F454420

General Info

Members Datasets Scaffolds Average Seq Length
493 228 488 255

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10108496|Ga0105242_101084962
Length 276
Sequence MKINRNSWLNKLKTKDMKILIVEDEDLAVKKLQKTLALVDKDAIVAGVTDSIKSSVEWLQQHPAPDLILMDIELADGQSFEIFNLTDIKSPVIFTTSYDEYALKAFKVNSIDYLLKPVQKEELEAALSKYRQIKQSYSPQNTNGDGISIDNIIKELQQKLQPKEYRKRFLVKHAQKLVSIEIDDIAYFFSDGRLNFFKTYDNRKFVVDYTMDELEDMLDPEKYFRISRSFYVSVECIDKIDDYFGNRLILQLKPAVDKEALVSREKVTDFKKWMGK

Samples

Sample ID Description Type Environment
1 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
2 2738543023 Pedobacter sp. OK628 Isolate Unclassified
3 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
4 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
5 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
154 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
157 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
158 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
159 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
162 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
163 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
187 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
188 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
189 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
197 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
198 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
199 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
200 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
201 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
202 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
203 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
204 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
205 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
206 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
207 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
208 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
209 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
210 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
211 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
212 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
213 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
214 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
215 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
216 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
217 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
225 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
228 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 0
Isolates 1.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.84
Nodule 0
Rhizoplane 1.01
Rhizosphere 93.51
Stem 0
Stem Tuber 0
Unclassified 2.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000680 3300002459 Bacteria 8461
2 rootH1_10000968 3300003316 Bacteria 9790
3 rootH2_10020850 3300003320 Bacteria 5214
4 rootL2_10178184 3300003322 Bacteria 1475
5 Ga0055531_10000014 3300003794 Bacteria 184532
6 Ga0065165_1001005 3300005262 Bacteria 34467
7 Ga0070658_10015009 3300005327 Bacteria 6201
8 Ga0070658_10191781 3300005327 Bacteria 1722
9 Ga0070658_10217247 3300005327 Bacteria 1616
10 Ga0070658_10313298 3300005327 Unclassified 1339
11 Ga0070676_10000919 3300005328 Bacteria 14575
12 Ga0070676_10140878 3300005328 Unclassified 1535
13 Ga0070670_100061190 3300005331 Bacteria 3232
14 Ga0070670_100335363 3300005331 Unclassified 1327
15 Ga0070670_100383047 3300005331 Bacteria 1239
16 Ga0070677_10145976 3300005333 Unclassified 1096
17 Ga0068869_100007409 3300005334 Bacteria 7010
18 Ga0068869_100010260 3300005334 Bacteria 6103
19 Ga0068869_100095040 3300005334 Bacteria 2248
20 Ga0068869_100241947 3300005334 Unclassified 1438
21 Ga0070666_10000128 3300005335 Bacteria 53252
22 Ga0070666_10001118 3300005335 Bacteria 16333
23 Ga0070666_10085518 3300005335 Bacteria 2160
24 Ga0070682_100092669 3300005337 Bacteria 1980
25 Ga0068868_100005277 3300005338 Bacteria 9074
26 Ga0068868_100026388 3300005338 Bacteria 4427
27 Ga0068868_100347537 3300005338 Unclassified 1269
28 Ga0070689_100105475 3300005340 Bacteria 2235
29 Ga0070661_100495422 3300005344 Bacteria 977
30 Ga0070668_100002267 3300005347 Bacteria 14174
31 Ga0070668_100008569 3300005347 Bacteria 7596
32 Ga0070668_100372818 3300005347 Unclassified 1213
33 Ga0070668_100420794 3300005347 Unclassified 1144
34 Ga0070675_100024972 3300005354 Bacteria 4790
35 Ga0070671_100003059 3300005355 Bacteria 13010
36 Ga0070671_100035380 3300005355 Bacteria 4138
37 Ga0070671_100127289 3300005355 Bacteria 2145
38 Ga0070671_100294684 3300005355 Bacteria 1381
39 Ga0070674_100020268 3300005356 Bacteria 4243
40 Ga0070674_100066502 3300005356 Unclassified 2533
41 Ga0070674_100258080 3300005356 Unclassified 1372
42 Ga0070673_100000176 3300005364 Bacteria 31248
43 Ga0070673_100036386 3300005364 Bacteria 3741
44 Ga0070667_100012217 3300005367 Bacteria 7104
45 Ga0070667_100015256 3300005367 Bacteria 6350
46 Ga0070667_100020994 3300005367 Bacteria 5425
47 Ga0070667_100107888 3300005367 Unclassified 2411
48 Ga0070678_100019622 3300005456 Bacteria 4415
49 Ga0070678_100057478 3300005456 Unclassified 2850
50 Ga0070662_100014397 3300005457 Bacteria 5284
51 Ga0068867_100003573 3300005459 Bacteria 10935
52 Ga0068867_100067215 3300005459 Bacteria 2672
53 Ga0068867_100208390 3300005459 Unclassified 1569
54 Ga0068867_100398623 3300005459 Unclassified 1160
55 Ga0070685_10043537 3300005466 Bacteria 2567
56 Ga0070685_10263070 3300005466 Bacteria 1148
57 Ga0070679_100000801 3300005530 Bacteria 27256
58 Ga0068853_100000663 3300005539 Bacteria 23682
59 Ga0068853_100006370 3300005539 Bacteria 9373
60 Ga0068853_100013731 3300005539 Bacteria 6617
61 Ga0068853_100022130 3300005539 Bacteria 5306
62 Ga0068853_100032723 3300005539 Bacteria 4407
63 Ga0068853_100245988 3300005539 Bacteria 1640
64 Ga0068853_100380394 3300005539 Unclassified 1318
65 Ga0070672_100000021 3300005543 Bacteria 69249
66 Ga0070672_100041657 3300005543 Bacteria 3532
67 Ga0070672_100158252 3300005543 Bacteria 1877
68 Ga0070665_100000052 3300005548 Bacteria 245694
69 Ga0070665_100002639 3300005548 Bacteria 19522
70 Ga0068855_100087680 3300005563 Bacteria 3596
71 Ga0068855_100152800 3300005563 Bacteria 2624
72 Ga0070664_100294154 3300005564 Bacteria 1466
73 Ga0070664_100618604 3300005564 Bacteria 1005
74 Ga0068857_100106574 3300005577 Bacteria 2517
75 Ga0068857_100148479 3300005577 Unclassified 2122
76 Ga0068854_100046067 3300005578 Bacteria 3104
77 Ga0068854_100231691 3300005578 Bacteria 1466
78 Ga0068856_100056565 3300005614 Unclassified 3871
