F454285

General Info

Members Datasets Scaffolds Average Seq Length
492 184 984 127

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100320713|Ga0307408_1003207132
Length 132
Sequence MPRYAGGMNSLPPYARLLRLRTEQQGDALRFVMPFHEDVVGRPGFLHGGAIAGLLEFAAFTALSRAIGDDTVKKPITVTVDYMRGGTPRDTFAEAQIERLGKRMANVEAYAWQSDRDRPIAAARINFLLDRQ

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
121 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
139 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
140 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
141 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
144 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
145 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
148 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
164 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
165 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
166 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
167 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
168 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
169 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
170 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
171 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
172 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
173 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
174 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
175 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
176 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
177 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
178 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
179 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
180 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 2.24
Rhizosphere 97.15
Stem 0
Stem Tuber 0
Unclassified 5.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100320713 3300031548 Bacteria 1305
2 JGI24746J21847_1003330 3300001977 Bacteria 2526
3 JGI24034J26672_10014286 3300002239 Bacteria 1210
4 rootH1_10190015 3300003323 Bacteria 1116
5 Ga0065704_10259470 3300005289 Bacteria 957
6 Ga0065712_10268531 3300005290 Bacteria 921
7 Ga0065715_10089189 3300005293 Bacteria 12880
8 Ga0065715_10095029 3300005293 Bacteria 4152
9 Ga0065707_10129470 3300005295 Bacteria 1947
10 Ga0065707_10387289 3300005295 Bacteria 858
11 Ga0070658_10003042 3300005327 Bacteria 13873
12 Ga0070658_11176406 3300005327 Unclassified 667
13 Ga0070676_10007382 3300005328 Bacteria 5898
14 Ga0070676_10300065 3300005328 Bacteria 1089
15 Ga0070690_100695117 3300005330 Bacteria 780
16 Ga0070690_101173308 3300005330 Bacteria 611
17 Ga0070670_100008951 3300005331 Bacteria 8552
18 Ga0070670_100019012 3300005331 Bacteria 5892
19 Ga0070670_100036183 3300005331 Bacteria 4249
20 Ga0070670_100676344 3300005331 Bacteria 927
21 Ga0070670_100695032 3300005331 Bacteria 914
22 Ga0070670_100994043 3300005331 Bacteria 763
23 Ga0070677_10000930 3300005333 Bacteria 9562
24 Ga0070677_10001640 3300005333 Bacteria 7082
25 Ga0070666_10295447 3300005335 Bacteria 1153
26 Ga0070680_100798654 3300005336 Bacteria 813
27 Ga0070680_100816338 3300005336 Bacteria 804
28 Ga0070660_100000852 3300005339 Bacteria 20293
29 Ga0070660_100007755 3300005339 Bacteria 7486
30 Ga0070660_100029533 3300005339 Bacteria 4109
31 Ga0070660_100498689 3300005339 Bacteria 1013
32 Ga0070660_100654913 3300005339 Bacteria 880
33 Ga0070661_100598719 3300005344 Bacteria 891
34 Ga0070692_10005532 3300005345 Bacteria 5399
35 Ga0070692_10128994 3300005345 Bacteria 1419
36 Ga0070668_100001451 3300005347 Bacteria 17116
37 Ga0070668_100049401 3300005347 Bacteria 3237
38 Ga0070668_100199154 3300005347 Bacteria 1643
39 Ga0070668_100710824 3300005347 Bacteria 887
40 Ga0070668_100775530 3300005347 Bacteria 850
41 Ga0070669_100001035 3300005353 Bacteria 20294
42 Ga0070669_100073032 3300005353 Bacteria 2541
43 Ga0070669_100091828 3300005353 Bacteria 2278
44 Ga0070669_101711170 3300005353 Unclassified 548
45 Ga0070675_100002714 3300005354 Bacteria 13302
46 Ga0070675_100002842 3300005354 Bacteria 13052
47 Ga0070675_100032854 3300005354 Bacteria 4201
48 Ga0070675_100252756 3300005354 Bacteria 1543
49 Ga0070675_101147516 3300005354 Bacteria 715
50 Ga0070671_100004167 3300005355 Bacteria 11428
51 Ga0070671_100322010 3300005355 Bacteria 1317
52 Ga0070674_100000894 3300005356 Bacteria 15570
53 Ga0070673_100018430 3300005364 Bacteria 4985
54 Ga0070673_100377882 3300005364 Bacteria 1263
55 Ga0070673_100382014 3300005364 Bacteria 1256
56 Ga0070673_100756302 3300005364 Bacteria 895
57 Ga0070659_100113013 3300005366 Bacteria 2193
58 Ga0070659_100382858 3300005366 Bacteria 1185
