ga0068866_10203644 Ga0068866_102036441 196
458 3300005719 Ga0068861_100707625 Ga0068861_1007076252 196
459 3300005834 Ga0068851_10302404 Ga0068851_103024041 196
460 3300006237 Ga0097621_100087732 Ga0097621_1000877321 196
461 3300006358 Ga0068871_100256158 Ga0068871_1002561582 196
462 3300009101 Ga0105247_10445341 Ga0105247_104453412 196
463 3300009174 Ga0105241_10294534 Ga0105241_102945341 196
464 3300009176 Ga0105242_10016512 Ga0105242_100165122 196
465 3300009553 Ga0105249_10009116 Ga0105249_100091167 196
466 3300011119 Ga0105246_10402146 Ga0105246_104021461 196
467 3300013296 Ga0157374_10065650 Ga0157374_100656503 196
468 3300013306 Ga0163162_10043510 Ga0163162_100435102 196
469 3300013306 Ga0163162_10202753 Ga0163162_102027533 196
470 3300013308 Ga0157375_10074844 Ga0157375_100748443 196
471 3300013308 Ga0157375_10411199 Ga0157375_104111992 196
472 3300014325 Ga0163163_10234326 Ga0163163_102343261 196
473 3300014325 Ga0163163_10407812 Ga0163163_104078122 196
474 3300014745 Ga0157377_10268738 Ga0157377_102687382 196
475 3300014969 Ga0157376_10019851 Ga0157376_100198512 196
476 3300014969 Ga0157376_10109864 Ga0157376_101098643 196
477 3300017792 Ga0163161_10048521 Ga0163161_100485212 196
478 3300025899 Ga0207642_10019944 Ga0207642_100199442 196
479 3300025933 Ga0207706_10009705 Ga0207706_100097056 196
480 3300025940 Ga0207691_11020503 Ga0207691_110205031 196
481 3300025941 Ga0207711_10507563 Ga0207711_105075632 196
482 3300025942 Ga0207689_10112309 Ga0207689_101123092 196
483 3300025945 Ga0207679_10271881 Ga0207679_102718812 196
484 3300025961 Ga0207712_10015848 Ga0207712_100158484 196
485 3300025981 Ga0207640_10071946 Ga0207640_100719462 196
486 3300026035 Ga0207703_10399010 Ga0207703_103990102 196
487 3300026089 Ga0207648_10236127 Ga0207648_102361272 196
488 3300026116 Ga0207674_10198775 Ga0207674_101987752 196
489 3300026118 Ga0207675_100482660 Ga0207675_1004826602 196
490 3300026121 Ga0207683_10295342 Ga0207683_102953422 196
491 3300035092 Ga0373952_0126379 Ga0373952_0126379_42_638 196
492 3300037068 Ga0373925_0839478 Ga0373925_0839478_101_697 196
493 3300041507 Ga0451851_0497521 Ga0451851_0497521_232_879 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06439

3keto-disac_hyd

3-keto-disaccharide hydrolase

21

198

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jqt-assembly1.cif.gz_B crystal structure of a putative glycosyl hydrolase (bt3469) from bacteroides thetaiotaomicron vpi-5482 at 2.49 a resolution 0.9293 18 193
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.8514 29 194
4jqt-assembly1.cif.gz_B crystal structure of a putative glycosyl hydrolase (bt3469) from bacteroides thetaiotaomicron vpi-5482 at 2.49 a resolution 0.8338 18 193
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.8171 29 194
1oq1-assembly2.cif.gz_B crystal structure of protein of unknown function with galectin-like fold from bacillus subtilis 0.7771 28 194
ID Description Score Start End Superfamily
4jqtB01 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.9216 18 193 2.60.120.560
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8514 29 194 2.60.120.560
4jqtB01 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8267 18 193 2.60.120.560
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8171 29 194 2.60.120.560
af_Q4D4Q5_106_279_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7875 138 162 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A661YRL7-F1-model_v4 DUF1080 domain-containing protein 0.9954 20 196 GO:0016787
AF-A0A2D0N0H6-F1-model_v4 Secreted glycosyl hydrolase 0.9951 16 195 GO:0016787
AF-A0A3M1YC63-F1-model_v4 DUF1080 domain-containing protein 0.995 18 192 GO:0016787
AF-A0A1Q4F145-F1-model_v4 Secreted glycosyl hydrolase 0.9949 19 195 GO:0016787
AF-A0A5B9WUX5-F1-model_v4 DUF1080 domain-containing protein 0.9943 15 195 GO:0016787

Feature Viewer

pLDDT pTM Quality
91.55 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map