79 Ga0068856_100060619 3300005614 Bacteria 3738
80 Ga0068852_100011437 3300005616 Bacteria 6681
81 Ga0068852_100072849 3300005616 Bacteria 3020
82 Ga0068852_100098593 3300005616 Bacteria 2632
83 Ga0068852_100234648 3300005616 Bacteria 1750
84 Ga0068852_100915367 3300005616 Unclassified 894
85 Ga0068859_100000018 3300005617 Bacteria 248813
86 Ga0068859_100008734 3300005617 Bacteria 10237
87 Ga0068859_100009972 3300005617 Bacteria 9583
88 Ga0068859_100134059 3300005617 Bacteria 2549
89 Ga0068859_101145162 3300005617 Bacteria 856
90 Ga0068864_100001639 3300005618 Bacteria 18453
91 Ga0068864_100021049 3300005618 Bacteria 5461
92 Ga0068864_100036693 3300005618 Bacteria 4180
93 Ga0068864_100124758 3300005618 Bacteria 2306
94 Ga0068864_100517205 3300005618 Bacteria 1150
95 Ga0068866_10267092 3300005718 Bacteria 1054
96 Ga0068861_100001635 3300005719 Bacteria 14295
97 Ga0068861_100054841 3300005719 Bacteria 3038
98 Ga0068851_10000042 3300005834 Bacteria 88904
99 Ga0068851_10000837 3300005834 Bacteria 13252
100 Ga0068851_10082545 3300005834 Bacteria 1680
101 Ga0068863_100001440 3300005841 Bacteria 23603
102 Ga0068863_100009850 3300005841 Bacteria 9311
103 Ga0068863_100093530 3300005841 Bacteria 2853
104 Ga0068863_100195622 3300005841 Bacteria 1944
105 Ga0068858_100001622 3300005842 Bacteria 22949
106 Ga0068858_100007306 3300005842 Bacteria 10699
107 Ga0068858_100141235 3300005842 Bacteria 2261
108 Ga0068858_100329389 3300005842 Bacteria 1460
109 Ga0068858_100730353 3300005842 Bacteria 964
110 Ga0068860_100000004 3300005843 Bacteria 506126
111 Ga0068860_100004245 3300005843 Bacteria 14679
112 Ga0068860_100006290 3300005843 Bacteria 11928
113 Ga0068860_100007305 3300005843 Bacteria 11046
114 Ga0068860_100010471 3300005843 Bacteria 9168
115 Ga0068860_100236331 3300005843 Bacteria 1777
116 Ga0068862_100026272 3300005844 Bacteria 4894
117 Ga0068862_100049775 3300005844 Bacteria 3579
118 Ga0070715_10141145 3300006163 Bacteria 1170
119 Ga0075366_10158564 3300006195 Unclassified 1371
120 Ga0097621_100000092 3300006237 Bacteria 49439
121 Ga0097621_100000420 3300006237 Bacteria 29466
122 Ga0097621_100005432 3300006237 Bacteria 8981
123 Ga0097621_100058281 3300006237 Bacteria 3160
124 Ga0097621_100106944 3300006237 Bacteria 2360
125 Ga0097621_100293964 3300006237 Unclassified 1433
126 Ga0068871_100000032 3300006358 Bacteria 73078
127 Ga0068871_100004987 3300006358 Bacteria 9275
128 Ga0068871_100007013 3300006358 Bacteria 8029
129 Ga0068871_100048066 3300006358 Bacteria 3443
130 Ga0068871_100158429 3300006358 Bacteria 1935
131 Ga0068871_100223295 3300006358 Unclassified 1633
132 Ga0075428_100007713 3300006844 Bacteria 11924
133 Ga0075430_100048587 3300006846 Bacteria 3583
134 Ga0075431_100010383 3300006847 Bacteria 9357
135 Ga0075429_100034791 3300006880 Bacteria 4378
136 Ga0068865_100006969 3300006881 Bacteria 6931
137 Ga0068865_100184021 3300006881 Unclassified 1611
138 Ga0068865_100186627 3300006881 Bacteria 1600
139 Ga0097620_100000018 3300006931 Bacteria 248813
140 Ga0097620_100008734 3300006931 Bacteria 10237
141 Ga0097620_100009972 3300006931 Bacteria 9583
142 Ga0097620_100134042 3300006931 Bacteria 2549
143 Ga0097620_101145132 3300006931 Bacteria 856
144 Ga0105240_10000033 3300009093 Bacteria 279600
145 Ga0105240_10000374 3300009093 Bacteria 83962
146 Ga0105240_10000396 3300009093 Bacteria 81252
147 Ga0105240_10003517 3300009093 Bacteria 24308
148 Ga0105240_10015563 3300009093 Bacteria 10337
149 Ga0105240_10024072 3300009093 Bacteria 8039
150 Ga0105240_10042289 3300009093 Bacteria 5807
151 Ga0105240_10047595 3300009093 Bacteria 5425
152 Ga0105240_10962558 3300009093 Bacteria 915
153 Ga0111539_10864745 3300009094 Unclassified 1052
154 Ga0105245_10112864 3300009098 Bacteria 2530
155 Ga0105245_10378176 3300009098 Unclassified 1410
156 Ga0105247_10005662 3300009101 Bacteria 7828
157 Ga0105247_10033548 3300009101 Bacteria 3123
158 Ga0114129_10099394 3300009147 Bacteria 4027
159 Ga0105243_10345547 3300009148 Unclassified 1364
160 Ga0105241_10000510 3300009174 Bacteria 29254
161 Ga0105241_10003108 3300009174 Bacteria 12354
162 Ga0105241_10078734 3300009174 Bacteria 2576
163 Ga0105241_10193417 3300009174 Bacteria 1694
164 Ga0105242_10022712 3300009176 Bacteria 4938
165 Ga0105242_10029685 3300009176 Bacteria 4361
166 Ga0105242_10029987 3300009176 Bacteria 4341
167 Ga0105242_10108496 3300009176 Bacteria 2362
168 Ga0105242_10366234 3300009176 Bacteria 1335
169 Ga0105242_10425150 3300009176 Bacteria 1246
170 Ga0105248_10289976 3300009177 Bacteria 1843
171 Ga0105237_10001030 3300009545 Bacteria 37560
172 Ga0105237_10001747 3300009545 Bacteria 28074
173 Ga0105237_10013007 3300009545 Bacteria 8739
174 Ga0105237_10115949 3300009545 Bacteria 2672
175 Ga0105237_10120383 3300009545 Bacteria 2619
176 Ga0105237_10628588 3300009545 Bacteria 1081
177 Ga0105238_10011503 3300009551 Bacteria 8916
178 Ga0105238_10014421 3300009551 Bacteria 7989
179 Ga0105238_10296899 3300009551 Bacteria 1599
180 Ga0105249_10002177 3300009553 Bacteria 16981
181 Ga0105249_10002773 3300009553 Bacteria 15120
182 Ga0105249_10003386 3300009553 Bacteria 13811
183 Ga0105249_10006808 3300009553 Bacteria 9965
184 Ga0105249_10065334 3300009553 Bacteria 3347
185 Ga0105239_10002949 3300010375 Bacteria 21217
186 Ga0105239_10004634 3300010375 Bacteria 16340
187 Ga0105239_10032974 3300010375 Bacteria 5689
188 Ga0105239_10033727 3300010375 Bacteria 5620
189 Ga0105239_10050966 3300010375 Bacteria 4539
190 Ga0105246_10320994 3300011119 Unclassified 1258
191 Ga0105246_10324567 3300011119 Bacteria 1252
192 Ga0157373_10121023 3300013100 Bacteria 1840
193 Ga0157371_10450027 3300013102 Bacteria 947
194 Ga0157370_10041253 3300013104 Bacteria 4454
195 Ga0157370_10050784 3300013104 Bacteria 3962
196 Ga0157370_10051081 3300013104 Unclassified 3950
197 Ga0157370_10106603 3300013104 Bacteria 2622
198 Ga0157369_10011029 3300013105 Bacteria 10284
199 Ga0157369_10060735 3300013105 Unclassified 4075
200 Ga0157369_10256794 3300013105 Bacteria 1823
201 Ga0157369_10267972 3300013105 Bacteria 1780
202 Ga0157374_10000263 3300013296 Bacteria 48612
203 Ga0157374_10037486 3300013296 Bacteria 4450
204 Ga0157374_10153052 3300013296 Bacteria 2243
205 Ga0157378_10006512 3300013297 Bacteria 10207
206 Ga0157378_10023933 3300013297 Bacteria 5371
207 Ga0157378_10028602 3300013297 Bacteria 4919
208 Ga0157378_10038486 3300013297 Bacteria 4239
209 Ga0157378_10495943 3300013297 Unclassified 1219
210 Ga0163162_10000257 3300013306 Bacteria 48216
211 Ga0163162_10000431 3300013306 Bacteria 38724
212 Ga0163162_10000599 3300013306 Bacteria 33336
213 Ga0163162_10001193 3300013306 Bacteria 24275
214 Ga0163162_10006837 3300013306 Bacteria 11066