59 Ga0070659_100778898 3300005366 Bacteria 831
60 Ga0070659_101281817 3300005366 Bacteria 649
61 Ga0070667_101875903 3300005367 Unclassified 564
62 Ga0070701_10184357 3300005438 Bacteria 1224
63 Ga0070663_100145390 3300005455 Bacteria 1814
64 Ga0070663_100228087 3300005455 Bacteria 1465
65 Ga0070663_100677269 3300005455 Unclassified 875
66 Ga0070678_100003324 3300005456 Bacteria 8949
67 Ga0070678_100061156 3300005456 Bacteria 2775
68 Ga0070662_100001948 3300005457 Bacteria 12690
69 Ga0070662_100012431 3300005457 Bacteria 5647
70 Ga0070662_100070567 3300005457 Bacteria 2574
71 Ga0070662_100138801 3300005457 Bacteria 1882
72 Ga0070662_100640925 3300005457 Bacteria 896
73 Ga0070681_10210811 3300005458 Bacteria 1859
74 Ga0070681_10274097 3300005458 Bacteria 1598
75 Ga0068867_100014795 3300005459 Bacteria 5532
76 Ga0068867_100690317 3300005459 Bacteria 900
77 Ga0070685_10878011 3300005466 Bacteria 666
78 Ga0070679_100820964 3300005530 Bacteria 873
79 Ga0070679_100830059 3300005530 Bacteria 867
80 Ga0068853_100103919 3300005539 Bacteria 2515
81 Ga0068853_100278377 3300005539 Bacteria 1542
82 Ga0068853_100349318 3300005539 Bacteria 1375
83 Ga0070672_100001437 3300005543 Bacteria 14726
84 Ga0070672_100019600 3300005543 Bacteria 4913
85 Ga0070672_100381284 3300005543 Bacteria 1206
86 Ga0070665_100077673 3300005548 Bacteria 3326
87 Ga0070665_100230956 3300005548 Bacteria 1850
88 Ga0068855_100000860 3300005563 Bacteria 37683
89 Ga0068855_101704060 3300005563 Unclassified 643
90 Ga0070664_100003661 3300005564 Bacteria 12375
91 Ga0070664_100186199 3300005564 Bacteria 1848
92 Ga0070664_100725785 3300005564 Bacteria 927
93 Ga0068857_100165612 3300005577 Bacteria 2007
94 Ga0068857_100531300 3300005577 Bacteria 1106
95 Ga0068857_101460043 3300005577 Bacteria 666
96 Ga0068854_100192956 3300005578 Bacteria 1597
97 Ga0068852_100264063 3300005616 Bacteria 1654
98 Ga0068859_100004379 3300005617 Bacteria 14402
99 Ga0068859_101770212 3300005617 Unclassified 682
100 Ga0068864_100050923 3300005618 Bacteria 3566
101 Ga0068864_100378451 3300005618 Bacteria 1341
102 Ga0068864_100599005 3300005618 Bacteria 1069
103 Ga0068866_10225066 3300005718 Bacteria 1134
104 Ga0068866_11123058 3300005718 Bacteria 564
105 Ga0068861_100011177 3300005719 Bacteria 6234
106 Ga0068870_10070475 3300005840 Bacteria 1905
107 Ga0068863_100973392 3300005841 Bacteria 851
108 Ga0068858_100676147 3300005842 Bacteria 1004
109 Ga0068860_100061074 3300005843 Bacteria 3580
110 Ga0068860_100204830 3300005843 Bacteria 1913
111 Ga0068862_100003135 3300005844 Bacteria 14380
112 Ga0068862_100033237 3300005844 Bacteria 4359
113 Ga0068862_100450780 3300005844 Bacteria 1213
114 Ga0075432_10041128 3300006058 Bacteria 1614
115 Ga0097621_100250333 3300006237 Bacteria 1551
116 Ga0075428_100754184 3300006844 Bacteria 1035
117 Ga0075431_100004274 3300006847 Bacteria 13987
118 Ga0075433_10371092 3300006852 Bacteria 1264
119 Ga0075429_100727833 3300006880 Bacteria 869
120 Ga0068865_100155639 3300006881 Bacteria 1738
121 Ga0097620_100004379 3300006931 Bacteria 14402
122 Ga0097620_101769944 3300006931 Unclassified 682
123 Ga0111539_10065335 3300009094 Bacteria 4299
124 Ga0111539_10338944 3300009094 Bacteria 1750
125 Ga0111539_11047164 3300009094 Bacteria 948
126 Ga0105243_11079243 3300009148 Bacteria 810
127 Ga0105248_10149034 3300009177 Bacteria 2640
128 Ga0105249_10048668 3300009553 Bacteria 3864
129 Ga0105249_10250807 3300009553 Bacteria 1755
130 Ga0105249_12300424 3300009553 Bacteria 612
131 Ga0157373_10752941 3300013100 Bacteria 716
132 Ga0157373_10857992 3300013100 Bacteria 672
133 Ga0157371_10023407 3300013102 Bacteria 4517
134 Ga0157371_10033303 3300013102 Bacteria 3702
135 Ga0157371_10056382 3300013102 Bacteria 2787
136 Ga0157371_10193369 3300013102 Bacteria 1457
137 Ga0157370_10133214 3300013104 Bacteria 2318
138 Ga0157370_11079187 3300013104 Bacteria 726
139 Ga0163162_10490296 3300013306 Bacteria 1360
140 Ga0157375_10007958 3300013308 Bacteria 9280
141 Ga0163163_10214042 3300014325 Bacteria 1976
142 Ga0163163_10835855 3300014325 Bacteria 984
143 Ga0157380_10001698 3300014326 Bacteria 14541
144 Ga0157380_10003692 3300014326 Bacteria 10532
145 Ga0157380_10053350 3300014326 Bacteria 3205
146 Ga0157380_10094605 3300014326 Bacteria 2473
147 Ga0157380_11329517 3300014326 Bacteria 767
148 Ga0157377_10608256 3300014745 Bacteria 781
149 Ga0163161_10017518 3300017792 Bacteria 5013
150 Ga0163161_10741450 3300017792 Bacteria 821
151 Ga0207666_1010754 3300025271 Bacteria 1257
152 Ga0207697_10000985 3300025315 Bacteria 15936
153 Ga0207697_10009622 3300025315 Bacteria 4165
154 Ga0207697_10018252 3300025315 Bacteria 2878
155 Ga0207697_10070181 3300025315 Bacteria 1467
