F454439

General Info

Members Datasets Scaffolds Average Seq Length
493 281 986 122

Family's Representative Sequence

Representative Sequence 3300025986|Ga0207658_10753988|Ga0207658_107539882
Length 148
Sequence MYYYLVDLGMEVVVAGNAGGTSRLRGMHIDKDLVAASATPLVLGILADGESYGYAILKRVRELSGGQMAWTDGMLYPLLHRLERQGYVKAAWGTADSGRKRKHYALTRSGRDALAERRQQWEIVAEALEQVWPNIRHSLAPMQPGLAQ

Samples

Sample ID Description Type Environment
1 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
114 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
115 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
116 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
117 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
118 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
119 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
120 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
121 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
150 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
151 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
152 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
153 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
154 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
155 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
156 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
157 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
158 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
159 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
160 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
161 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
162 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
163 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
164 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
165 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
168 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
169 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
170 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
172 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
173 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
174 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
175 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
176 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
177 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
178 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
179 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
180 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
181 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
182 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
183 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
184 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
185 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
186 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
207 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
208 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
273 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
279 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
280 2858882152 Micromonospora noduli MED15 Isolate Nodule
281 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 0.41
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.62
Nodule 0.2
Rhizoplane 10.14
Rhizosphere 82.56
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207658_10753988 3300025986 Bacteria 882
2 LJQas_1004479 3300000549 Bacteria 1818
3 JGI25406J46586_10057241 3300003203 Bacteria 1275
4 Ga0065714_10004329 3300005288 Bacteria 5407
5 Ga0070658_10100343 3300005327 Bacteria 2393
6 Ga0070658_11152897 3300005327 Bacteria 674
7 Ga0070683_100010681 3300005329 Bacteria 7895
8 Ga0070683_101527878 3300005329 Bacteria 642
9 Ga0070690_100245928 3300005330 Bacteria 1263
10 Ga0070670_100103600 3300005331 Bacteria 2451
11 Ga0070670_102003481 3300005331 Bacteria 533
12 Ga0068869_100010746 3300005334 Bacteria 5978
13 Ga0070680_100281469 3300005336 Bacteria 1409
14 Ga0070682_100907165 3300005337 Bacteria 725
15 Ga0068868_100014301 3300005338 Bacteria 5845
16 Ga0070660_100058480 3300005339 Bacteria 2988
17 Ga0070660_100183102 3300005339 Bacteria 1695
18 Ga0070689_101192227 3300005340 Bacteria 683
19 Ga0070692_10254651 3300005345 Bacteria 1052
20 Ga0070668_100598095 3300005347 Bacteria 965
21 Ga0070669_101182777 3300005353 Bacteria 660
22 Ga0070675_100188645 3300005354 Bacteria 1785
23 Ga0070659_100098477 3300005366 Bacteria 2351
24 Ga0070659_100107614 3300005366 Bacteria 2248
25 Ga0070659_100162139 3300005366 Bacteria 1829
26 Ga0070659_100214341 3300005366 Bacteria 1588
27 Ga0070667_100763441 3300005367 Bacteria 897
28 Ga0070713_100794778 3300005436 Bacteria 907
29 Ga0070705_100674590 3300005440 Bacteria 809
30 Ga0070700_100021420 3300005441 Bacteria 3758
31 Ga0070700_100236235 3300005441 Bacteria 1304
32 Ga0070678_101345102 3300005456 Bacteria 666