215 Ga0163162_10384416 3300013306 Bacteria 1537
216 Ga0163162_10858885 3300013306 Bacteria 1022
217 Ga0157372_10005222 3300013307 Bacteria 13804
218 Ga0157372_10018407 3300013307 Bacteria 7508
219 Ga0157372_10045522 3300013307 Bacteria 4868
220 Ga0157372_10084966 3300013307 Bacteria 3589
221 Ga0157372_10111773 3300013307 Bacteria 3130
222 Ga0157372_10196061 3300013307 Bacteria 2339
223 Ga0157372_10243005 3300013307 Unclassified 2089
224 Ga0157372_10344277 3300013307 Bacteria 1737
225 Ga0157375_10000067 3300013308 Bacteria 110313
226 Ga0157375_10002610 3300013308 Bacteria 15628
227 Ga0157375_10011022 3300013308 Bacteria 7973
228 Ga0157375_10166064 3300013308 Bacteria 2352
229 Ga0163163_10000607 3300014325 Bacteria 31168
230 Ga0163163_10009878 3300014325 Bacteria 8550
231 Ga0157380_10000001 3300014326 Bacteria 254890
232 Ga0157380_10000834 3300014326 Bacteria 19263
233 Ga0157380_10001919 3300014326 Bacteria 13809
234 Ga0157380_10085974 3300014326 Unclassified 2583
235 Ga0182008_10000349 3300014497 Bacteria 35951
236 Ga0157379_10002288 3300014968 Bacteria 15969
237 Ga0157379_10021139 3300014968 Bacteria 5759
238 Ga0157379_10174458 3300014968 Bacteria 1941
239 Ga0157379_10404199 3300014968 Bacteria 1256
240 Ga0157376_10000380 3300014969 Bacteria 28963
241 Ga0157376_10000419 3300014969 Bacteria 27633
242 Ga0157376_10003834 3300014969 Bacteria 10395
243 Ga0157376_10117890 3300014969 Bacteria 2348
244 Ga0182006_1000272 3300015261 Bacteria 46317
245 Ga0182007_10010016 3300015262 Bacteria 3775
246 Ga0163161_10000985 3300017792 Bacteria 21812
247 Ga0163161_10018828 3300017792 Bacteria 4839
248 Ga0163161_10167333 3300017792 Bacteria 1679
249 Ga0163161_10237375 3300017792 Unclassified 1417
250 Ga0209257_1000004 3300025304 Bacteria 1678347
251 Ga0207697_10021045 3300025315 Bacteria 2670
252 Ga0207656_10000176 3300025321 Bacteria 23119
253 Ga0207656_10009820 3300025321 Bacteria 3561
254 Ga0207656_10181375 3300025321 Bacteria 1011
255 Ga0207642_10146813 3300025899 Archaea 1250
256 Ga0207710_10017089 3300025900 Bacteria 3074
257 Ga0207680_10000212 3300025903 Bacteria 27928
258 Ga0207680_10196850 3300025903 Bacteria 1371
259 Ga0207647_10037414 3300025904 Bacteria 3077
260 Ga0207647_10038314 3300025904 Bacteria 3032
261 Ga0207645_10001548 3300025907 Bacteria 18808
262 Ga0207645_10017936 3300025907 Unclassified 4667
263 Ga0207705_10012197 3300025909 Bacteria 6210
264 Ga0207705_10027667 3300025909 Bacteria 4044
265 Ga0207654_10002807 3300025911 Bacteria 8840
266 Ga0207654_10028816 3300025911 Bacteria 3031
267 Ga0207695_10000023 3300025913 Bacteria 657903
268 Ga0207695_10000031 3300025913 Bacteria 526801
269 Ga0207695_10001413 3300025913 Bacteria 40444
270 Ga0207695_10015197 3300025913 Bacteria 9078
271 Ga0207695_10072148 3300025913 Unclassified 3524
272 Ga0207695_10075832 3300025913 Unclassified 3420
273 Ga0207695_10100183 3300025913 Bacteria 2894
274 Ga0207695_10767519 3300025913 Bacteria 844
275 Ga0207671_10001806 3300025914 Bacteria 23915
276 Ga0207671_10007426 3300025914 Bacteria 9513
277 Ga0207671_10008400 3300025914 Bacteria 8765
278 Ga0207671_10378910 3300025914 Bacteria 1124
279 Ga0207657_10043877 3300025919 Bacteria 3935
280 Ga0207652_10003129 3300025921 Bacteria 13799
281 Ga0207652_10046078 3300025921 Bacteria 3719
282 Ga0207694_10043079 3300025924 Bacteria 3483
283 Ga0207694_10265588 3300025924 Bacteria 1407
284 Ga0207650_10103001 3300025925 Bacteria 2200
285 Ga0207650_10362595 3300025925 Bacteria 1194
286 Ga0207659_10084378 3300025926 Bacteria 2357
287 Ga0207687_10089240 3300025927 Bacteria 2244
288 Ga0207687_10279968 3300025927 Bacteria 1336
289 Ga0207644_10005771 3300025931 Bacteria 8055
290 Ga0207644_10203318 3300025931 Bacteria 1563
291 Ga0207644_10348755 3300025931 Bacteria 1201
292 Ga0207644_10386688 3300025931 Unclassified 1142
293 Ga0207644_10591946 3300025931 Bacteria 920
294 Ga0207706_10001948 3300025933 Bacteria 20257
295 Ga0207686_10044276 3300025934 Bacteria 2732
296 Ga0207686_10048913 3300025934 Bacteria 2622
297 Ga0207709_10303967 3300025935 Unclassified 1187
298 Ga0207669_10006754 3300025937 Bacteria 5268
299 Ga0207669_10236484 3300025937 Unclassified 1351
300 Ga0207704_10281061 3300025938 Unclassified 1265
301 Ga0207691_10000115 3300025940 Bacteria 72014
302 Ga0207691_10056774 3300025940 Bacteria 3566
303 Ga0207691_10211948 3300025940 Bacteria 1682
304 Ga0207689_10000602 3300025942 Bacteria 34433
305 Ga0207689_10000885 3300025942 Bacteria 28807
306 Ga0207689_10248155 3300025942 Unclassified 1472
307 Ga0207679_10286327 3300025945 Unclassified 1415
308 Ga0207667_10005101 3300025949 Bacteria 16039
309 Ga0207667_10065118 3300025949 Bacteria 3802
310 Ga0207667_10124459 3300025949 Bacteria 2656
311 Ga0207667_10174973 3300025949 Bacteria 2206
312 Ga0207651_10004090 3300025960 Bacteria 7277
313 Ga0207651_10111512 3300025960 Bacteria 2054
314 Ga0207712_10007860 3300025961 Bacteria 6742
315 Ga0207712_10011855 3300025961 Bacteria 5557
316 Ga0207712_10100762 3300025961 Bacteria 2147
317 Ga0207712_10182084 3300025961 Bacteria 1651
318 Ga0207712_10222414 3300025961 Bacteria 1510
319 Ga0207668_10003346 3300025972 Bacteria 9393
320 Ga0207668_10130425 3300025972 Bacteria 1919
321 Ga0207668_10185453 3300025972 Unclassified 1645
322 Ga0207640_10013742 3300025981 Unclassified 4647
323 Ga0207640_10189241 3300025981 Bacteria 1550
324 Ga0207658_10018380 3300025986 Bacteria 4827
325 Ga0207658_10041471 3300025986 Bacteria 3333
326 Ga0207658_10045811 3300025986 Bacteria 3190
327 Ga0207658_10105395 3300025986 Bacteria 2217
328 Ga0207658_10270383 3300025986 Unclassified 1452
329 Ga0207677_10013744 3300026023 Unclassified 4701
330 Ga0207677_10028034 3300026023 Bacteria 3556
331 Ga0207703_10011675 3300026035 Bacteria 6831
332 Ga0207703_10013400 3300026035 Bacteria 6389
333 Ga0207639_10008759 3300026041 Bacteria 6951
334 Ga0207639_10023289 3300026041 Bacteria 4471
335 Ga0207639_10033930 3300026041 Bacteria 3769
336 Ga0207639_10056183 3300026041 Bacteria 3016
337 Ga0207639_10175064 3300026041 Bacteria 1821
338 Ga0207639_10203834 3300026041 Bacteria 1698
339 Ga0207639_10216429 3300026041 Bacteria 1652
340 Ga0207639_10345398 3300026041 Unclassified 1328
341 Ga0207708_10561673 3300026075 Unclassified 963
342 Ga0207702_10102901 3300026078 Unclassified 2525
343 Ga0207702_10210832 3300026078 Bacteria 1806
344 Ga0207641_10000015 3300026088 Bacteria 321332
345 Ga0207641_10017756 3300026088 Bacteria 5829
346 Ga0207641_10387777 3300026088 Bacteria 1339
347 Ga0207641_10416095 3300026088 Bacteria 1293
348 Ga0207648_10001560 3300026089 Bacteria 25220
349 Ga0207648_10003423 3300026089 Bacteria 16650
350 Ga0207648_10143039 3300026089 Bacteria 2109