156 Ga0207682_10000857 3300025893 Bacteria 14109
157 Ga0207682_10001191 3300025893 Bacteria 12044
158 Ga0207642_10760075 3300025899 Bacteria 614
159 Ga0207688_10072077 3300025901 Bacteria 1962
160 Ga0207688_10303684 3300025901 Bacteria 976
161 Ga0207645_10011981 3300025907 Bacteria 5898
162 Ga0207645_10510120 3300025907 Bacteria 815
163 Ga0207645_10784814 3300025907 Unclassified 648
164 Ga0207643_10338754 3300025908 Bacteria 942
165 Ga0207705_10000648 3300025909 Bacteria 28951
166 Ga0207705_10001745 3300025909 Bacteria 17203
167 Ga0207705_10367653 3300025909 Bacteria 1110
168 Ga0207705_10994968 3300025909 Unclassified 648
169 Ga0207654_11141625 3300025911 Bacteria 568
170 Ga0207707_10061774 3300025912 Bacteria 3260
171 Ga0207707_10324691 3300025912 Bacteria 1328
172 Ga0207660_11065050 3300025917 Unclassified 659
173 Ga0207657_10001247 3300025919 Bacteria 27200
174 Ga0207657_10001696 3300025919 Bacteria 23760
175 Ga0207657_10141024 3300025919 Bacteria 1969
176 Ga0207657_10339132 3300025919 Bacteria 1186
177 Ga0207657_10383281 3300025919 Bacteria 1107
178 Ga0207657_11256933 3300025919 Bacteria 561
179 Ga0207649_10477927 3300025920 Bacteria 945
180 Ga0207652_10823465 3300025921 Bacteria 823
181 Ga0207652_10853852 3300025921 Bacteria 806
182 Ga0207681_10001808 3300025923 Bacteria 13726
183 Ga0207681_10023028 3300025923 Bacteria 3978
184 Ga0207681_10310576 3300025923 Bacteria 1250
185 Ga0207650_10014719 3300025925 Bacteria 5437
186 Ga0207650_10090408 3300025925 Bacteria 2338
187 Ga0207650_10108169 3300025925 Bacteria 2149
188 Ga0207650_10629615 3300025925 Bacteria 903
189 Ga0207659_10003143 3300025926 Bacteria 9870
190 Ga0207659_10122112 3300025926 Bacteria 1997
191 Ga0207659_10195627 3300025926 Bacteria 1611
192 Ga0207644_10114064 3300025931 Bacteria 2047
193 Ga0207644_10367372 3300025931 Bacteria 1171
194 Ga0207690_10074057 3300025932 Bacteria 2358
195 Ga0207690_10163158 3300025932 Bacteria 1663
196 Ga0207690_10353120 3300025932 Bacteria 1163
197 Ga0207690_11139370 3300025932 Bacteria 651
198 Ga0207690_11590979 3300025932 Unclassified 546
199 Ga0207706_10000284 3300025933 Bacteria 55240
200 Ga0207706_10044034 3300025933 Bacteria 3955
201 Ga0207706_10171181 3300025933 Bacteria 1908
202 Ga0207706_11482473 3300025933 Bacteria 554
203 Ga0207709_10097849 3300025935 Bacteria 1933
204 Ga0207669_10005555 3300025937 Bacteria 5670
205 Ga0207669_10785771 3300025937 Bacteria 788
206 Ga0207704_10689029 3300025938 Unclassified 845
207 Ga0207704_11057308 3300025938 Bacteria 688
208 Ga0207691_10001690 3300025940 Bacteria 21784
209 Ga0207691_10044262 3300025940 Bacteria 4098
210 Ga0207691_10117949 3300025940 Bacteria 2354
211 Ga0207711_10568828 3300025941 Bacteria 1057
212 Ga0207711_10701542 3300025941 Bacteria 944
213 Ga0207679_10006008 3300025945 Bacteria 7638
214 Ga0207679_10082011 3300025945 Bacteria 2468
215 Ga0207679_10736852 3300025945 Bacteria 896
216 Ga0207667_10010703 3300025949 Bacteria 10703
217 Ga0207667_10186565 3300025949 Bacteria 2129
218 Ga0207651_10040267 3300025960 Bacteria 3089
219 Ga0207651_10232660 3300025960 Bacteria 1497
220 Ga0207712_10412177 3300025961 Bacteria 1138
221 Ga0207668_10005040 3300025972 Bacteria 7773
222 Ga0207668_10568511 3300025972 Bacteria 984
223 Ga0207668_10955490 3300025972 Bacteria 764
224 Ga0207668_11924946 3300025972 Bacteria 533
225 Ga0207640_10028574 3300025981 Bacteria 3411
226 Ga0207658_11695478 3300025986 Unclassified 577
227 Ga0207677_10402594 3300026023 Bacteria 1161
228 Ga0207639_10167947 3300026041 Bacteria 1855
229 Ga0207639_10246266 3300026041 Bacteria 1557
230 Ga0207678_10171828 3300026067 Bacteria 1850
231 Ga0207678_10203681 3300026067 Bacteria 1692
232 Ga0207648_10003838 3300026089 Bacteria 15698
233 Ga0207648_11810337 3300026089 Bacteria 572
234 Ga0207676_10046933 3300026095 Bacteria 3345
235 Ga0207676_10285909 3300026095 Bacteria 1499
236 Ga0207676_11629594 3300026095 Bacteria 643
237 Ga0207674_10049004 3300026116 Bacteria 4322
238 Ga0207674_10396843 3300026116 Bacteria 1333
239 Ga0207674_10706814 3300026116 Bacteria 973
240 Ga0207675_100013354 3300026118 Bacteria 7663
241 Ga0207675_100582457 3300026118 Bacteria 1120
242 Ga0207683_10011685 3300026121 Bacteria 7496
243 Ga0207683_10236171 3300026121 Bacteria 1667
244 Ga0209970_1013994 3300027614 Bacteria 1331
245 Ga0209983_1016172 3300027665 Bacteria 1539
246 Ga0209974_10043567 3300027876 Bacteria 1496
247 Ga0209974_10060068 3300027876 Bacteria 1286
248 Ga0207428_10497067 3300027907 Bacteria 886
249 Ga0268266_10735920 3300028379 Bacteria 951
250 Ga0268265_10001996 3300028380 Bacteria 16124
251 Ga0268265_10042666 3300028380 Bacteria 3367