33 Ga0070681_10240632 3300005458 Bacteria 1723
34 Ga0070698_100311059 3300005471 Bacteria 1506
35 Ga0070679_101817123 3300005530 Bacteria 558
36 Ga0070684_100005944 3300005535 Bacteria 9399
37 Ga0070684_100008437 3300005535 Bacteria 8054
38 Ga0070684_100015319 3300005535 Bacteria 6240
39 Ga0068853_101469215 3300005539 Bacteria 660
40 Ga0068853_101742666 3300005539 Bacteria 604
41 Ga0070672_100609917 3300005543 Bacteria 951
42 Ga0070672_101414877 3300005543 Bacteria 622
43 Ga0070672_101948842 3300005543 Bacteria 529
44 Ga0070695_100284132 3300005545 Bacteria 1217
45 Ga0070696_101356012 3300005546 Bacteria 605
46 Ga0068855_100332171 3300005563 Bacteria 1678
47 Ga0068855_101619234 3300005563 Bacteria 662
48 Ga0070664_100001178 3300005564 Bacteria 20808
49 Ga0068857_100029746 3300005577 Bacteria 4821
50 Ga0068857_100905666 3300005577 Bacteria 846
51 Ga0068857_102139374 3300005577 Bacteria 549
52 Ga0070702_100361519 3300005615 Bacteria 1026
53 Ga0068852_100035330 3300005616 Bacteria 4168
54 Ga0068852_102084853 3300005616 Bacteria 589
55 Ga0068859_101919263 3300005617 Bacteria 654
56 Ga0068870_10144223 3300005840 Bacteria 1396
57 Ga0068858_100126490 3300005842 Bacteria 2394
58 Ga0068862_101508997 3300005844 Bacteria 677
59 Ga0081455_10160522 3300005937 Bacteria 1724
60 Ga0081455_10440926 3300005937 Bacteria 892
61 Ga0081538_10000036 3300005981 Bacteria 119944
62 Ga0081539_10000039 3300005985 Bacteria 295914
63 Ga0081539_10000100 3300005985 Bacteria 199516
64 Ga0081539_10002328 3300005985 Bacteria 27352
65 Ga0075367_10181825 3300006178 Bacteria 1311
66 Ga0075370_10103871 3300006353 Bacteria 1646
67 Ga0075428_100001373 3300006844 Bacteria 25870
68 Ga0075428_100125148 3300006844 Bacteria 2798
69 Ga0075428_100247245 3300006844 Bacteria 1923
70 Ga0075428_100486953 3300006844 Bacteria 1320
71 Ga0075428_101125712 3300006844 Bacteria 829
72 Ga0075428_101216619 3300006844 Bacteria 794
73 Ga0075428_101528187 3300006844 Bacteria 699
74 Ga0075430_100019399 3300006846 Bacteria 5782
75 Ga0075430_100220265 3300006846 Bacteria 1574
76 Ga0075430_101787804 3300006846 Bacteria 504
77 Ga0075431_100002453 3300006847 Bacteria 17855
78 Ga0075431_100087594 3300006847 Bacteria 3213
79 Ga0075431_101644737 3300006847 Bacteria 599
80 Ga0075429_100005673 3300006880 Bacteria 10766
81 Ga0075429_100014654 3300006880 Bacteria 6797
82 Ga0075429_100038416 3300006880 Bacteria 4167
83 Ga0075429_100075937 3300006880 Bacteria 2927
84 Ga0075429_100096205 3300006880 Bacteria 2583
85 Ga0075429_101083103 3300006880 Bacteria 700
86 Ga0075429_101264418 3300006880 Bacteria 644
87 Ga0097620_101919374 3300006931 Bacteria 654
88 Ga0111539_10010193 3300009094 Bacteria 11843
89 Ga0111539_10215241 3300009094 Bacteria 2238
90 Ga0114129_10000061 3300009147 Bacteria 96663
91 Ga0114129_10084668 3300009147 Bacteria 4402
92 Ga0114129_10860047 3300009147 Bacteria 1152
93 Ga0114129_10976664 3300009147 Bacteria 1068
94 Ga0114129_11766751 3300009147 Bacteria 753
95 Ga0105243_10588764 3300009148 Bacteria 1069
96 Ga0105243_11344050 3300009148 Bacteria 733
97 Ga0105243_11623809 3300009148 Bacteria 674
98 Ga0105248_12299443 3300009177 Bacteria 614
99 Ga0105238_10703261 3300009551 Bacteria 1023
100 Ga0105239_10297594 3300010375 Bacteria 1817
101 Ga0105239_10353241 3300010375 Bacteria 1660
102 Ga0105239_12125886 3300010375 Bacteria 652
103 Ga0105246_10742513 3300011119 Bacteria 865
104 Ga0157371_11502334 3300013102 Bacteria 525
105 Ga0157370_11210052 3300013104 Bacteria 681
106 Ga0157369_10510151 3300013105 Bacteria 1244
107 Ga0157369_11549256 3300013105 Bacteria 674
108 Ga0163162_10019406 3300013306 Bacteria 6667
109 Ga0163162_10268922 3300013306 Bacteria 1836
110 Ga0163162_10417940 3300013306 Bacteria 1473
111 Ga0163162_11243771 3300013306 Bacteria 845
112 Ga0157372_10264221 3300013307 Bacteria 1998
113 Ga0157372_11620328 3300013307 Bacteria 745
114 Ga0157375_10760006 3300013308 Bacteria 1120
115 Ga0157375_10883844 3300013308 Bacteria 1038
116 Ga0157380_10695070 3300014326 Bacteria 1021
117 Ga0157380_11390339 3300014326 Bacteria 752
118 Ga0157377_10085380 3300014745 Bacteria 1853
119 Ga0163161_10995352 3300017792 Bacteria 715
120 Ga0206356_10963748 3300020070 Bacteria 1132
121 Ga0206353_11100137 3300020082 Bacteria 939
122 Ga0213876_10110418 3300021384 Bacteria 1460
123 Ga0213875_10000703 3300021388 Bacteria 25856
124 Ga0207697_10462454 3300025315 Bacteria 562
125 Ga0207688_10234384 3300025901 Bacteria 1108
126 Ga0207647_10016140 3300025904 Bacteria 5103
127 Ga0207647_10036740 3300025904 Bacteria 3110
128 Ga0207645_10124239 3300025907 Bacteria 1677
129 Ga0207643_10063977 3300025908 Bacteria 2105
130 Ga0207643_10407074 3300025908 Bacteria 861
131 Ga0207705_10177503 3300025909 Bacteria 1606
132 Ga0207705_10177935 3300025909 Bacteria 1604
133 Ga0207705_10874391 3300025909 Bacteria 697
134 Ga0207707_10317633 3300025912 Bacteria 1345
135 Ga0207660_10483676 3300025917 Bacteria 1003