351 Ga0207648_10209499 3300026089 Bacteria 1730
352 Ga0207648_10306544 3300026089 Bacteria 1425
353 Ga0207648_10467517 3300026089 Bacteria 1150
354 Ga0207648_10637603 3300026089 Bacteria 984
355 Ga0207676_10013364 3300026095 Bacteria 5897
356 Ga0207676_10024634 3300026095 Bacteria 4456
357 Ga0207676_10027416 3300026095 Bacteria 4243
358 Ga0207676_10174681 3300026095 Unclassified 1875
359 Ga0207674_10050171 3300026116 Unclassified 4264
360 Ga0207674_10196115 3300026116 Bacteria 1969
361 Ga0207675_100013061 3300026118 Bacteria 7751
362 Ga0207675_100059486 3300026118 Bacteria 3565
363 Ga0207675_100838903 3300026118 Bacteria 934
364 Ga0207683_10020838 3300026121 Bacteria 5609
365 Ga0268266_10000070 3300028379 Bacteria 235423
366 Ga0268266_10005778 3300028379 Bacteria 11456
367 Ga0268265_10085404 3300028380 Bacteria 2505
368 Ga0268265_10621491 3300028380 Bacteria 1035
369 Ga0268264_10000011 3300028381 Bacteria 580884
370 Ga0268264_10000844 3300028381 Bacteria 32786
371 Ga0268264_10003313 3300028381 Bacteria 13913
372 Ga0268264_10005183 3300028381 Bacteria 11038
373 Ga0268264_10007072 3300028381 Bacteria 9404
374 Ga0268264_10409882 3300028381 Unclassified 1304
375 Ga0265323_10000572 3300028653 Bacteria 20311
376 Ga0307515_10000002 3300028794 Bacteria 1231751
377 Ga0307515_10000118 3300028794 Bacteria 190444
378 Ga0307515_10167445 3300028794 Bacteria 2208
379 Ga0265316_10011768 3300031344 Bacteria 7870
380 Ga0307509_10005365 3300031507 Bacteria 17876
381 Ga0307413_10126926 3300031824 Bacteria 1739
382 Ga0307410_10150458 3300031852 Unclassified 1732
383 Ga0307412_10496860 3300031911 Bacteria 1015
384 Ga0307416_101274209 3300032002 Bacteria 841
385 Ga0307414_10000438 3300032004 Bacteria 22058
386 Ga0307414_10115970 3300032004 Bacteria 2049
387 Ga0307414_10368703 3300032004 Bacteria 1238
388 Ga0307411_10125338 3300032005 Unclassified 1867
389 Ga0307415_100638158 3300032126 Unclassified 953
390 Ga0395901_0261140 3300038443 Bacteria 1803
391 Ga0400483_125933 3300039062 Bacteria 2516
392 Ga0436365_0490833 3300039437 Unclassified 1814
393 Ga0439466_0018090 3300041411 Bacteria 2531
394 Ga0451837_1466621 3300041494 Bacteria 1072
395 Ga0451853_0718014 3300041512 Unclassified 1208
396 Ga0439441_033196 3300042001 Unclassified 1009
397 Ga0439442_039755 3300042002 Bacteria 987
398 Ga0439445_0012635 3300042004 Bacteria 2033
399 Ga0439432_106807 3300042006 Bacteria 835
400 Ga0439449_0019105 3300042007 Bacteria 2570
401 Ga0450896_011649 3300042133 Bacteria 1240
402 Ga0450898_000781 3300042134 Bacteria 3902
403 Ga0450899_006192 3300042135 Bacteria 1292
404 Ga0451577_0036540 3300042876 Bacteria 4422
405 Ga0451577_0055235 3300042876 Bacteria 3544
406 Ga0466972_0003222 3300044658 Bacteria 8102
407 Ga0453683_0266268 3300044673 Bacteria 1093
408 Ga0466964_0029724 3300044706 Bacteria 2159
409 Ga0453684_0004162 3300044712 Bacteria 31248
410 Ga0453684_0009200 3300044712 Bacteria 17361
411 Ga0453684_0017614 3300044712 Bacteria 11048
412 Ga0453684_0039379 3300044712 Bacteria 6442
413 Ga0453684_0272142 3300044712 Bacteria 1935
414 Ga0453684_0456405 3300044712 Bacteria 1422
415 Ga0466968_0010520 3300044735 Bacteria 3590
416 Ga0466970_0045295 3300044765 Bacteria 2342
417 Ga0451576_0059877 3300045051 Bacteria 3974
418 Ga0495638_0123568 3300046460 Bacteria 1527
419 Ga0495664_0360765 3300046477 Unclassified 875
420 Ga0495648_0003586 3300046524 Bacteria 13579
421 Ga0495648_0151969 3300046524 Bacteria 1207
422 Ga0495633_0023467 3300046558 Unclassified 3057
423 Ga0495668_0220601 3300046616 Bacteria 1038
424 Ga0495611_0000209 3300046648 Bacteria 41348
425 Ga0495611_0069221 3300046648 Bacteria 1612
426 Ga0495581_0299394 3300047315 Unclassified 940
427 Ga0495674_0210840 3300047319 Bacteria 1609
428 Ga0495687_000006 3300047443 Bacteria 571936
429 Ga0495686_0110054 3300047472 Bacteria 1653
430 Ga0496100_0020456 3300048903 Bacteria 3968
431 Ga0496104_0358831 3300048907 Bacteria 1370
432 Ga0496104_0419141 3300048907 Bacteria 1251
433 Ga0496109_0212740 3300048912 Bacteria 1818
434 Ga0496114_0586815 3300048917 Bacteria 983
435 Ga0501290_002721 3300049513 Bacteria 2263
436 Ga0501299_026403 3300049522 Bacteria 1096
437 Ga0501300_010806 3300049523 Bacteria 1331
438 Ga0501303_008362 3300049526 Bacteria 939
439 Ga0501032_0030540 3300049569 Bacteria 3698
440 Ga0501033_0098707 3300049570 Unclassified 2133
441 Ga0501034_0012984 3300049571 Bacteria 8586
442 Ga0501034_0213289 3300049571 Bacteria 1885
443 Ga0501046_0306513 3300049580 Bacteria 1159
444 Ga0501047_0004399 3300049581 Bacteria 13262
445 Ga0501070_0037864 3300049586 Bacteria 4025
446 Ga0501201_000013 3300049651 Bacteria 11044
447 Ga0501207_002219 3300049654 Bacteria 2497
448 Ga0501217_000291 3300049661 Bacteria 7878
449 Ga0501223_000132 3300049663 Bacteria 20982
450 Ga0501224_008986 3300049664 Bacteria 1460
451 Ga0501235_000236 3300049669 Bacteria 10127
452 Ga0501242_000616 3300049674 Unclassified 3229
453 Ga0501243_000210 3300049675 Bacteria 7168
454 Ga0501250_023604 3300049680 Unclassified 813
455 Ga0501252_005389 3300049682 Bacteria 1390
456 Ga0501253_000843 3300049683 Bacteria 2856
457 Ga0501257_058553 3300049686 Unclassified 971
458 Ga0501257_072407 3300049686 Unclassified 882
459 Ga0501259_000086 3300049688 Bacteria 13265
460 Ga0501259_064735 3300049688 Unclassified 772
461 Ga0501261_002118 3300049690 Bacteria 2436
462 Ga0501221_000387 3300049704 Bacteria 6765
463 Ga0501221_015321 3300049704 Unclassified 1437
464 Ga0501225_0000506 3300049705 Bacteria 12138
465 Ga0501245_000916 3300049708 Bacteria 3745
466 Ga0501232_009025 3300049757 Bacteria 1091
467 Ga0501266_003876 3300049763 Bacteria 1852
468 Ga0501276_001440 3300049773 Bacteria 1610
469 Ga0501281_04501 3300049777 Bacteria 979
470 Ga0501283_022148 3300049779 Bacteria 1023
471 Ga0501035_0059444 3300049822 Bacteria 3404
472 Ga0501044_0056431 3300049823 Bacteria 4033
473 Ga0501044_0582120 3300049823 Bacteria 1014
474 Ga0501212_020578 3300049851 Bacteria 1018
475 nmdc:mga09592_15299_c1 3300050508 Bacteria 6267
476 nmdc:mga0qj67_12060_c1 3300050509 Bacteria 6498
477 nmdc:mga06r32_111197_c1 3300050510 Bacteria 2696
478 Ga0500583_0001979 3300053092 Bacteria 6026
479 Ga0500583_0102183 3300053092 Bacteria 1405
480 Ga0500618_009867 3300053125 Bacteria 2589
481 Ga0500568_0000880 3300053139 Bacteria 21086
482 Ga0500568_0123895 3300053139 Unclassified 962
483 Ga0500622_0000027 3300053156 Bacteria 232414
484 Ga0500622_0000066 3300053156 Bacteria 124842
485 Ga0500622_0000546 3300053156 Bacteria 34660
486 Ga0500622_0015119 3300053156 Bacteria 4139
487 Ga0500622_0025951 3300053156 Unclassified 3094
488 Ga0590075_044056 3300059424 Bacteria 1142