252 Ga0268265_10360134 3300028380 Bacteria 1331
253 Ga0268264_11715943 3300028381 Bacteria 638
254 Ga0316183_1070220 3300030742 Bacteria 2098
255 Ga0316182_1079047 3300030745 Bacteria 1934
256 Ga0316182_1181019 3300030745 Bacteria 730
257 Ga0307408_100036802 3300031548 Bacteria 3442
258 Ga0307408_100103990 3300031548 Bacteria 2169
259 Ga0307408_100118755 3300031548 Bacteria 2045
260 Ga0307408_100254476 3300031548 Bacteria 1450
261 Ga0307408_100557747 3300031548 Bacteria 1012
262 Ga0307408_101902956 3300031548 Bacteria 570
263 Ga0307405_10023301 3300031731 Bacteria 3516
264 Ga0307405_10030813 3300031731 Bacteria 3149
265 Ga0307405_10053494 3300031731 Bacteria 2515
266 Ga0307405_10068564 3300031731 Bacteria 2270
267 Ga0307405_10136968 3300031731 Bacteria 1701
268 Ga0307405_10313336 3300031731 Bacteria 1195
269 Ga0307405_10350556 3300031731 Bacteria 1138
270 Ga0307405_10436116 3300031731 Bacteria 1035
271 Ga0307405_10546528 3300031731 Bacteria 936
272 Ga0307405_10644168 3300031731 Bacteria 870
273 Ga0307405_10668527 3300031731 Bacteria 856
274 Ga0307413_10000587 3300031824 Bacteria 12214
275 Ga0307413_10002432 3300031824 Bacteria 7570
276 Ga0307413_10024656 3300031824 Bacteria 3283
277 Ga0307413_10042054 3300031824 Bacteria 2682
278 Ga0307413_10052294 3300031824 Bacteria 2466
279 Ga0307413_10075101 3300031824 Bacteria 2144
280 Ga0307413_10086273 3300031824 Bacteria 2029
281 Ga0307413_10394272 3300031824 Bacteria 1083
282 Ga0307413_10442442 3300031824 Bacteria 1029
283 Ga0307413_10556944 3300031824 Bacteria 931
284 Ga0307413_10676935 3300031824 Bacteria 854
285 Ga0307413_10949418 3300031824 Bacteria 734
286 Ga0307413_11408854 3300031824 Bacteria 613
287 Ga0307410_10019081 3300031852 Bacteria 4163
288 Ga0307410_10022852 3300031852 Bacteria 3874
289 Ga0307410_10043782 3300031852 Bacteria 2969
290 Ga0307410_10085025 3300031852 Bacteria 2231
291 Ga0307410_10120734 3300031852 Bacteria 1911
292 Ga0307410_10140632 3300031852 Bacteria 1785
293 Ga0307410_10178610 3300031852 Bacteria 1605
294 Ga0307410_10384354 3300031852 Bacteria 1130
295 Ga0307410_10536726 3300031852 Bacteria 967
296 Ga0307410_10692382 3300031852 Bacteria 858
297 Ga0307410_10806997 3300031852 Bacteria 798
298 Ga0307410_11011935 3300031852 Bacteria 717
299 Ga0307410_11171609 3300031852 Bacteria 669
300 Ga0307406_10015311 3300031901 Bacteria 4435
301 Ga0307406_10068485 3300031901 Bacteria 2317
302 Ga0307406_10085033 3300031901 Bacteria 2114
303 Ga0307406_10116407 3300031901 Bacteria 1849
304 Ga0307406_10117511 3300031901 Bacteria 1842
305 Ga0307406_10134339 3300031901 Bacteria 1741
306 Ga0307406_10234523 3300031901 Bacteria 1372
307 Ga0307406_10668589 3300031901 Bacteria 864
308 Ga0307406_11369300 3300031901 Bacteria 619
309 Ga0307407_10003648 3300031903 Bacteria 6366
310 Ga0307407_10019882 3300031903 Bacteria 3428
311 Ga0307407_10021951 3300031903 Bacteria 3303
312 Ga0307407_10068028 3300031903 Bacteria 2108
313 Ga0307407_10112960 3300031903 Bacteria 1709
314 Ga0307407_10203044 3300031903 Bacteria 1329
315 Ga0307407_10312114 3300031903 Bacteria 1100
316 Ga0307407_11026299 3300031903 Unclassified 638
317 Ga0307412_10026727 3300031911 Bacteria 3591
318 Ga0307412_10031859 3300031911 Bacteria 3334
319 Ga0307412_10039584 3300031911 Bacteria 3044
320 Ga0307412_10083188 3300031911 Bacteria 2218
321 Ga0307412_10109135 3300031911 Bacteria 1972
322 Ga0307412_10131642 3300031911 Bacteria 1818
323 Ga0307412_10167095 3300031911 Bacteria 1641
324 Ga0307412_10205621 3300031911 Bacteria 1498
325 Ga0307412_10229141 3300031911 Bacteria 1429
326 Ga0307412_10257176 3300031911 Bacteria 1359
327 Ga0307412_10873756 3300031911 Bacteria 786
328 Ga0307412_11600146 3300031911 Unclassified 595
329 Ga0307412_11849732 3300031911 Bacteria 556
330 Ga0307409_100070109 3300031995 Bacteria 2781
331 Ga0307409_100080661 3300031995 Bacteria 2626
332 Ga0307409_100089251 3300031995 Bacteria 2519
333 Ga0307409_100140198 3300031995 Bacteria 2082
334 Ga0307409_100151227 3300031995 Bacteria 2015
335 Ga0307409_100196561 3300031995 Bacteria 1800
336 Ga0307409_100370746 3300031995 Bacteria 1357
337 Ga0307409_100447268 3300031995 Bacteria 1246
338 Ga0307409_100520048 3300031995 Bacteria 1162
339 Ga0307409_100566236 3300031995 Bacteria 1118
340 Ga0307409_100593787 3300031995 Bacteria 1093
341 Ga0307409_100613929 3300031995 Bacteria 1076
342 Ga0307409_100685762 3300031995 Bacteria 1022
343 Ga0307409_100709123 3300031995 Bacteria 1006
344 Ga0307409_100859864 3300031995 Bacteria 918
345 Ga0307409_100861345 3300031995 Bacteria 917
346 Ga0307409_100868867 3300031995 Bacteria 914
347 Ga0307409_101479287 3300031995 Bacteria 706
348 Ga0307409_101505317 3300031995 Bacteria 700