136 Ga0207657_10074632 3300025919 Bacteria 2863
137 Ga0207657_10136152 3300025919 Bacteria 2009
138 Ga0207657_10618705 3300025919 Bacteria 844
139 Ga0207649_10016591 3300025920 Bacteria 4157
140 Ga0207650_11299964 3300025925 Bacteria 619
141 Ga0207659_10106711 3300025926 Bacteria 2121
142 Ga0207700_10504474 3300025928 Bacteria 1071
143 Ga0207644_10487645 3300025931 Bacteria 1016
144 Ga0207690_10018106 3300025932 Bacteria 4316
145 Ga0207690_10226290 3300025932 Bacteria 1434
146 Ga0207690_10335939 3300025932 Bacteria 1191
147 Ga0207690_10756193 3300025932 Bacteria 801
148 Ga0207709_10602275 3300025935 Bacteria 870
149 Ga0207669_10095222 3300025937 Bacteria 1951
150 Ga0207691_11404456 3300025940 Unclassified 573
151 Ga0207711_10000285 3300025941 Bacteria 53872
152 Ga0207711_10677339 3300025941 Bacteria 962
153 Ga0207689_10003196 3300025942 Bacteria 15012
154 Ga0207661_10010176 3300025944 Bacteria 6762
155 Ga0207661_10046732 3300025944 Bacteria 3432
156 Ga0207661_10123788 3300025944 Bacteria 2206
157 Ga0207679_10071565 3300025945 Bacteria 2616
158 Ga0207679_11496685 3300025945 Bacteria 619
159 Ga0207667_10355495 3300025949 Bacteria 1494
160 Ga0207667_10856855 3300025949 Bacteria 903
161 Ga0207667_11918133 3300025949 Bacteria 554
162 Ga0207712_10909894 3300025961 Bacteria 778
163 Ga0207668_10749362 3300025972 Bacteria 862
164 Ga0207668_10914644 3300025972 Bacteria 781
165 Ga0207640_10045418 3300025981 Bacteria 2821
166 Ga0207677_10009110 3300026023 Bacteria 5572
167 Ga0207703_10716316 3300026035 Bacteria 952
168 Ga0207703_11111008 3300026035 Bacteria 759
169 Ga0207639_10221664 3300026041 Bacteria 1634
170 Ga0207639_10897062 3300026041 Bacteria 828
171 Ga0207678_10006850 3300026067 Bacteria 10103
172 Ga0207678_11131653 3300026067 Bacteria 693
173 Ga0207708_10003029 3300026075 Bacteria 12393
174 Ga0207708_11309600 3300026075 Bacteria 635
175 Ga0207641_11024068 3300026088 Bacteria 823
176 Ga0207641_11486167 3300026088 Bacteria 679
177 Ga0207676_12484437 3300026095 Bacteria 515
178 Ga0207674_10008046 3300026116 Bacteria 12222
179 Ga0207674_10527705 3300026116 Bacteria 1140
180 Ga0207674_10919884 3300026116 Bacteria 843
181 Ga0207675_100580022 3300026118 Bacteria 1123
182 Ga0207683_10241233 3300026121 Bacteria 1649
183 Ga0207698_10068664 3300026142 Bacteria 2800
184 Ga0207428_10013311 3300027907 Bacteria 7193
185 Ga0268265_10042067 3300028380 Bacteria 3387
186 Ga0268264_11283078 3300028381 Bacteria 742
187 Ga0307515_10000741 3300028794 Bacteria 75546
188 Ga0307515_10464021 3300028794 Bacteria 880
189 Ga0307512_10062138 3300030522 Bacteria 2868
190 Ga0316177_1103462 3300030731 Bacteria 1379
191 Ga0316176_1083689 3300030732 Bacteria 926
192 Ga0314311_1119278 3300030733 Bacteria 1503
193 Ga0316179_1061631 3300030734 Bacteria 935
194 Ga0316178_1109174 3300030735 Bacteria 747
195 Ga0316178_1114149 3300030735 Bacteria 1060
196 Ga0316180_1074632 3300030736 Bacteria 581
197 Ga0316180_1188960 3300030736 Bacteria 966
198 Ga0316181_1256691 3300030744 Bacteria 645
199 Ga0316182_1102902 3300030745 Bacteria 2682
200 Ga0307513_10217891 3300031456 Bacteria 1733
201 Ga0307408_101095608 3300031548 Bacteria 738
202 Ga0307408_101406748 3300031548 Bacteria 657
203 Ga0307408_101692372 3300031548 Bacteria 602
204 Ga0307508_10015665 3300031616 Bacteria 6908
205 Ga0307508_10615660 3300031616 Bacteria 688
206 Ga0316575_10000001 3300031665 Bacteria 151281
207 Ga0307516_10010281 3300031730 Bacteria 10307
208 Ga0307516_10060453 3300031730 Bacteria 3681
209 Ga0307516_11001054 3300031730 Bacteria 508
210 Ga0307405_10036828 3300031731 Bacteria 2935
211 Ga0307405_10776395 3300031731 Bacteria 800
212 Ga0307413_11469478 3300031824 Bacteria 602
213 Ga0307410_10026387 3300031852 Bacteria 3656
214 Ga0307410_10108934 3300031852 Bacteria 2001
215 Ga0307410_10217880 3300031852 Bacteria 1467
216 Ga0307410_10368477 3300031852 Bacteria 1153
217 Ga0307406_10004819 3300031901 Bacteria 7350
218 Ga0307406_10047126 3300031901 Bacteria 2715
219 Ga0307406_10094615 3300031901 Bacteria 2020
220 Ga0307406_10101721 3300031901 Bacteria 1959
221 Ga0307406_10676898 3300031901 Bacteria 859
222 Ga0307407_10003798 3300031903 Bacteria 6287
223 Ga0307407_10133659 3300031903 Bacteria 1591
224 Ga0307407_10696217 3300031903 Bacteria 765
225 Ga0307412_10048037 3300031911 Bacteria 2805
226 Ga0307412_11862702 3300031911 Bacteria 554
227 Ga0307409_100077833 3300031995 Bacteria 2665
228 Ga0307409_100106881 3300031995 Bacteria 2337
229 Ga0307409_100428472 3300031995 Bacteria 1271
230 Ga0307409_100780385 3300031995 Bacteria 962
231 Ga0307409_102026733 3300031995 Bacteria 605
232 Ga0307409_102103918 3300031995 Bacteria 594
233 Ga0307416_100003743 3300032002 Bacteria 9027
234 Ga0307416_100090726 3300032002 Bacteria 2622
235 Ga0307416_100318488 3300032002 Bacteria 1556
236 Ga0307416_100387825 3300032002 Bacteria 1430
237 Ga0307416_100398878 3300032002 Bacteria 1412
238 Ga0307416_102435346 3300032002 Bacteria 623