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049680 Ga0501250_023604 Ga0501250_023604_137_796 200
2 3300049688 Ga0501259_064735 Ga0501259_064735_103_762 200
3 3300049686 Ga0501257_058553 Ga0501257_058553_155_931 231
4 3300046477 Ga0495664_0360765 Ga0495664_0360765_153_857 234
5 3300047315 Ga0495581_0299394 Ga0495581_0299394_18_722 234
6 3300049526 Ga0501303_008362 Ga0501303_008362_110_886 235
7 3300049704 Ga0501221_015321 Ga0501221_015321_59_835 235
8 3300006237 Ga0097621_100005432 Ga0097621_1000054328 236
9 3300006358 Ga0068871_100007013 Ga0068871_1000070132 236
10 3300013297 Ga0157378_10023933 Ga0157378_100239332 236
11 3300026075 Ga0207708_10561673 Ga0207708_105616732 236
12 3300028794 Ga0307515_10000118 Ga0307515_1000011857 236
13 3300042004 Ga0439445_0012635 Ga0439445_0012635_19_729 236
14 3300005334 Ga0068869_100241947 Ga0068869_1002419472 237
15 3300006358 Ga0068871_100223295 Ga0068871_1002232951 237
16 3300006881 Ga0068865_100184021 Ga0068865_1001840212 237
17 3300014969 Ga0157376_10003834 Ga0157376_100038344 237
18 3300025938 Ga0207704_10281061 Ga0207704_102810612 237
19 3300025942 Ga0207689_10248155 Ga0207689_102481552 237
20 3300031824 Ga0307413_10126926 Ga0307413_101269262 237
21 3300031911 Ga0307412_10496860 Ga0307412_104968601 237
22 3300032005 Ga0307411_10125338 Ga0307411_101253381 237
23 3300048907 Ga0496104_0419141 Ga0496104_0419141_185_949 237
24 3300049686 Ga0501257_072407 Ga0501257_072407_48_824 237
25 3300032004 Ga0307414_10368703 Ga0307414_103687032 239
26 3300047472 Ga0495686_0110054 Ga0495686_0110054_854_1615 243
27 3300028653 Ga0265323_10000572 Ga0265323_1000057210 244
28 3300031344 Ga0265316_10011768 Ga0265316_100117682 244
29 3300026116 Ga0207674_10196115 Ga0207674_101961152 245
30 3300046616 Ga0495668_0220601 Ga0495668_0220601_20_760 246
31 iso_pu_bacteria 2884634485 2884635901 246
32 iso_pu_bacteria 2919692658 2919693563 246
33 3300005327 Ga0070658_10015009 Ga0070658_100150093 248
34 3300005328 Ga0070676_10000919 Ga0070676_100009196 248
35 3300005354 Ga0070675_100024972 Ga0070675_1000249722 248
36 3300005355 Ga0070671_100294684 Ga0070671_1002946842 248
37 3300005364 Ga0070673_100000176 Ga0070673_10000017625 248
38 3300005367 Ga0070667_100015256 Ga0070667_1000152563 248
39 3300005457 Ga0070662_100014397 Ga0070662_1000143972 248
40 3300005459 Ga0068867_100003573 Ga0068867_1000035733 248
41 3300005539 Ga0068853_100013731 Ga0068853_1000137315 248
42 3300005543 Ga0070672_100000021 Ga0070672_10000002137 248
43 3300005563 Ga0068855_100087680 Ga0068855_1000876802 248
44 3300005618 Ga0068864_100001639 Ga0068864_1000016392 248
45 3300005719 Ga0068861_100054841 Ga0068861_1000548412 248
46 3300005834 Ga0068851_10000837 Ga0068851_1000083713 248
47 3300005841 Ga0068863_100001440 Ga0068863_10000144010 248
48 3300005841 Ga0068863_100093530 Ga0068863_1000935302 248
49 3300006237 Ga0097621_100000420 Ga0097621_10000042025 248
50 3300006358 Ga0068871_100004987 Ga0068871_1000049874 248
51 3300006881 Ga0068865_100006969 Ga0068865_1000069698 248
52 3300009093 Ga0105240_10024072 Ga0105240_100240723 248
53 3300009098 Ga0105245_10112864 Ga0105245_101128642 248
54 3300009101 Ga0105247_10033548 Ga0105247_100335482 248
55 3300009176 Ga0105242_10029685 Ga0105242_100296853 248
56 3300009545 Ga0105237_10120383 Ga0105237_101203832 248
57 3300009553 Ga0105249_10003386 Ga0105249_100033864 248
58 3300010375 Ga0105239_10033727 Ga0105239_100337273 248
59 3300013296 Ga0157374_10000263 Ga0157374_100002635 248
60 3300013297 Ga0157378_10038486 Ga0157378_100384861 248
61 3300013306 Ga0163162_10000257 Ga0163162_1000025738 248
62 3300013307 Ga0157372_10344277 Ga0157372_103442772 248
63 3300014968 Ga0157379_10002288 Ga0157379_100022887 248
64 3300025315 Ga0207697_10021045 Ga0207697_100210452 248
65 3300025900 Ga0207710_10017089 Ga0207710_100170892 248
66 3300025909 Ga0207705_10012197 Ga0207705_100121972 248
67 3300025927 Ga0207687_10089240 Ga0207687_100892402 248
68 3300025931 Ga0207644_10203318 Ga0207644_102033182 248
69 3300025933 Ga0207706_10001948 Ga0207706_100019483 248
70 3300025934 Ga0207686_10048913 Ga0207686_100489132 248
71 3300025940 Ga0207691_10000115 Ga0207691_1000011539 248
72 3300025949 Ga0207667_10065118 Ga0207667_100651182 248
73 3300025960 Ga0207651_10004090 Ga0207651_100040903 248
74 3300025961 Ga0207712_10011855 Ga0207712_100118556 248
75 3300026041 Ga0207639_10056183 Ga0207639_100561833 248
76 3300026088 Ga0207641_10017756 Ga0207641_100177562 248
77 3300026088 Ga0207641_10387777 Ga0207641_103877772 248
78 3300026089 Ga0207648_10001560 Ga0207648_100015606 248
79 3300031507 Ga0307509_10005365 Ga0307509_1000536514 248
80 3300044712 Ga0453684_0039379 Ga0453684_0039379_2436_3185 248
81 iso_pu_bacteria 2738543023 2739303701 248
82 3300005335 Ga0070666_10001118 Ga0070666_100011184 249
83 3300005338 Ga0068868_100005277 Ga0068868_1000052773 249
84 3300005347 Ga0070668_100002267 Ga0070668_10000226711 249
85 3300005548 Ga0070665_100002639 Ga0070665_1000026394 249
86 3300005842 Ga0068858_100001622 Ga0068858_10000162211 249
87 3300005843 Ga0068860_100007305 Ga0068860_1000073053 249
88 3300013308 Ga0157375_10002610 Ga0157375_100026105 249
89 3300014325 Ga0163163_10000607 Ga0163163_1000060715 249
90 3300014969 Ga0157376_10000380 Ga0157376_1000038015 249
91 3300025907 Ga0207645_10001548 Ga0207645_100015489 249
92 3300025926 Ga0207659_10084378 Ga0207659_100843782 249
93 3300025972 Ga0207668_10003346 Ga0207668_100033466 249
94 3300025986 Ga0207658_10018380 Ga0207658_100183806 249
95 3300026023 Ga0207677_10028034 Ga0207677_100280342 249
96 3300026035 Ga0207703_10011675 Ga0207703_100116756 249
97 3300026118 Ga0207675_100059486 Ga0207675_1000594862 249
98 3300028379 Ga0268266_10005778 Ga0268266_100057787 249
99 3300028381 Ga0268264_10005183 Ga0268264_100051835 249
100 3300048912 Ga0496109_0212740 Ga0496109_0212740_254_1039 249
101 iso_pu_bacteria 2904445276 2904446593 249
102 3300013297 Ga0157378_10495943 Ga0157378_104959432 250
103 3300032004 Ga0307414_10000438 Ga0307414_1000043815 250
104 3300042876 Ga0451577_0055235 Ga0451577_0055235_511_1275 250
105 3300044712 Ga0453684_0009200 Ga0453684_0009200_16259_17023 250
106 3300045051 Ga0451576_0059877 Ga0451576_0059877_2086_2850 250
107 3300059424 Ga0590075_044056 Ga0590075_044056_258_1016 250
108 iso_pu_bacteria 2585428061 2587751771 250
109 3300003316 rootH1_10000968 rootH1_100009688 251
110 3300003322 rootL2_10178184 rootL2_101781842 251
111 3300005466 Ga0070685_10263070 Ga0070685_102630702 251
112 3300017792 Ga0163161_10167333 Ga0163161_101673332 251
113 3300025931 Ga0207644_10386688 Ga0207644_103866882 251
114 3300038443 Ga0395901_0261140 Ga0395901_0261140_259_1014 251
115 3300049513 Ga0501290_002721 Ga0501290_002721_679_1455 251
116 3300049522 Ga0501299_026403 Ga0501299_026403_93_869 251
117 3300049523 Ga0501300_010806 Ga0501300_010806_305_1081 251
118 3300049651 Ga0501201_000013 Ga0501201_000013_6027_6803 251
119 3300049654 Ga0501207_002219 Ga0501207_002219_1355_2131 251
120 3300049661 Ga0501217_000291 Ga0501217_000291_1440_2216 251
121 3300049663 Ga0501223_000132 Ga0501223_000132_15921_16697 251
122 3300049664 Ga0501224_008986 Ga0501224_008986_420_1196 251
123 3300049669 Ga0501235_000236 Ga0501235_000236_5695_6471 251
124 3300049674 Ga0501242_000616 Ga0501242_000616_266_1042 251
125 3300049675 Ga0501243_000210 Ga0501243_000210_583_1359 251
126 3300049682 Ga0501252_005389 Ga0501252_005389_248_1024 251