349 Ga0307409_101938937 3300031995 Bacteria 618
350 Ga0307409_102298732 3300031995 Bacteria 568
351 Ga0307416_100139347 3300032002 Bacteria 2201
352 Ga0307416_100192440 3300032002 Bacteria 1925
353 Ga0307416_100217959 3300032002 Bacteria 1827
354 Ga0307416_100346442 3300032002 Bacteria 1501
355 Ga0307416_100547748 3300032002 Bacteria 1230
356 Ga0307416_100730717 3300032002 Bacteria 1081
357 Ga0307416_101130659 3300032002 Bacteria 888
358 Ga0307416_101313669 3300032002 Bacteria 829
359 Ga0307416_102199067 3300032002 Unclassified 653
360 Ga0307416_103415002 3300032002 Unclassified 531
361 Ga0307414_10002885 3300032004 Bacteria 9080
362 Ga0307414_10020771 3300032004 Bacteria 4101
363 Ga0307414_10047412 3300032004 Bacteria 2956
364 Ga0307414_10050848 3300032004 Bacteria 2873
365 Ga0307414_10058173 3300032004 Bacteria 2722
366 Ga0307414_10122314 3300032004 Bacteria 2003
367 Ga0307414_10161712 3300032004 Bacteria 1779
368 Ga0307414_10162526 3300032004 Bacteria 1775
369 Ga0307414_10193288 3300032004 Bacteria 1648
370 Ga0307414_10201150 3300032004 Bacteria 1620
371 Ga0307414_10402582 3300032004 Bacteria 1189
372 Ga0307414_10559352 3300032004 Bacteria 1020
373 Ga0307414_10603572 3300032004 Bacteria 984
374 Ga0307414_10724126 3300032004 Bacteria 902
375 Ga0307414_11706781 3300032004 Bacteria 587
376 Ga0307411_10002724 3300032005 Bacteria 7927
377 Ga0307411_10007367 3300032005 Bacteria 5597
378 Ga0307411_10009224 3300032005 Bacteria 5172
379 Ga0307411_10010450 3300032005 Bacteria 4949
380 Ga0307411_10032872 3300032005 Bacteria 3211
381 Ga0307411_10046135 3300032005 Bacteria 2807
382 Ga0307411_10067959 3300032005 Bacteria 2400
383 Ga0307411_10097054 3300032005 Bacteria 2073
384 Ga0307411_10103265 3300032005 Bacteria 2022
385 Ga0307411_10152836 3300032005 Bacteria 1717
386 Ga0307411_10156790 3300032005 Bacteria 1699
387 Ga0307411_10240260 3300032005 Bacteria 1417
388 Ga0307411_10249114 3300032005 Bacteria 1395
389 Ga0307411_10259978 3300032005 Bacteria 1370
390 Ga0307411_10275881 3300032005 Bacteria 1335
391 Ga0307411_10281956 3300032005 Bacteria 1323
392 Ga0307411_10398431 3300032005 Bacteria 1137
393 Ga0307411_10498504 3300032005 Bacteria 1029
394 Ga0307411_10614318 3300032005 Bacteria 936
395 Ga0307411_10715878 3300032005 Bacteria 873
396 Ga0307411_10909522 3300032005 Bacteria 782
397 Ga0307415_100015344 3300032126 Bacteria 4533
398 Ga0307415_100016359 3300032126 Bacteria 4419
399 Ga0307415_100051417 3300032126 Bacteria 2796
400 Ga0307415_100076428 3300032126 Bacteria 2374
401 Ga0307415_100083418 3300032126 Bacteria 2289
402 Ga0307415_100093218 3300032126 Bacteria 2186
403 Ga0307415_100211551 3300032126 Bacteria 1547
404 Ga0307415_100232389 3300032126 Bacteria 1486
405 Ga0307415_100285199 3300032126 Bacteria 1360
406 Ga0307415_100319514 3300032126 Bacteria 1294
407 Ga0307415_100365786 3300032126 Bacteria 1219
408 Ga0307415_100546551 3300032126 Bacteria 1021
409 Ga0307415_101142170 3300032126 Bacteria 731
410 Ga0307415_101532629 3300032126 Unclassified 638
411 Ga0307415_101749691 3300032126 Bacteria 600
412 Ga0395899_0004515 3300037312 Bacteria 10849
413 Ga0395899_0116962 3300037312 Bacteria 1912
414 Ga0395899_0255725 3300037312 Bacteria 1200
415 Ga0395900_0000777 3300037418 Bacteria 42484
416 Ga0395900_0001654 3300037418 Bacteria 26100
417 Ga0395898_0015202 3300037466 Bacteria 7902
418 Ga0395898_0209161 3300037466 Bacteria 1861
419 Ga0395905_0001805 3300037471 Bacteria 24778
420 Ga0395905_0049460 3300037471 Bacteria 3940
421 Ga0395905_0113958 3300037471 Bacteria 2540
422 Ga0395905_0432323 3300037471 Bacteria 1213
423 Ga0395905_0790047 3300037471 Bacteria 852
424 Ga0395905_1625400 3300037471 Bacteria 551
425 Ga0395901_0002157 3300038443 Bacteria 20101
426 Ga0395901_0006976 3300038443 Bacteria 11414
427 Ga0395901_0032181 3300038443 Bacteria 5412
428 Ga0439453_0024191 3300041408 Bacteria 1113
429 Ga0439461_0109499 3300041410 Bacteria 680
430 Ga0439466_0066009 3300041411 Bacteria 1159
431 Ga0451807_0695055 3300041486 Bacteria 592
432 Ga0451853_2745094 3300041512 Bacteria 602
433 Ga0439431_0185532 3300041997 Bacteria 602
434 Ga0439445_0002103 3300042004 Bacteria 4405
435 Ga0439449_0203724 3300042007 Bacteria 741
436 Ga0495585_0411978 3300046492 Bacteria 650
437 Ga0495663_0004446 3300046525 Bacteria 3942
438 Ga0495663_0004557 3300046525 Bacteria 3887
439 Ga0495642_0085352 3300046528 Bacteria 1333
440 Ga0495621_0000209 3300046539 Bacteria 13667
441 Ga0495621_0029897 3300046539 Bacteria 1859
442 Ga0495621_0030922 3300046539 Bacteria 1833
443 Ga0495633_0058498 3300046558 Bacteria 1809
444 Ga0495633_0058806 3300046558 Bacteria 1804
445 Ga0495633_0177786 3300046558 Bacteria 980