239 Ga0307411_10697526 3300032005 Bacteria 884
240 Ga0307411_10768814 3300032005 Bacteria 845
241 Ga0307415_100000011 3300032126 Bacteria 84750
242 Ga0307415_100033058 3300032126 Bacteria 3354
243 Ga0307415_100060943 3300032126 Bacteria 2610
244 Ga0307415_100170766 3300032126 Bacteria 1695
245 Ga0307415_100404896 3300032126 Bacteria 1166
246 Ga0307415_100482101 3300032126 Bacteria 1080
247 Ga0307415_100952172 3300032126 Bacteria 795
248 Ga0373948_0162923 3300034817 Bacteria 563
249 Ga0373935_0007232 3300035692 Bacteria 6633
250 Ga0373947_0047742 3300035725 Bacteria 2566
251 Ga0373937_0257948 3300036401 Bacteria 1644
252 Ga0373937_0571027 3300036401 Bacteria 1074
253 Ga0373925_0917992 3300037068 Bacteria 721
254 Ga0395899_0233242 3300037312 Bacteria 1270
255 Ga0395899_0488274 3300037312 Bacteria 801
256 Ga0395900_0006621 3300037418 Bacteria 12055
257 Ga0395900_0040114 3300037418 Bacteria 4825
258 Ga0395898_0009507 3300037466 Bacteria 10205
259 Ga0395898_0021487 3300037466 Bacteria 6545
260 Ga0395898_0141189 3300037466 Bacteria 2306
261 Ga0395905_0007783 3300037471 Bacteria 10626
262 Ga0395905_0224686 3300037471 Bacteria 1757
263 Ga0395901_0302759 3300038443 Bacteria 1657
264 Ga0395901_0874170 3300038443 Bacteria 882
265 Ga0395901_0979200 3300038443 Bacteria 823
266 Ga0395901_2008887 3300038443 Bacteria 524
267 Ga0400483_216108 3300039062 Bacteria 21207
268 Ga0436365_1456480 3300039437 Bacteria 644
269 Ga0439436_0000142 3300041404 Bacteria 16527
270 Ga0439436_0018570 3300041404 Bacteria 2079
271 Ga0439438_004523 3300041405 Bacteria 5304
272 Ga0439438_092312 3300041405 Bacteria 737
273 Ga0439439_0001219 3300041406 Bacteria 4982
274 Ga0439447_034073 3300041407 Bacteria 1267
275 Ga0439461_0003384 3300041410 Bacteria 2622
276 Ga0439466_0001136 3300041411 Bacteria 10375
277 Ga0439466_0180602 3300041411 Bacteria 643
278 Ga0439465_0054550 3300041413 Bacteria 1315
279 Ga0439465_0125108 3300041413 Bacteria 904
280 Ga0439465_0289343 3300041413 Bacteria 611
281 Ga0451791_0524839 3300041451 Bacteria 501
282 Ga0451791_1503339 3300041451 Bacteria 2044
283 Ga0451793_0093726 3300041452 Bacteria 6584
284 Ga0451797_0471118 3300041453 Bacteria 594
285 Ga0451797_0615286 3300041453 Bacteria 1238
286 Ga0451795_1685673 3300041456 Bacteria 1079
287 Ga0451802_2045260 3300041460 Bacteria 519
288 Ga0451833_0570333 3300041491 Bacteria 6569
289 Ga0451833_0980057 3300041491 Bacteria 12474
290 Ga0451837_1439484 3300041494 Bacteria 2164
291 Ga0451839_1323906 3300041496 Bacteria 3956
292 Ga0451841_1017450 3300041498 Bacteria 1668
293 Ga0451843_1014165 3300041509 Bacteria 779
294 Ga0451853_0279636 3300041512 Bacteria 1674
295 Ga0451853_2870202 3300041512 Bacteria 1496
296 Ga0439433_0000028 3300041999 Bacteria 17942
297 Ga0439442_001031 3300042002 Bacteria 5615
298 Ga0439445_0038998 3300042004 Bacteria 1258
299 Ga0439445_0145011 3300042004 Bacteria 689
300 Ga0439432_008729 3300042006 Bacteria 3550
301 Ga0439432_031745 3300042006 Bacteria 1707
302 Ga0439449_0002108 3300042007 Bacteria 7807
303 Ga0439449_0075765 3300042007 Bacteria 1240
304 Ga0439449_0089787 3300042007 Bacteria 1134
305 Ga0439449_0261534 3300042007 Bacteria 651
306 Ga0439452_002512 3300042010 Bacteria 6746
307 Ga0439457_001291 3300042014 Bacteria 7518
308 Ga0439457_016848 3300042014 Bacteria 1626
309 Ga0439462_0000282 3300042015 Bacteria 9388
310 Ga0450911_022201 3300042115 Bacteria 827
311 Ga0450919_008356 3300042121 Bacteria 1199
312 Ga0450920_005815 3300042122 Bacteria 2202
313 Ga0450920_016909 3300042122 Bacteria 1392
314 Ga0450897_007669 3300042128 Bacteria 989
315 Ga0450900_011337 3300042136 Bacteria 1157
316 Ga0450907_005400 3300042146 Bacteria 2157
317 Ga0450907_006937 3300042146 Bacteria 1889
318 Ga0439446_0021743 3300042156 Bacteria 1815
319 Ga0450908_009296 3300042184 Bacteria 1827
320 Ga0450909_043972 3300042185 Bacteria 690
321 Ga0450909_076220 3300042185 Bacteria 540
322 Ga0439434_0001039 3300042435 Bacteria 8047
323 Ga0439460_0273606 3300042461 Bacteria 587
324 Ga0450918_003364 3300042531 Bacteria 2974
325 Ga0450918_007019 3300042531 Bacteria 2002
326 Ga0466969_0072241 3300044656 Bacteria 1658
327 Ga0466965_0073449 3300044683 Bacteria 1722
328 Ga0466966_0008889 3300044684 Bacteria 6652
329 Ga0466963_0010860 3300044694 Bacteria 5530
330 Ga0466963_1271151 3300044694 Bacteria 517
331 Ga0466964_0609122 3300044706 Bacteria 600
332 Ga0466971_0034473 3300044719 Bacteria 2268
333 Ga0466957_0003375 3300044842 Bacteria 8768
334 Ga0466960_0011895 3300044901 Bacteria 3659
335 Ga0466960_0133922 3300044901 Bacteria 1311
336 Ga0466959_0005972 3300045049 Bacteria 8400
337 Ga0466958_0056661 3300045836 Bacteria 2381
338 Ga0466967_0737329 3300045976 Bacteria 977
339 Ga0495638_0135745 3300046460 Bacteria 1441
340 Ga0495639_0326706 3300046475 Bacteria 768
341 Ga0495594_0873701 3300046499 Bacteria 506
342 Ga0495633_0469560 3300046558 Bacteria 568
343 Ga0495668_0000794 3300046616 Bacteria 36446