127 3300049683 Ga0501253_000843 Ga0501253_000843_734_1510 251
128 3300049688 Ga0501259_000086 Ga0501259_000086_3173_3949 251
129 3300049690 Ga0501261_002118 Ga0501261_002118_977_1753 251
130 3300049704 Ga0501221_000387 Ga0501221_000387_5163_5939 251
131 3300049705 Ga0501225_0000506 Ga0501225_0000506_5490_6266 251
132 3300049708 Ga0501245_000916 Ga0501245_000916_946_1722 251
133 3300049757 Ga0501232_009025 Ga0501232_009025_36_812 251
134 3300049763 Ga0501266_003876 Ga0501266_003876_396_1172 251
135 3300049773 Ga0501276_001440 Ga0501276_001440_506_1282 251
136 3300049777 Ga0501281_04501 Ga0501281_04501_178_954 251
137 3300049779 Ga0501283_022148 Ga0501283_022148_230_1006 251
138 3300049851 Ga0501212_020578 Ga0501212_020578_200_976 251
139 3300053156 Ga0500622_0000066 Ga0500622_0000066_107249_108010 251
140 3300053156 Ga0500622_0000546 Ga0500622_0000546_17063_17824 251
141 3300005262 Ga0065165_1001005 Ga0065165_10010051 252
142 3300005356 Ga0070674_100020268 Ga0070674_1000202683 252
143 3300006844 Ga0075428_100007713 Ga0075428_1000077135 252
144 3300006846 Ga0075430_100048587 Ga0075430_1000485872 252
145 3300006847 Ga0075431_100010383 Ga0075431_1000103835 252
146 3300006880 Ga0075429_100034791 Ga0075429_1000347913 252
147 3300009094 Ga0111539_10864745 Ga0111539_108647451 252
148 3300009147 Ga0114129_10099394 Ga0114129_100993945 252
149 3300013104 Ga0157370_10041253 Ga0157370_100412533 252
150 3300013306 Ga0163162_10858885 Ga0163162_108588852 252
151 3300014497 Ga0182008_10000349 Ga0182008_1000034914 252
152 3300015261 Ga0182006_1000272 Ga0182006_100027225 252
153 3300015262 Ga0182007_10010016 Ga0182007_100100162 252
154 3300025937 Ga0207669_10006754 Ga0207669_100067544 252
155 3300026118 Ga0207675_100838903 Ga0207675_1008389031 252
156 3300032004 Ga0307414_10115970 Ga0307414_101159703 252
157 3300032126 Ga0307415_100638158 Ga0307415_1006381582 252
158 3300039062 Ga0400483_125933 Ga0400483_125933_336_1112 252
159 3300047319 Ga0495674_0210840 Ga0495674_0210840_137_895 252
160 3300050508 nmdc:mga09592_15299_c1 nmdc:mga09592_15299_c1_3758_4516 252
161 3300050509 nmdc:mga0qj67_12060_c1 nmdc:mga0qj67_12060_c1_3064_3822 252
162 3300050510 nmdc:mga06r32_111197_c1 nmdc:mga06r32_111197_c1_1251_2009 252
163 3300053156 Ga0500622_0025951 Ga0500622_0025951_492_1250 252
164 3300005331 Ga0070670_100061190 Ga0070670_1000611904 253
165 3300005338 Ga0068868_100026388 Ga0068868_1000263883 253
166 3300005355 Ga0070671_100127289 Ga0070671_1001272892 253
167 3300005364 Ga0070673_100036386 Ga0070673_1000363862 253
168 3300005367 Ga0070667_100012217 Ga0070667_1000122177 253
169 3300005466 Ga0070685_10043537 Ga0070685_100435372 253
170 3300005539 Ga0068853_100245988 Ga0068853_1002459882 253
171 3300005578 Ga0068854_100231691 Ga0068854_1002316912 253
172 3300005617 Ga0068859_100008734 Ga0068859_1000087342 253
173 3300005842 Ga0068858_100329389 Ga0068858_1003293892 253
174 3300005843 Ga0068860_100004245 Ga0068860_1000042453 253
175 3300006358 Ga0068871_100158429 Ga0068871_1001584292 253
176 3300006931 Ga0097620_100008734 Ga0097620_1000087342 253
177 3300013104 Ga0157370_10050784 Ga0157370_100507843 253
178 3300013296 Ga0157374_10037486 Ga0157374_100374862 253
179 3300013297 Ga0157378_10006512 Ga0157378_100065128 253
180 3300014968 Ga0157379_10404199 Ga0157379_104041992 253
181 3300025321 Ga0207656_10009820 Ga0207656_100098203 253
182 3300025925 Ga0207650_10362595 Ga0207650_103625952 253
183 3300025931 Ga0207644_10591946 Ga0207644_105919461 253
184 3300025960 Ga0207651_10111512 Ga0207651_101115122 253
185 3300025981 Ga0207640_10189241 Ga0207640_101892412 253
186 3300025986 Ga0207658_10105395 Ga0207658_101053952 253
187 3300026023 Ga0207677_10013744 Ga0207677_100137441 253
188 3300026041 Ga0207639_10203834 Ga0207639_102038342 253
189 3300026088 Ga0207641_10416095 Ga0207641_104160952 253
190 3300026095 Ga0207676_10027416 Ga0207676_100274162 253
191 3300028381 Ga0268264_10003313 Ga0268264_1000331311 253
192 3300028794 Ga0307515_10000002 Ga0307515_1000000245 253
193 3300053156 Ga0500622_0000027 Ga0500622_0000027_164627_165388 253
194 3300005327 Ga0070658_10217247 Ga0070658_102172472 254
195 3300005334 Ga0068869_100010260 Ga0068869_1000102603 254
196 3300005335 Ga0070666_10000128 Ga0070666_1000012818 254
197 3300005338 Ga0068868_100347537 Ga0068868_1003475372 254
198 3300005340 Ga0070689_100105475 Ga0070689_1001054752 254
199 3300005347 Ga0070668_100372818 Ga0070668_1003728182 254
200 3300005355 Ga0070671_100035380 Ga0070671_1000353803 254
201 3300005367 Ga0070667_100107888 Ga0070667_1001078882 254
202 3300005459 Ga0068867_100398623 Ga0068867_1003986233 254
203 3300005539 Ga0068853_100006370 Ga0068853_1000063709 254
204 3300005543 Ga0070672_100041657 Ga0070672_1000416574 254
205 3300005616 Ga0068852_100098593 Ga0068852_1000985933 254
206 3300005617 Ga0068859_100000018 Ga0068859_100000018100 254
207 3300005617 Ga0068859_100009972 Ga0068859_1000099723 254
208 3300005618 Ga0068864_100036693 Ga0068864_1000366934 254
209 3300005841 Ga0068863_100009850 Ga0068863_1000098507 254
210 3300005842 Ga0068858_100007306 Ga0068858_1000073067 254
211 3300005843 Ga0068860_100006290 Ga0068860_1000062909 254
212 3300006163 Ga0070715_10141145 Ga0070715_101411451 254
213 3300006237 Ga0097621_100058281 Ga0097621_1000582812 254
214 3300006358 Ga0068871_100048066 Ga0068871_1000480663 254
215 3300006931 Ga0097620_100000018 Ga0097620_100000018100 254
216 3300006931 Ga0097620_100009972 Ga0097620_1000099723 254
217 3300009098 Ga0105245_10378176 Ga0105245_103781762 254
218 3300009101 Ga0105247_10005662 Ga0105247_100056627 254
219 3300009174 Ga0105241_10000510 Ga0105241_1000051031 254
220 3300009176 Ga0105242_10029987 Ga0105242_100299871 254
221 3300009177 Ga0105248_10289976 Ga0105248_102899762 254
222 3300009545 Ga0105237_10001030 Ga0105237_1000103029 254
223 3300009553 Ga0105249_10002177 Ga0105249_1000217710 254
224 3300011119 Ga0105246_10320994 Ga0105246_103209942 254
225 3300011119 Ga0105246_10324567 Ga0105246_103245672 254
226 3300013105 Ga0157369_10256794 Ga0157369_102567942 254
227 3300013306 Ga0163162_10000599 Ga0163162_1000059929 254
228 3300014326 Ga0157380_10000001 Ga0157380_10000001138 254
229 3300014968 Ga0157379_10021139 Ga0157379_100211392 254
230 3300025903 Ga0207680_10000212 Ga0207680_1000021218 254
231 3300025904 Ga0207647_10037414 Ga0207647_100374143 254
232 3300025911 Ga0207654_10028816 Ga0207654_100288163 254
233 3300025914 Ga0207671_10001806 Ga0207671_100018062 254
234 3300025927 Ga0207687_10279968 Ga0207687_102799682 254
235 3300025931 Ga0207644_10348755 Ga0207644_103487552 254
236 3300025940 Ga0207691_10056774 Ga0207691_100567744 254
237 3300025942 Ga0207689_10000602 Ga0207689_1000060231 254
238 3300025961 Ga0207712_10100762 Ga0207712_101007622 254
239 3300025972 Ga0207668_10130425 Ga0207668_101304252 254
240 3300025972 Ga0207668_10185453 Ga0207668_101854532 254
241 3300025986 Ga0207658_10045811 Ga0207658_100458112 254
242 3300025986 Ga0207658_10270383 Ga0207658_102703832 254
243 3300026035 Ga0207703_10013400 Ga0207703_100134004 254
244 3300026041 Ga0207639_10175064 Ga0207639_101750642 254
245 3300026041 Ga0207639_10216429 Ga0207639_102164292 254
246 3300026088 Ga0207641_10000015 Ga0207641_100000157 254
247 3300026089 Ga0207648_10143039 Ga0207648_101430392 254
248 3300026095 Ga0207676_10013364 Ga0207676_100133643 254
249 3300028381 Ga0268264_10000844 Ga0268264_100008441 254
250 3300031852 Ga0307410_10150458 Ga0307410_101504581 254