446 Ga0495633_0516480 3300046558 Bacteria 538
447 Ga0495659_0026155 3300046664 Bacteria 2003
448 Ga0495659_0054902 3300046664 Bacteria 1458
449 Ga0495659_0055353 3300046664 Bacteria 1453
450 Ga0495659_0160992 3300046664 Bacteria 906
451 Ga0495659_0379764 3300046664 Unclassified 607
452 Ga0495669_0065702 3300046684 Bacteria 1647
453 Ga0495670_0013506 3300046691 Bacteria 4018
454 Ga0495670_0029074 3300046691 Bacteria 2742
455 Ga0495670_0031402 3300046691 Bacteria 2639
456 Ga0495670_0040437 3300046691 Bacteria 2325
457 Ga0495670_0177765 3300046691 Bacteria 1123
458 Ga0495677_0032746 3300047445 Bacteria 1893
459 Ga0495677_0043423 3300047445 Bacteria 1648
460 Ga0496102_0572745 3300048905 Bacteria 1052
461 Ga0496107_0539245 3300048910 Bacteria 864
462 Ga0496108_0588607 3300048911 Bacteria 970
463 Ga0496109_0223647 3300048912 Bacteria 1770
464 Ga0496109_0876599 3300048912 Bacteria 835
465 Ga0496110_0076524 3300048913 Bacteria 2976
466 Ga0496110_0103542 3300048913 Bacteria 2553
467 Ga0496111_0008972 3300048914 Bacteria 6652
468 Ga0496113_0597498 3300048916 Bacteria 884
469 Ga0496114_0006322 3300048917 Bacteria 9322
470 Ga0501199_043016 3300049650 Unclassified 591
471 Ga0501201_033122 3300049651 Unclassified 596
472 Ga0501202_108198 3300049652 Bacteria 685
473 Ga0501209_054526 3300049656 Bacteria 1100
474 Ga0501214_070020 3300049659 Unclassified 571
475 Ga0501223_062192 3300049663 Unclassified 730
476 Ga0501224_047780 3300049664 Bacteria 652
477 Ga0501230_060857 3300049667 Unclassified 764
478 Ga0501235_002169 3300049669 Bacteria 4214
479 Ga0501247_057288 3300049677 Unclassified 591
480 Ga0501249_001173 3300049679 Bacteria 5516
481 Ga0501257_039862 3300049686 Bacteria 1151
482 Ga0501258_012168 3300049687 Bacteria 930
483 Ga0501234_028998 3300049707 Bacteria 891
484 Ga0501263_042673 3300049760 Unclassified 670
485 Ga0501272_006790 3300049769 Bacteria 1229
486 Ga0501204_003946 3300049850 Bacteria 1581
487 Ga0501212_043703 3300049851 Bacteria 746
488 nmdc:mga00v17_866346_c1 3300050491 Unclassified 573
489 nmdc:mga06r32_11078_c1 3300050510 Bacteria 8118
490 nmdc:mga08y16_152169_c1 3300050511 Bacteria 2404
491 nmdc:mga08y16_406932_c1 3300050511 Bacteria 1392
492 nmdc:mga0a205_546334_c1 3300050515 Bacteria 1014
493 Ga0307408_100320713
494 JGI24746J21847_1003330
495 JGI24034J26672_10014286
496 rootH1_10190015
497 Ga0065704_10259470
498 Ga0065712_10268531
499 Ga0065715_10089189
500 Ga0065715_10095029
501 Ga0065707_10129470
502 Ga0065707_10387289
503 Ga0070658_10003042
504 Ga0070658_11176406
505 Ga0070676_10007382
506 Ga0070676_10300065
507 Ga0070690_100695117
508 Ga0070690_101173308
509 Ga0070670_100008951
510 Ga0070670_100019012
511 Ga0070670_100036183
512 Ga0070670_100676344
513 Ga0070670_100695032
514 Ga0070670_100994043
515 Ga0070677_10000930
516 Ga0070677_10001640
517 Ga0070666_10295447
518 Ga0070680_100798654
519 Ga0070680_100816338
520 Ga0070660_100000852
521 Ga0070660_100007755
522 Ga0070660_100029533
523 Ga0070660_100498689
524 Ga0070660_100654913
525 Ga0070661_100598719
526 Ga0070692_10005532
527 Ga0070692_10128994
528 Ga0070668_100001451
529 Ga0070668_100049401
530 Ga0070668_100199154
531 Ga0070668_100710824
532 Ga0070668_100775530
533 Ga0070669_100001035
534 Ga0070669_100073032
535 Ga0070669_100091828
536 Ga0070669_101711170
537 Ga0070675_100002714
538 Ga0070675_100002842
539 Ga0070675_100032854
540 Ga0070675_100252756
541 Ga0070675_101147516
542 Ga0070671_100004167
543 Ga0070671_100322010
544 Ga0070674_100000894
545 Ga0070673_100018430
546 Ga0070673_100377882
547 Ga0070673_100382014
548 Ga0070673_100756302
549 Ga0070659_100113013
550 Ga0070659_100382858
551 Ga0070659_100778898
552 Ga0070659_101281817
553 Ga0070667_101875903
554 Ga0070701_10184357
555 Ga0070663_100145390
556 Ga0070663_100228087
557 Ga0070663_100677269
558 Ga0070678_100003324
559 Ga0070678_100061156
560 Ga0070662_100001948
561 Ga0070662_100012431
562 Ga0070662_100070567
563 Ga0070662_100138801
564 Ga0070662_100640925
565 Ga0070681_10210811
566 Ga0070681_10274097
567 Ga0068867_100014795
568 Ga0068867_100690317
569 Ga0070685_10878011
570 Ga0070679_100820964
571 Ga0070679_100830059
572 Ga0068853_100103919
573 Ga0068853_100278377
574 Ga0068853_100349318
575 Ga0070672_100001437
576 Ga0070672_100019600
577 Ga0070672_100381284
578 Ga0070665_100077673
579 Ga0070665_100230956
580 Ga0068855_100000860
581 Ga0068855_101704060
582 Ga0070664_100003661
583 Ga0070664_100186199
584 Ga0070664_100725785
585 Ga0068857_100165612
586 Ga0068857_100531300
587 Ga0068857_101460043
588 Ga0068854_100192956
589 Ga0068852_100264063
590 Ga0068859_100004379
591 Ga0068859_101770212
592 Ga0068864_100050923
593 Ga0068864_100378451