344 Ga0495625_0005235 3300046660 Bacteria 11940
345 Ga0495588_0314290 3300046674 Bacteria 824
346 Ga0495670_0201010 3300046691 Bacteria 1055
347 Ga0495670_0679453 3300046691 Bacteria 561
348 Ga0495671_0501699 3300046692 Bacteria 579
349 Ga0495589_0492649 3300046794 Bacteria 560
350 Ga0495660_0517862 3300046810 Bacteria 508
351 Ga0495581_0346342 3300047315 Bacteria 867
352 Ga0495683_0437559 3300047323 Bacteria 538
353 Ga0495593_0045634 3300047673 Bacteria 2338
354 Ga0495626_0000142 3300048091 Bacteria 90766
355 Ga0496100_0002255 3300048903 Bacteria 9745
356 Ga0496101_0010445 3300048904 Bacteria 6132
357 Ga0496101_0062787 3300048904 Bacteria 2702
358 Ga0496101_0565065 3300048904 Bacteria 899
359 Ga0496102_0009076 3300048905 Bacteria 8530
360 Ga0496102_0360087 3300048905 Bacteria 1369
361 Ga0496102_1448763 3300048905 Bacteria 605
362 Ga0496104_0108283 3300048907 Bacteria 2663
363 Ga0496104_0156813 3300048907 Bacteria 2184
364 Ga0496104_0480441 3300048907 Bacteria 1154
365 Ga0496104_1095167 3300048907 Bacteria 700
366 Ga0496105_0045151 3300048908 Bacteria 3635
367 Ga0496105_0052547 3300048908 Bacteria 3366
368 Ga0496105_0603296 3300048908 Bacteria 852
369 Ga0496106_0002931 3300048909 Bacteria 12700
370 Ga0496106_1194136 3300048909 Bacteria 593
371 Ga0496107_0000856 3300048910 Bacteria 17867
372 Ga0496107_0167486 3300048910 Bacteria 1629
373 Ga0496108_0229481 3300048911 Bacteria 1614
374 Ga0496109_0023288 3300048912 Bacteria 5495
375 Ga0496109_0058988 3300048912 Bacteria 3506
376 Ga0496109_0062707 3300048912 Bacteria 3400
377 Ga0496109_0139514 3300048912 Bacteria 2266
378 Ga0496109_0372643 3300048912 Bacteria 1349
379 Ga0496109_1948713 3300048912 Bacteria 520
380 Ga0496110_0047754 3300048913 Bacteria 3750
381 Ga0496110_0063904 3300048913 Bacteria 3252
382 Ga0496110_0570081 3300048913 Bacteria 1028
383 Ga0496110_0839931 3300048913 Bacteria 823
384 Ga0496111_0048764 3300048914 Bacteria 3051
385 Ga0496111_0144623 3300048914 Bacteria 1762
386 Ga0496111_0694318 3300048914 Bacteria 740
387 Ga0496112_0116126 3300048915 Bacteria 2647
388 Ga0496112_0143904 3300048915 Bacteria 2353
389 Ga0496112_0872348 3300048915 Bacteria 823
390 Ga0496113_0096627 3300048916 Bacteria 2284
391 Ga0496113_0293204 3300048916 Bacteria 1302
392 Ga0496113_0336838 3300048916 Bacteria 1210
393 Ga0496114_0038926 3300048917 Bacteria 3935
394 Ga0496114_0788505 3300048917 Bacteria 829
395 Ga0496115_0366258 3300048918 Bacteria 1174
396 Ga0496115_0434575 3300048918 Bacteria 1062
397 Ga0496115_0673212 3300048918 Bacteria 816
398 Ga0496118_0004452 3300048921 Bacteria 16607
399 Ga0496119_0002443 3300048922 Bacteria 20410
400 Ga0496124_0517985 3300048927 Bacteria 795
401 Ga0496126_0027227 3300048929 Bacteria 5464
402 Ga0501031_0000913 3300049568 Bacteria 17795
403 Ga0501032_0045830 3300049569 Bacteria 2956
404 Ga0501033_0019148 3300049570 Bacteria 5176
405 Ga0501034_0028667 3300049571 Bacteria 5664
406 Ga0501034_0597488 3300049571 Bacteria 1009
407 Ga0501036_0016566 3300049572 Bacteria 6155
408 Ga0501037_0030484 3300049573 Bacteria 3986
409 Ga0501038_0015614 3300049574 Bacteria 6903
410 Ga0501038_0064012 3300049574 Bacteria 3137
411 Ga0501038_0221501 3300049574 Bacteria 1509
412 Ga0501039_0006409 3300049575 Bacteria 8942
413 Ga0501040_0003635 3300049576 Bacteria 9984
414 Ga0501040_0020571 3300049576 Bacteria 4399
415 Ga0501041_0009306 3300049577 Bacteria 5785
416 Ga0501041_0146003 3300049577 Bacteria 1476
417 Ga0501042_0003198 3300049578 Bacteria 10234
418 Ga0501042_0067356 3300049578 Bacteria 2559
419 Ga0501043_0040241 3300049579 Bacteria 3674
420 Ga0501043_0678670 3300049579 Bacteria 754
421 Ga0501046_0045547 3300049580 Bacteria 3485
422 Ga0501046_0781449 3300049580 Bacteria 670
423 Ga0501047_0063598 3300049581 Bacteria 3560
424 Ga0501048_0005139 3300049582 Bacteria 9968
425 Ga0501067_0337043 3300049583 Bacteria 840
426 Ga0501067_0372237 3300049583 Bacteria 797
427 Ga0501067_0594157 3300049583 Bacteria 621
428 Ga0501068_0128065 3300049584 Bacteria 1586
429 Ga0501068_0533938 3300049584 Bacteria 762
430 Ga0501068_0635456 3300049584 Bacteria 696
431 Ga0501068_0849494 3300049584 Bacteria 600
432 Ga0501070_0093262 3300049586 Bacteria 2491
433 Ga0501070_0396129 3300049586 Bacteria 1117
434 Ga0501071_0017348 3300049587 Bacteria 4962
435 Ga0501071_0701140 3300049587 Unclassified 779
436 Ga0501071_0930075 3300049587 Bacteria 671
437 Ga0501071_0946884 3300049587 Bacteria 665
438 Ga0501072_0013715 3300049588 Bacteria 6204
439 Ga0501074_0004151 3300049590 Bacteria 10340
440 Ga0501074_0021486 3300049590 Bacteria 4685
441 Ga0501074_0243924 3300049590 Bacteria 1278
442 Ga0501075_0002108 3300049591 Bacteria 13151
443 Ga0501075_0181880 3300049591 Bacteria 1604
444 Ga0501076_0005020 3300049592 Bacteria 9470
445 Ga0501076_0103531 3300049592 Bacteria 2296
446 Ga0501077_0723096 3300049593 Bacteria 640
447 Ga0501079_0004432 3300049741 Bacteria 10398
448 Ga0501079_0068228 3300049741 Bacteria 2745