251 3300044673 Ga0453683_0266268 Ga0453683_0266268_150_914 254
252 3300044712 Ga0453684_0004162 Ga0453684_0004162_21323_22087 254
253 3300044712 Ga0453684_0017614 Ga0453684_0017614_10085_10849 254
254 3300044712 Ga0453684_0272142 Ga0453684_0272142_924_1688 254
255 3300044712 Ga0453684_0456405 Ga0453684_0456405_419_1183 254
256 3300046558 Ga0495633_0023467 Ga0495633_0023467_1711_2475 254
257 3300048907 Ga0496104_0358831 Ga0496104_0358831_491_1255 254
258 3300003794 Ga0055531_10000014 Ga0055531_10000014158 255
259 3300005327 Ga0070658_10313298 Ga0070658_103132983 255
260 3300005539 Ga0068853_100032723 Ga0068853_1000327233 255
261 3300013296 Ga0157374_10153052 Ga0157374_101530523 255
262 3300013307 Ga0157372_10045522 Ga0157372_100455224 255
263 3300013307 Ga0157372_10111773 Ga0157372_101117732 255
264 3300013307 Ga0157372_10243005 Ga0157372_102430052 255
265 3300025304 Ga0209257_1000004 Ga0209257_1000004501 255
266 3300026041 Ga0207639_10023289 Ga0207639_100232892 255
267 3300039437 Ga0436365_0490833 Ga0436365_0490833_719_1492 255
268 3300041411 Ga0439466_0018090 Ga0439466_0018090_955_1722 255
269 3300042002 Ga0439442_039755 Ga0439442_039755_49_816 255
270 3300042006 Ga0439432_106807 Ga0439432_106807_35_802 255
271 3300042007 Ga0439449_0019105 Ga0439449_0019105_1253_2020 255
272 3300042133 Ga0450896_011649 Ga0450896_011649_344_1111 255
273 3300042134 Ga0450898_000781 Ga0450898_000781_476_1243 255
274 3300042135 Ga0450899_006192 Ga0450899_006192_374_1141 255
275 3300053125 Ga0500618_009867 Ga0500618_009867_1481_2260 256
276 3300005327 Ga0070658_10191781 Ga0070658_101917812 257
277 3300005333 Ga0070677_10145976 Ga0070677_101459761 257
278 3300005337 Ga0070682_100092669 Ga0070682_1000926692 257
279 3300005344 Ga0070661_100495422 Ga0070661_1004954222 257
280 3300005356 Ga0070674_100258080 Ga0070674_1002580802 257
281 3300005456 Ga0070678_100057478 Ga0070678_1000574783 257
282 3300005530 Ga0070679_100000801 Ga0070679_10000080110 257
283 3300005539 Ga0068853_100380394 Ga0068853_1003803942 257
284 3300005563 Ga0068855_100152800 Ga0068855_1001528002 257
285 3300005616 Ga0068852_100011437 Ga0068852_1000114375 257
286 3300013100 Ga0157373_10121023 Ga0157373_101210232 257
287 3300013102 Ga0157371_10450027 Ga0157371_104500272 257
288 3300013104 Ga0157370_10106603 Ga0157370_101066033 257
289 3300013105 Ga0157369_10011029 Ga0157369_100110296 257
290 3300013307 Ga0157372_10084966 Ga0157372_100849662 257
291 3300014326 Ga0157380_10000834 Ga0157380_1000083417 257
292 3300014326 Ga0157380_10085974 Ga0157380_100859741 257
293 3300017792 Ga0163161_10237375 Ga0163161_102373752 257
294 3300025909 Ga0207705_10027667 Ga0207705_100276675 257
295 3300025919 Ga0207657_10043877 Ga0207657_100438774 257
296 3300025921 Ga0207652_10003129 Ga0207652_100031292 257
297 3300025921 Ga0207652_10046078 Ga0207652_100460781 257
298 3300025949 Ga0207667_10174973 Ga0207667_101749732 257
299 3300026041 Ga0207639_10345398 Ga0207639_103453981 257
300 3300026089 Ga0207648_10637603 Ga0207648_106376031 257
301 3300049569 Ga0501032_0030540 Ga0501032_0030540_2841_3614 257
302 3300049570 Ga0501033_0098707 Ga0501033_0098707_83_856 257
303 3300049571 Ga0501034_0012984 Ga0501034_0012984_220_993 257
304 3300049580 Ga0501046_0306513 Ga0501046_0306513_83_856 257
305 3300049581 Ga0501047_0004399 Ga0501047_0004399_12088_12861 257
306 3300049586 Ga0501070_0037864 Ga0501070_0037864_1828_2601 257
307 3300049822 Ga0501035_0059444 Ga0501035_0059444_2272_3045 257
308 3300049823 Ga0501044_0056431 Ga0501044_0056431_816_1589 257
309 3300005543 Ga0070672_100158252 Ga0070672_1001582523 258
310 3300005617 Ga0068859_101145162 Ga0068859_1011451621 258
311 3300005834 Ga0068851_10000042 Ga0068851_1000004283 258
312 3300006931 Ga0097620_101145132 Ga0097620_1011451321 258
313 3300009176 Ga0105242_10366234 Ga0105242_103662341 258
314 3300009176 Ga0105242_10425150 Ga0105242_104251502 258
315 3300013307 Ga0157372_10018407 Ga0157372_100184073 258
316 3300013308 Ga0157375_10166064 Ga0157375_101660644 258
317 3300014326 Ga0157380_10001919 Ga0157380_100019193 258
318 3300025321 Ga0207656_10000176 Ga0207656_100001764 258
319 3300041494 Ga0451837_1466621 Ga0451837_1466621_127_903 258
320 3300042876 Ga0451577_0036540 Ga0451577_0036540_2495_3289 258
321 3300005335 Ga0070666_10085518 Ga0070666_100855182 259
322 3300005355 Ga0070671_100003059 Ga0070671_1000030593 259
323 3300005367 Ga0070667_100020994 Ga0070667_1000209943 259
324 3300005459 Ga0068867_100067215 Ga0068867_1000672153 259
325 3300006237 Ga0097621_100000092 Ga0097621_10000009234 259
326 3300006358 Ga0068871_100000032 Ga0068871_10000003222 259
327 3300009545 Ga0105237_10628588 Ga0105237_106285882 259
328 3300009553 Ga0105249_10006808 Ga0105249_100068083 259
329 3300013297 Ga0157378_10028602 Ga0157378_100286022 259
330 3300013306 Ga0163162_10000431 Ga0163162_100004315 259
331 3300013306 Ga0163162_10006837 Ga0163162_100068379 259
332 3300013308 Ga0157375_10000067 Ga0157375_100000675 259
333 3300013308 Ga0157375_10011022 Ga0157375_100110222 259
334 3300014968 Ga0157379_10174458 Ga0157379_101744582 259
335 3300014969 Ga0157376_10000419 Ga0157376_100004199 259
336 3300014969 Ga0157376_10117890 Ga0157376_101178902 259
337 3300017792 Ga0163161_10000985 Ga0163161_100009857 259
338 3300017792 Ga0163161_10018828 Ga0163161_100188283 259
339 3300025903 Ga0207680_10196850 Ga0207680_101968502 259
340 3300025931 Ga0207644_10005771 Ga0207644_100057713 259
341 3300025986 Ga0207658_10041471 Ga0207658_100414712 259
342 3300026089 Ga0207648_10209499 Ga0207648_102094992 259
343 3300026089 Ga0207648_10467517 Ga0207648_104675172 259
344 3300028794 Ga0307515_10167445 Ga0307515_101674452 259
345 3300041512 Ga0451853_0718014 Ga0451853_0718014_400_1179 259
346 3300046460 Ga0495638_0123568 Ga0495638_0123568_228_1007 259
347 3300048903 Ga0496100_0020456 Ga0496100_0020456_1780_2559 259
348 3300048917 Ga0496114_0586815 Ga0496114_0586815_17_796 259
349 3300002459 JGI24751J29686_10000680 JGI24751J29686_100006805 260
350 3300003320 rootH2_10020850 rootH2_100208505 260
351 3300005328 Ga0070676_10140878 Ga0070676_101408782 260
352 3300005331 Ga0070670_100335363 Ga0070670_1003353631 260
353 3300005331 Ga0070670_100383047 Ga0070670_1003830472 260
354 3300005334 Ga0068869_100007409 Ga0068869_1000074095 260
355 3300005334 Ga0068869_100095040 Ga0068869_1000950402 260
356 3300005347 Ga0070668_100008569 Ga0070668_1000085692 260
357 3300005347 Ga0070668_100420794 Ga0070668_1004207942 260
358 3300005356 Ga0070674_100066502 Ga0070674_1000665021 260
359 3300005456 Ga0070678_100019622 Ga0070678_1000196222 260
360 3300005459 Ga0068867_100208390 Ga0068867_1002083902 260
361 3300005539 Ga0068853_100000663 Ga0068853_1000006633 260
362 3300005539 Ga0068853_100022130 Ga0068853_1000221305 260
363 3300005548 Ga0070665_100000052 Ga0070665_10000005295 260
364 3300005564 Ga0070664_100294154 Ga0070664_1002941542 260
365 3300005564 Ga0070664_100618604 Ga0070664_1006186042 260
366 3300005577 Ga0068857_100106574 Ga0068857_1001065742 260
367 3300005577 Ga0068857_100148479 Ga0068857_1001484791 260
368 3300005578 Ga0068854_100046067 Ga0068854_1000460672 260
369 3300005614 Ga0068856_100056565 Ga0068856_1000565654 260
370 3300005614 Ga0068856_100060619 Ga0068856_1000606194 260
371 3300005616 Ga0068852_100072849 Ga0068852_1000728492 260
372 3300005616 Ga0068852_100234648 Ga0068852_1002346482 260
373 3300005616 Ga0068852_100915367 Ga0068852_1009153672 260