594 Ga0068864_100599005
595 Ga0068866_10225066
596 Ga0068866_11123058
597 Ga0068861_100011177
598 Ga0068870_10070475
599 Ga0068863_100973392
600 Ga0068858_100676147
601 Ga0068860_100061074
602 Ga0068860_100204830
603 Ga0068862_100003135
604 Ga0068862_100033237
605 Ga0068862_100450780
606 Ga0075432_10041128
607 Ga0097621_100250333
608 Ga0075428_100754184
609 Ga0075431_100004274
610 Ga0075433_10371092
611 Ga0075429_100727833
612 Ga0068865_100155639
613 Ga0097620_100004379
614 Ga0097620_101769944
615 Ga0111539_10065335
616 Ga0111539_10338944
617 Ga0111539_11047164
618 Ga0105243_11079243
619 Ga0105248_10149034
620 Ga0105249_10048668
621 Ga0105249_10250807
622 Ga0105249_12300424
623 Ga0157373_10752941
624 Ga0157373_10857992
625 Ga0157371_10023407
626 Ga0157371_10033303
627 Ga0157371_10056382
628 Ga0157371_10193369
629 Ga0157370_10133214
630 Ga0157370_11079187
631 Ga0163162_10490296
632 Ga0157375_10007958
633 Ga0163163_10214042
634 Ga0163163_10835855
635 Ga0157380_10001698
636 Ga0157380_10003692
637 Ga0157380_10053350
638 Ga0157380_10094605
639 Ga0157380_11329517
640 Ga0157377_10608256
641 Ga0163161_10017518
642 Ga0163161_10741450
643 Ga0207666_1010754
644 Ga0207697_10000985
645 Ga0207697_10009622
646 Ga0207697_10018252
647 Ga0207697_10070181
648 Ga0207682_10000857
649 Ga0207682_10001191
650 Ga0207642_10760075
651 Ga0207688_10072077
652 Ga0207688_10303684
653 Ga0207645_10011981
654 Ga0207645_10510120
655 Ga0207645_10784814
656 Ga0207643_10338754
657 Ga0207705_10000648
658 Ga0207705_10001745
659 Ga0207705_10367653
660 Ga0207705_10994968
661 Ga0207654_11141625
662 Ga0207707_10061774
663 Ga0207707_10324691
664 Ga0207660_11065050
665 Ga0207657_10001247
666 Ga0207657_10001696
667 Ga0207657_10141024
668 Ga0207657_10339132
669 Ga0207657_10383281
670 Ga0207657_11256933
671 Ga0207649_10477927
672 Ga0207652_10823465
673 Ga0207652_10853852
674 Ga0207681_10001808
675 Ga0207681_10023028
676 Ga0207681_10310576
677 Ga0207650_10014719
678 Ga0207650_10090408
679 Ga0207650_10108169
680 Ga0207650_10629615
681 Ga0207659_10003143
682 Ga0207659_10122112
683 Ga0207659_10195627
684 Ga0207644_10114064
685 Ga0207644_10367372
686 Ga0207690_10074057
687 Ga0207690_10163158
688 Ga0207690_10353120
689 Ga0207690_11139370
690 Ga0207690_11590979
691 Ga0207706_10000284
692 Ga0207706_10044034
693 Ga0207706_10171181
694 Ga0207706_11482473
695 Ga0207709_10097849
696 Ga0207669_10005555
697 Ga0207669_10785771
698 Ga0207704_10689029
699 Ga0207704_11057308
700 Ga0207691_10001690
701 Ga0207691_10044262
702 Ga0207691_10117949
703 Ga0207711_10568828
704 Ga0207711_10701542
705 Ga0207679_10006008
706 Ga0207679_10082011
707 Ga0207679_10736852
708 Ga0207667_10010703
709 Ga0207667_10186565
710 Ga0207651_10040267
711 Ga0207651_10232660
712 Ga0207712_10412177
713 Ga0207668_10005040
714 Ga0207668_10568511
715 Ga0207668_10955490
716 Ga0207668_11924946
717 Ga0207640_10028574
718 Ga0207658_11695478
719 Ga0207677_10402594
720 Ga0207639_10167947
721 Ga0207639_10246266
722 Ga0207678_10171828
723 Ga0207678_10203681
724 Ga0207648_10003838
725 Ga0207648_11810337
726 Ga0207676_10046933
727 Ga0207676_10285909
728 Ga0207676_11629594
729 Ga0207674_10049004
730 Ga0207674_10396843
731 Ga0207674_10706814
732 Ga0207675_100013354
733 Ga0207675_100582457
734 Ga0207683_10011685
735 Ga0207683_10236171
736 Ga0209970_1013994
737 Ga0209983_1016172
738 Ga0209974_10043567
739 Ga0209974_10060068
740 Ga0207428_10497067
741 Ga0268266_10735920
742 Ga0268265_10001996
743 Ga0268265_10042666
744 Ga0268265_10360134
745 Ga0268264_11715943
746 Ga0316183_1070220
747 Ga0316182_1079047
748 Ga0316182_1181019
749 Ga0307408_100036802
750 Ga0307408_100103990
751 Ga0307408_100118755
752 Ga0307408_100254476
753 Ga0307408_100557747
754 Ga0307408_101902956
755 Ga0307405_10023301
756 Ga0307405_10030813
757 Ga0307405_10053494
758 Ga0307405_10068564
759 Ga0307405_10136968
760 Ga0307405_10313336
761 Ga0307405_10350556
762 Ga0307405_10436116
763 Ga0307405_10546528
764 Ga0307405_10644168
765 Ga0307405_10668527
766 Ga0307413_10000587
767 Ga0307413_10002432
768 Ga0307413_10024656
769 Ga0307413_10042054
770 Ga0307413_10052294
771 Ga0307413_10075101
772 Ga0307413_10086273
773 Ga0307413_10394272
774 Ga0307413_10442442
775 Ga0307413_10556944
776 Ga0307413_10676935
777 Ga0307413_10949418
778 Ga0307413_11408854
779 Ga0307410_10019081
780 Ga0307410_10022852
781 Ga0307410_10043782
782 Ga0307410_10085025
783 Ga0307410_10120734
784 Ga0307410_10140632
785 Ga0307410_10178610
786 Ga0307410_10384354
787 Ga0307410_10536726
788 Ga0307410_10692382
789 Ga0307410_10806997
790 Ga0307410_11011935
791 Ga0307410_11171609
792 Ga0307406_10015311
793 Ga0307406_10068485
794 Ga0307406_10085033