449 Ga0501079_0660875 3300049741 Bacteria 823
450 Ga0501080_0009204 3300049742 Bacteria 8998
451 Ga0501081_0006413 3300049743 Bacteria 7633
452 Ga0501083_0041709 3300049744 Bacteria 3112
453 Ga0501083_0315935 3300049744 Bacteria 1016
454 Ga0501083_0664441 3300049744 Bacteria 678
455 Ga0501044_0044026 3300049823 Bacteria 4635
456 Ga0501045_0002811 3300049824 Bacteria 11893
457 Ga0501045_0019985 3300049824 Bacteria 4780
458 Ga0501045_0280645 3300049824 Unclassified 1240
459 nmdc:mga06z11_276862_c1 3300050494 Bacteria 993
460 nmdc:mga07m45_56447_c1 3300050496 Bacteria 2219
461 nmdc:mga05p37_360_c1 3300050507 Bacteria 48915
462 nmdc:mga05p37_466765_c1 3300050507 Bacteria 1457
463 nmdc:mga05p37_546666_c1 3300050507 Bacteria 1319
464 nmdc:mga05p37_813564_c1 3300050507 Bacteria 1020
465 nmdc:mga09592_221663_c1 3300050508 Bacteria 1638
466 nmdc:mga09592_266_c1 3300050508 Bacteria 38082
467 nmdc:mga09592_622156_c1 3300050508 Bacteria 924
468 nmdc:mga09592_948164_c1 3300050508 Bacteria 721
469 nmdc:mga09592_96844_c1 3300050508 Bacteria 2524
470 nmdc:mga0qj67_131_c1 3300050509 Bacteria 49650
471 nmdc:mga0qj67_1444362_c1 3300050509 Bacteria 530
472 nmdc:mga06r32_11281_c2 3300050510 Bacteria 3864
473 nmdc:mga06r32_227709_c1 3300050510 Bacteria 1852
474 nmdc:mga06r32_364_c1 3300050510 Bacteria 38033
475 nmdc:mga06r32_679861_c1 3300050510 Bacteria 996
476 nmdc:mga08y16_15172_c1 3300050511 Bacteria 8102
477 nmdc:mga0n895_2123604_c1 3300050512 Bacteria 518
478 nmdc:mga0a205_1183662_c1 3300050515 Bacteria 612
479 Ga0495619_0048885 3300053085 Bacteria 2787
480 Ga0500594_0162293 3300053118 Bacteria 723
481 Ga0500588_0001374 3300053146 Bacteria 4617
482 Ga0500616_0001699 3300053153 Bacteria 20241
483 Ga0500616_0045408 3300053153 Bacteria 2341
484 Ga0501084_0007439 3300054114 Bacteria 9028
485 Ga0501084_0016179 3300054114 Bacteria 6194
486 Ga0501082_0008736 3300060353 Bacteria 8731
487 Ga0501082_0053575 3300060353 Bacteria 3477
488 Ga0466962_0038141 3300061719 Bacteria 2301
489 Ga0530510_0002028 3300061734 Bacteria 13915
490 Ga0530510_0554002 3300061734 Bacteria 873
491 2857290210 2857288857 Bacteria 7189066
492 2858884191 2858882152 Bacteria 7230291
493 8045833850 8045830549 Bacteria 4444727
494 Ga0207658_10753988
495 LJQas_1004479
496 JGI25406J46586_10057241
497 Ga0065714_10004329
498 Ga0070658_10100343
499 Ga0070658_11152897
500 Ga0070683_100010681
501 Ga0070683_101527878
502 Ga0070690_100245928
503 Ga0070670_100103600
504 Ga0070670_102003481
505 Ga0068869_100010746
506 Ga0070680_100281469
507 Ga0070682_100907165
508 Ga0068868_100014301
509 Ga0070660_100058480
510 Ga0070660_100183102
511 Ga0070689_101192227
512 Ga0070692_10254651
513 Ga0070668_100598095
514 Ga0070669_101182777
515 Ga0070675_100188645
516 Ga0070659_100098477
517 Ga0070659_100107614
518 Ga0070659_100162139
519 Ga0070659_100214341
520 Ga0070667_100763441
521 Ga0070713_100794778
522 Ga0070705_100674590
523 Ga0070700_100021420
524 Ga0070700_100236235
525 Ga0070678_101345102
526 Ga0070681_10240632
527 Ga0070698_100311059
528 Ga0070679_101817123
529 Ga0070684_100005944
530 Ga0070684_100008437
531 Ga0070684_100015319
532 Ga0068853_101469215
533 Ga0068853_101742666
534 Ga0070672_100609917
535 Ga0070672_101414877
536 Ga0070672_101948842
537 Ga0070695_100284132
538 Ga0070696_101356012
539 Ga0068855_100332171
540 Ga0068855_101619234
541 Ga0070664_100001178
542 Ga0068857_100029746
543 Ga0068857_100905666
544 Ga0068857_102139374
545 Ga0070702_100361519
546 Ga0068852_100035330
547 Ga0068852_102084853
548 Ga0068859_101919263
549 Ga0068870_10144223
550 Ga0068858_100126490
551 Ga0068862_101508997
552 Ga0081455_10160522
553 Ga0081455_10440926
554 Ga0081538_10000036
555 Ga0081539_10000039
556 Ga0081539_10000100
557 Ga0081539_10002328
558 Ga0075367_10181825
559 Ga0075370_10103871
560 Ga0075428_100001373
561 Ga0075428_100125148
562 Ga0075428_100247245
563 Ga0075428_100486953
564 Ga0075428_101125712
565 Ga0075428_101216619
566 Ga0075428_101528187
567 Ga0075430_100019399
568 Ga0075430_100220265
569 Ga0075430_101787804
570 Ga0075431_100002453
571 Ga0075431_100087594
572 Ga0075431_101644737
573 Ga0075429_100005673
574 Ga0075429_100014654
575 Ga0075429_100038416
576 Ga0075429_100075937
577 Ga0075429_100096205
578 Ga0075429_101083103
579 Ga0075429_101264418
580 Ga0097620_101919374
581 Ga0111539_10010193
582 Ga0111539_10215241
583 Ga0114129_10000061
584 Ga0114129_10084668
585 Ga0114129_10860047
586 Ga0114129_10976664
587 Ga0114129_11766751
588 Ga0105243_10588764
589 Ga0105243_11344050
590 Ga0105243_11623809
591 Ga0105248_12299443
592 Ga0105238_10703261
593 Ga0105239_10297594
594 Ga0105239_10353241
595 Ga0105239_12125886
596 Ga0105246_10742513
597 Ga0157371_11502334
598 Ga0157370_11210052
599 Ga0157369_10510151
600 Ga0157369_11549256
601 Ga0163162_10019406
602 Ga0163162_10268922
603 Ga0163162_10417940
604 Ga0163162_11243771
605 Ga0157372_10264221
606 Ga0157372_11620328
607 Ga0157375_10760006