374 3300005617 Ga0068859_100134059 Ga0068859_1001340593 260
375 3300005618 Ga0068864_100021049 Ga0068864_1000210494 260
376 3300005618 Ga0068864_100124758 Ga0068864_1001247581 260
377 3300005618 Ga0068864_100517205 Ga0068864_1005172052 260
378 3300005718 Ga0068866_10267092 Ga0068866_102670922 260
379 3300005719 Ga0068861_100001635 Ga0068861_1000016355 260
380 3300005834 Ga0068851_10082545 Ga0068851_100825451 260
381 3300005841 Ga0068863_100195622 Ga0068863_1001956222 260
382 3300005842 Ga0068858_100141235 Ga0068858_1001412352 260
383 3300005842 Ga0068858_100730353 Ga0068858_1007303531 260
384 3300005843 Ga0068860_100000004 Ga0068860_100000004349 260
385 3300005843 Ga0068860_100010471 Ga0068860_1000104712 260
386 3300005843 Ga0068860_100236331 Ga0068860_1002363312 260
387 3300005844 Ga0068862_100026272 Ga0068862_1000262722 260
388 3300005844 Ga0068862_100049775 Ga0068862_1000497753 260
389 3300006195 Ga0075366_10158564 Ga0075366_101585642 260
390 3300006237 Ga0097621_100106944 Ga0097621_1001069442 260
391 3300006237 Ga0097621_100293964 Ga0097621_1002939642 260
392 3300006881 Ga0068865_100186627 Ga0068865_1001866272 260
393 3300006931 Ga0097620_100134042 Ga0097620_1001340422 260
394 3300009093 Ga0105240_10000033 Ga0105240_1000003329 260
395 3300009093 Ga0105240_10000374 Ga0105240_1000037416 260
396 3300009093 Ga0105240_10000396 Ga0105240_1000039635 260
397 3300009093 Ga0105240_10003517 Ga0105240_1000351710 260
398 3300009093 Ga0105240_10015563 Ga0105240_100155635 260
399 3300009093 Ga0105240_10042289 Ga0105240_100422892 260
400 3300009093 Ga0105240_10047595 Ga0105240_100475952 260
401 3300009093 Ga0105240_10962558 Ga0105240_109625581 260
402 3300009148 Ga0105243_10345547 Ga0105243_103455472 260
403 3300009174 Ga0105241_10003108 Ga0105241_100031084 260
404 3300009174 Ga0105241_10078734 Ga0105241_100787341 260
405 3300009174 Ga0105241_10193417 Ga0105241_101934171 260
406 3300009176 Ga0105242_10022712 Ga0105242_100227123 260
407 3300009176 Ga0105242_10108496 Ga0105242_101084962 260
408 3300009545 Ga0105237_10001747 Ga0105237_1000174718 260
409 3300009545 Ga0105237_10013007 Ga0105237_100130076 260
410 3300009545 Ga0105237_10115949 Ga0105237_101159493 260
411 3300009551 Ga0105238_10011503 Ga0105238_100115033 260
412 3300009551 Ga0105238_10014421 Ga0105238_100144212 260
413 3300009551 Ga0105238_10296899 Ga0105238_102968992 260
414 3300009553 Ga0105249_10002773 Ga0105249_1000277313 260
415 3300009553 Ga0105249_10065334 Ga0105249_100653342 260
416 3300010375 Ga0105239_10002949 Ga0105239_100029496 260
417 3300010375 Ga0105239_10004634 Ga0105239_100046342 260
418 3300010375 Ga0105239_10032974 Ga0105239_100329742 260
419 3300010375 Ga0105239_10050966 Ga0105239_100509664 260
420 3300013104 Ga0157370_10051081 Ga0157370_100510812 260
421 3300013105 Ga0157369_10060735 Ga0157369_100607352 260
422 3300013105 Ga0157369_10267972 Ga0157369_102679722 260
423 3300013306 Ga0163162_10001193 Ga0163162_1000119314 260
424 3300013306 Ga0163162_10384416 Ga0163162_103844162 260
425 3300013307 Ga0157372_10005222 Ga0157372_100052227 260
426 3300013307 Ga0157372_10196061 Ga0157372_101960613 260
427 3300014325 Ga0163163_10009878 Ga0163163_100098784 260
428 3300025321 Ga0207656_10181375 Ga0207656_101813752 260
429 3300025899 Ga0207642_10146813 Ga0207642_101468132 260
430 3300025904 Ga0207647_10038314 Ga0207647_100383142 260
431 3300025907 Ga0207645_10017936 Ga0207645_100179364 260
432 3300025911 Ga0207654_10002807 Ga0207654_100028076 260
433 3300025913 Ga0207695_10000023 Ga0207695_10000023334 260
434 3300025913 Ga0207695_10000031 Ga0207695_10000031232 260
435 3300025913 Ga0207695_10001413 Ga0207695_1000141331 260
436 3300025913 Ga0207695_10015197 Ga0207695_100151973 260
437 3300025913 Ga0207695_10072148 Ga0207695_100721482 260
438 3300025913 Ga0207695_10075832 Ga0207695_100758322 260
439 3300025913 Ga0207695_10100183 Ga0207695_101001832 260
440 3300025913 Ga0207695_10767519 Ga0207695_107675191 260
441 3300025914 Ga0207671_10007426 Ga0207671_100074267 260
442 3300025914 Ga0207671_10008400 Ga0207671_100084005 260
443 3300025914 Ga0207671_10378910 Ga0207671_103789101 260
444 3300025924 Ga0207694_10043079 Ga0207694_100430792 260
445 3300025924 Ga0207694_10265588 Ga0207694_102655882 260
446 3300025925 Ga0207650_10103001 Ga0207650_101030013 260
447 3300025934 Ga0207686_10044276 Ga0207686_100442763 260
448 3300025935 Ga0207709_10303967 Ga0207709_103039671 260
449 3300025937 Ga0207669_10236484 Ga0207669_102364842 260
450 3300025940 Ga0207691_10211948 Ga0207691_102119481 260
451 3300025942 Ga0207689_10000885 Ga0207689_1000088512 260
452 3300025945 Ga0207679_10286327 Ga0207679_102863271 260
453 3300025949 Ga0207667_10005101 Ga0207667_1000510114 260
454 3300025949 Ga0207667_10124459 Ga0207667_101244592 260
455 3300025961 Ga0207712_10007860 Ga0207712_100078602 260
456 3300025961 Ga0207712_10182084 Ga0207712_101820842 260
457 3300025961 Ga0207712_10222414 Ga0207712_102224142 260
458 3300025981 Ga0207640_10013742 Ga0207640_100137423 260
459 3300026041 Ga0207639_10008759 Ga0207639_100087597 260
460 3300026041 Ga0207639_10033930 Ga0207639_100339302 260
461 3300026078 Ga0207702_10102901 Ga0207702_101029012 260
462 3300026078 Ga0207702_10210832 Ga0207702_102108322 260
463 3300026089 Ga0207648_10003423 Ga0207648_100034233 260
464 3300026089 Ga0207648_10306544 Ga0207648_103065442 260
465 3300026095 Ga0207676_10024634 Ga0207676_100246342 260
466 3300026095 Ga0207676_10174681 Ga0207676_101746812 260
467 3300026116 Ga0207674_10050171 Ga0207674_100501713 260
468 3300026118 Ga0207675_100013061 Ga0207675_1000130617 260
469 3300026121 Ga0207683_10020838 Ga0207683_100208382 260
470 3300028379 Ga0268266_10000070 Ga0268266_1000007086 260
471 3300028380 Ga0268265_10085404 Ga0268265_100854042 260
472 3300028380 Ga0268265_10621491 Ga0268265_106214912 260
473 3300028381 Ga0268264_10000011 Ga0268264_1000001117 260
474 3300028381 Ga0268264_10007072 Ga0268264_100070722 260
475 3300028381 Ga0268264_10409882 Ga0268264_104098822 260
476 3300032002 Ga0307416_101274209 Ga0307416_1012742091 260
477 3300042001 Ga0439441_033196 Ga0439441_033196_16_801 260
478 3300044658 Ga0466972_0003222 Ga0466972_0003222_2505_3287 260
479 3300044706 Ga0466964_0029724 Ga0466964_0029724_1354_2136 260
480 3300044735 Ga0466968_0010520 Ga0466968_0010520_2573_3355 260
481 3300044765 Ga0466970_0045295 Ga0466970_0045295_1088_1870 260
482 3300046524 Ga0495648_0003586 Ga0495648_0003586_10370_11152 260
483 3300046524 Ga0495648_0151969 Ga0495648_0151969_349_1131 260
484 3300046648 Ga0495611_0000209 Ga0495611_0000209_7958_8740 260
485 3300046648 Ga0495611_0069221 Ga0495611_0069221_529_1314 260
486 3300047443 Ga0495687_000006 Ga0495687_000006_248963_249745 260
487 3300049571 Ga0501034_0213289 Ga0501034_0213289_734_1516 260
488 3300049823 Ga0501044_0582120 Ga0501044_0582120_50_832 260
489 3300053092 Ga0500583_0001979 Ga0500583_0001979_650_1432 260
490 3300053092 Ga0500583_0102183 Ga0500583_0102183_352_1134 260
491 3300053139 Ga0500568_0000880 Ga0500568_0000880_15299_16081 260
492 3300053139 Ga0500568_0123895 Ga0500568_0123895_46_828 260
493 3300053156 Ga0500622_0015119 Ga0500622_0015119_2073_2855 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04397

LytTR

LytTr DNA-binding domain

175

275

0.97

PF00072

Response_reg

Response regulator receiver domain

19

128

0.9

Feature Viewer

pLDDT pTM Quality
86.55 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map