608 Ga0157375_10883844
609 Ga0157380_10695070
610 Ga0157380_11390339
611 Ga0157377_10085380
612 Ga0163161_10995352
613 Ga0206356_10963748
614 Ga0206353_11100137
615 Ga0213876_10110418
616 Ga0213875_10000703
617 Ga0207697_10462454
618 Ga0207688_10234384
619 Ga0207647_10016140
620 Ga0207647_10036740
621 Ga0207645_10124239
622 Ga0207643_10063977
623 Ga0207643_10407074
624 Ga0207705_10177503
625 Ga0207705_10177935
626 Ga0207705_10874391
627 Ga0207707_10317633
628 Ga0207660_10483676
629 Ga0207657_10074632
630 Ga0207657_10136152
631 Ga0207657_10618705
632 Ga0207649_10016591
633 Ga0207650_11299964
634 Ga0207659_10106711
635 Ga0207700_10504474
636 Ga0207644_10487645
637 Ga0207690_10018106
638 Ga0207690_10226290
639 Ga0207690_10335939
640 Ga0207690_10756193
641 Ga0207709_10602275
642 Ga0207669_10095222
643 Ga0207691_11404456
644 Ga0207711_10000285
645 Ga0207711_10677339
646 Ga0207689_10003196
647 Ga0207661_10010176
648 Ga0207661_10046732
649 Ga0207661_10123788
650 Ga0207679_10071565
651 Ga0207679_11496685
652 Ga0207667_10355495
653 Ga0207667_10856855
654 Ga0207667_11918133
655 Ga0207712_10909894
656 Ga0207668_10749362
657 Ga0207668_10914644
658 Ga0207640_10045418
659 Ga0207677_10009110
660 Ga0207703_10716316
661 Ga0207703_11111008
662 Ga0207639_10221664
663 Ga0207639_10897062
664 Ga0207678_10006850
665 Ga0207678_11131653
666 Ga0207708_10003029
667 Ga0207708_11309600
668 Ga0207641_11024068
669 Ga0207641_11486167
670 Ga0207676_12484437
671 Ga0207674_10008046
672 Ga0207674_10527705
673 Ga0207674_10919884
674 Ga0207675_100580022
675 Ga0207683_10241233
676 Ga0207698_10068664
677 Ga0207428_10013311
678 Ga0268265_10042067
679 Ga0268264_11283078
680 Ga0307515_10000741
681 Ga0307515_10464021
682 Ga0307512_10062138
683 Ga0316177_1103462
684 Ga0316176_1083689
685 Ga0314311_1119278
686 Ga0316179_1061631
687 Ga0316178_1109174
688 Ga0316178_1114149
689 Ga0316180_1074632
690 Ga0316180_1188960
691 Ga0316181_1256691
692 Ga0316182_1102902
693 Ga0307513_10217891
694 Ga0307408_101095608
695 Ga0307408_101406748
696 Ga0307408_101692372
697 Ga0307508_10015665
698 Ga0307508_10615660
699 Ga0316575_10000001
700 Ga0307516_10010281
701 Ga0307516_10060453
702 Ga0307516_11001054
703 Ga0307405_10036828
704 Ga0307405_10776395
705 Ga0307413_11469478
706 Ga0307410_10026387
707 Ga0307410_10108934
708 Ga0307410_10217880
709 Ga0307410_10368477
710 Ga0307406_10004819
711 Ga0307406_10047126
712 Ga0307406_10094615
713 Ga0307406_10101721
714 Ga0307406_10676898
715 Ga0307407_10003798
716 Ga0307407_10133659
717 Ga0307407_10696217
718 Ga0307412_10048037
719 Ga0307412_11862702
720 Ga0307409_100077833
721 Ga0307409_100106881
722 Ga0307409_100428472
723 Ga0307409_100780385
724 Ga0307409_102026733
725 Ga0307409_102103918
726 Ga0307416_100003743
727 Ga0307416_100090726
728 Ga0307416_100318488
729 Ga0307416_100387825
730 Ga0307416_100398878
731 Ga0307416_102435346
732 Ga0307411_10697526
733 Ga0307411_10768814
734 Ga0307415_100000011
735 Ga0307415_100033058
736 Ga0307415_100060943
737 Ga0307415_100170766
738 Ga0307415_100404896
739 Ga0307415_100482101
740 Ga0307415_100952172
741 Ga0373948_0162923
742 Ga0373935_0007232
743 Ga0373947_0047742
744 Ga0373937_0257948
745 Ga0373937_0571027
746 Ga0373925_0917992
747 Ga0395899_0233242
748 Ga0395899_0488274
749 Ga0395900_0006621
750 Ga0395900_0040114
751 Ga0395898_0009507
752 Ga0395898_0021487
753 Ga0395898_0141189
754 Ga0395905_0007783
755 Ga0395905_0224686
756 Ga0395901_0302759
757 Ga0395901_0874170
758 Ga0395901_0979200
759 Ga0395901_2008887
760 Ga0400483_216108
761 Ga0436365_1456480
762 Ga0439436_0000142
763 Ga0439436_0018570
764 Ga0439438_004523
765 Ga0439438_092312
766 Ga0439439_0001219
767 Ga0439447_034073
768 Ga0439461_0003384
769 Ga0439466_0001136
770 Ga0439466_0180602
771 Ga0439465_0054550
772 Ga0439465_0125108
773 Ga0439465_0289343
774 Ga0451791_0524839
775 Ga0451791_1503339
776 Ga0451793_0093726
777 Ga0451797_0471118
778 Ga0451797_0615286
779 Ga0451795_1685673
780 Ga0451802_2045260
781 Ga0451833_0570333
782 Ga0451833_0980057
783 Ga0451837_1439484
784 Ga0451839_1323906
785 Ga0451841_1017450
786 Ga0451843_1014165
787 Ga0451853_0279636
788 Ga0451853_2870202
789 Ga0439433_0000028
790 Ga0439442_001031
791 Ga0439445_0038998
792 Ga0439445_0145011
793 Ga0439432_008729
794 Ga0439432_031745
795 Ga0439449_0002108
796 Ga0439449_0075765
797 Ga0439449_0089787
798 Ga0439449_0261534
799 Ga0439452_002512
800 Ga0439457_001291
801 Ga0439457_016848
802 Ga0439462_0000282
803 Ga0450911_022201
804 Ga0450919_008356
805 Ga0450920_005815
806 Ga0450920_016909
807 Ga0450897_007669
808 Ga0450900_011337
809 Ga0450907_005400
810 Ga0450907_006937
811 Ga0439446_0021743
812 Ga0450908_009296
813 Ga0450909_043972
814 Ga0450909_076220
815 Ga0439434_0001039
816 Ga0439460_0273606
817 Ga0450918_003364
818 Ga0450918_007019
819 Ga0466969_0072241
820 Ga0466965_0073449
821 Ga0466966_0008889
822 Ga0466963_0010860
823 Ga0466963_1271151
824 Ga0466964_0609122
825 Ga0466971_0034473
826 Ga0466957_0003375
827 Ga0466960_0011895
828 Ga0466960_0133922
829 Ga0466959_0005972
830 Ga0466958_0056661
831 Ga0466967_0737329
832 Ga0495638_0135745
833 Ga0495639_0326706
834 Ga0495594_0873701
835 Ga0495633_0469560
836 Ga0495668_0000794
837 Ga0495625_0005235
838 Ga0495588_0314290
839 Ga0495670_0201010
840 Ga0495670_0679453
841 Ga0495671_0501699
842 Ga0495589_0492649
843 Ga0495660_0517862
844 Ga0495581_0346342
845 Ga0495683_0437559
846 Ga0495593_0045634
847 Ga0495626_0000142
848 Ga0496100_0002255
849 Ga0496101_0010445
850 Ga0496101_0062787
851 Ga0496101_0565065
852 Ga0496102_0009076
853 Ga0496102_0360087
854 Ga0496102_1448763
855 Ga0496104_0108283
856 Ga0496104_0156813
857 Ga0496104_0480441
858 Ga0496104_1095167
859 Ga0496105_0045151
860 Ga0496105_0052547
861 Ga0496105_0603296
862 Ga0496106_0002931
863 Ga0496106_1194136
864 Ga0496107_0000856
865 Ga0496107_0167486
866 Ga0496108_0229481
867 Ga0496109_0023288
868 Ga0496109_0058988
869 Ga0496109_0062707
870 Ga0496109_0139514
871 Ga0496109_0372643
872 Ga0496109_1948713
873 Ga0496110_0047754
874 Ga0496110_0063904
875 Ga0496110_0570081
876 Ga0496110_0839931
877 Ga0496111_0048764
878 Ga0496111_0144623
879 Ga0496111_0694318
880 Ga0496112_0116126
881 Ga0496112_0143904
882 Ga0496112_0872348
883 Ga0496113_0096627
884 Ga0496113_0293204
885 Ga0496113_0336838
886 Ga0496114_0038926
887 Ga0496114_0788505
888 Ga0496115_0366258
889 Ga0496115_0434575
890 Ga0496115_0673212
891 Ga0496118_0004452
892 Ga0496119_0002443
893 Ga0496124_0517985
894 Ga0496126_0027227
895 Ga0501031_0000913
896 Ga0501032_0045830
897 Ga0501033_0019148
898 Ga0501034_0028667
899 Ga0501034_0597488
900 Ga0501036_0016566
901 Ga0501037_0030484
902 Ga0501038_0015614
903 Ga0501038_0064012
904 Ga0501038_0221501
905 Ga0501039_0006409
906 Ga0501040_0003635
907 Ga0501040_0020571
908 Ga0501041_0009306
909 Ga0501041_0146003
910 Ga0501042_0003198
911 Ga0501042_0067356
912 Ga0501043_0040241
913 Ga0501043_0678670
914 Ga0501046_0045547
915 Ga0501046_0781449
916 Ga0501047_0063598
917 Ga0501048_0005139
918 Ga0501067_0337043
919 Ga0501067_0372237
920 Ga0501067_0594157
921 Ga0501068_0128065
922 Ga0501068_0533938
923 Ga0501068_0635456
924 Ga0501068_0849494
925 Ga0501070_0093262
926 Ga0501070_0396129
927 Ga0501071_0017348
928 Ga0501071_0701140
929 Ga0501071_0930075
930 Ga0501071_0946884
931 Ga0501072_0013715
932 Ga0501074_0004151
933 Ga0501074_0021486
934 Ga0501074_0243924
935 Ga0501075_0002108
936 Ga0501075_0181880
937 Ga0501076_0005020
938 Ga0501076_0103531
939 Ga0501077_0723096
940 Ga0501079_0004432
941 Ga0501079_0068228
942 Ga0501079_0660875
943 Ga0501080_0009204
944 Ga0501081_0006413
945 Ga0501083_0041709
946 Ga0501083_0315935
947 Ga0501083_0664441
948 Ga0501044_0044026
949 Ga0501045_0002811
950 Ga0501045_0019985
951 Ga0501045_0280645
952 nmdc:mga06z11_276862_c1
953 nmdc:mga07m45_56447_c1
954 nmdc:mga05p37_360_c1
955 nmdc:mga05p37_466765_c1
956 nmdc:mga05p37_546666_c1
957 nmdc:mga05p37_813564_c1
958 nmdc:mga09592_221663_c1
959 nmdc:mga09592_266_c1
960 nmdc:mga09592_622156_c1
961 nmdc:mga09592_948164_c1
962 nmdc:mga09592_96844_c1
963 nmdc:mga0qj67_131_c1
964 nmdc:mga0qj67_1444362_c1
965 nmdc:mga06r32_11281_c2
966 nmdc:mga06r32_227709_c1
967 nmdc:mga06r32_364_c1
968 nmdc:mga06r32_679861_c1
969 nmdc:mga08y16_15172_c1
970 nmdc:mga0n895_2123604_c1
971 nmdc:mga0a205_1183662_c1
972 Ga0495619_0048885
973 Ga0500594_0162293
974 Ga0500588_0001374
975 Ga0500616_0001699
976 Ga0500616_0045408
977 Ga0501084_0007439
978 Ga0501084_0016179
979 Ga0501082_0008736
980 Ga0501082_0053575
981 Ga0466962_0038141
982 Ga0530510_0002028
983 Ga0530510_0554002
984 2857290210
985 2858884191
986 8045833850

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

42

116

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9502 3 103
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9419 6 105
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9399 5 103
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9342 6 105
6abq-assembly1.cif.gz_B crystal structure of transcription factor from listeria monocytogenes 0.9262 6 108
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9399 5 103 1.10.10.10
4esfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9164 6 108 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9106 13 90 1.10.10.10
2yr2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8998 13 104 1.10.10.10
af_P32349_45_122_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8971 15 80 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A523GL95-F1-model_v4 PadR family transcriptional regulator 0.9826 3 108 GO:0005737
AF-A0A1G3M1Z1-F1-model_v4 PadR family transcriptional regulator 0.982 1 107
AF-A0A2D6LBC3-F1-model_v4 PadR family transcriptional regulator 0.9774 3 110
AF-A0A094KWV6-F1-model_v4 Lineage-specific thermal regulator protein 0.9762 5 106
AF-A0A2H0JUK8-F1-model_v4 PadR family transcriptional regulator 0.9745 9 106 GO:0005737

Map