795 Ga0307406_10116407
796 Ga0307406_10117511
797 Ga0307406_10134339
798 Ga0307406_10234523
799 Ga0307406_10668589
800 Ga0307406_11369300
801 Ga0307407_10003648
802 Ga0307407_10019882
803 Ga0307407_10021951
804 Ga0307407_10068028
805 Ga0307407_10112960
806 Ga0307407_10203044
807 Ga0307407_10312114
808 Ga0307407_11026299
809 Ga0307412_10026727
810 Ga0307412_10031859
811 Ga0307412_10039584
812 Ga0307412_10083188
813 Ga0307412_10109135
814 Ga0307412_10131642
815 Ga0307412_10167095
816 Ga0307412_10205621
817 Ga0307412_10229141
818 Ga0307412_10257176
819 Ga0307412_10873756
820 Ga0307412_11600146
821 Ga0307412_11849732
822 Ga0307409_100070109
823 Ga0307409_100080661
824 Ga0307409_100089251
825 Ga0307409_100140198
826 Ga0307409_100151227
827 Ga0307409_100196561
828 Ga0307409_100370746
829 Ga0307409_100447268
830 Ga0307409_100520048
831 Ga0307409_100566236
832 Ga0307409_100593787
833 Ga0307409_100613929
834 Ga0307409_100685762
835 Ga0307409_100709123
836 Ga0307409_100859864
837 Ga0307409_100861345
838 Ga0307409_100868867
839 Ga0307409_101479287
840 Ga0307409_101505317
841 Ga0307409_101938937
842 Ga0307409_102298732
843 Ga0307416_100139347
844 Ga0307416_100192440
845 Ga0307416_100217959
846 Ga0307416_100346442
847 Ga0307416_100547748
848 Ga0307416_100730717
849 Ga0307416_101130659
850 Ga0307416_101313669
851 Ga0307416_102199067
852 Ga0307416_103415002
853 Ga0307414_10002885
854 Ga0307414_10020771
855 Ga0307414_10047412
856 Ga0307414_10050848
857 Ga0307414_10058173
858 Ga0307414_10122314
859 Ga0307414_10161712
860 Ga0307414_10162526
861 Ga0307414_10193288
862 Ga0307414_10201150
863 Ga0307414_10402582
864 Ga0307414_10559352
865 Ga0307414_10603572
866 Ga0307414_10724126
867 Ga0307414_11706781
868 Ga0307411_10002724
869 Ga0307411_10007367
870 Ga0307411_10009224
871 Ga0307411_10010450
872 Ga0307411_10032872
873 Ga0307411_10046135
874 Ga0307411_10067959
875 Ga0307411_10097054
876 Ga0307411_10103265
877 Ga0307411_10152836
878 Ga0307411_10156790
879 Ga0307411_10240260
880 Ga0307411_10249114
881 Ga0307411_10259978
882 Ga0307411_10275881
883 Ga0307411_10281956
884 Ga0307411_10398431
885 Ga0307411_10498504
886 Ga0307411_10614318
887 Ga0307411_10715878
888 Ga0307411_10909522
889 Ga0307415_100015344
890 Ga0307415_100016359
891 Ga0307415_100051417
892 Ga0307415_100076428
893 Ga0307415_100083418
894 Ga0307415_100093218
895 Ga0307415_100211551
896 Ga0307415_100232389
897 Ga0307415_100285199
898 Ga0307415_100319514
899 Ga0307415_100365786
900 Ga0307415_100546551
901 Ga0307415_101142170
902 Ga0307415_101532629
903 Ga0307415_101749691
904 Ga0395899_0004515
905 Ga0395899_0116962
906 Ga0395899_0255725
907 Ga0395900_0000777
908 Ga0395900_0001654
909 Ga0395898_0015202
910 Ga0395898_0209161
911 Ga0395905_0001805
912 Ga0395905_0049460
913 Ga0395905_0113958
914 Ga0395905_0432323
915 Ga0395905_0790047
916 Ga0395905_1625400
917 Ga0395901_0002157
918 Ga0395901_0006976
919 Ga0395901_0032181
920 Ga0439453_0024191
921 Ga0439461_0109499
922 Ga0439466_0066009
923 Ga0451807_0695055
924 Ga0451853_2745094
925 Ga0439431_0185532
926 Ga0439445_0002103
927 Ga0439449_0203724
928 Ga0495585_0411978
929 Ga0495663_0004446
930 Ga0495663_0004557
931 Ga0495642_0085352
932 Ga0495621_0000209
933 Ga0495621_0029897
934 Ga0495621_0030922
935 Ga0495633_0058498
936 Ga0495633_0058806
937 Ga0495633_0177786
938 Ga0495633_0516480
939 Ga0495659_0026155
940 Ga0495659_0054902
941 Ga0495659_0055353
942 Ga0495659_0160992
943 Ga0495659_0379764
944 Ga0495669_0065702
945 Ga0495670_0013506
946 Ga0495670_0029074
947 Ga0495670_0031402
948 Ga0495670_0040437
949 Ga0495670_0177765
950 Ga0495677_0032746
951 Ga0495677_0043423
952 Ga0496102_0572745
953 Ga0496107_0539245
954 Ga0496108_0588607
955 Ga0496109_0223647
956 Ga0496109_0876599
957 Ga0496110_0076524
958 Ga0496110_0103542
959 Ga0496111_0008972
960 Ga0496113_0597498
961 Ga0496114_0006322
962 Ga0501199_043016
963 Ga0501201_033122
964 Ga0501202_108198
965 Ga0501209_054526
966 Ga0501214_070020
967 Ga0501223_062192
968 Ga0501224_047780
969 Ga0501230_060857
970 Ga0501235_002169
971 Ga0501247_057288
972 Ga0501249_001173
973 Ga0501257_039862
974 Ga0501258_012168
975 Ga0501234_028998
976 Ga0501263_042673
977 Ga0501272_006790
978 Ga0501204_003946
979 Ga0501212_043703
980 nmdc:mga00v17_866346_c1
981 nmdc:mga06r32_11078_c1
982 nmdc:mga08y16_152169_c1
983 nmdc:mga08y16_406932_c1
984 nmdc:mga0a205_546334_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

43

120

0.95

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

37

128

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nwz-assembly2.cif.gz_C crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.8837 7 123
1zki-assembly1.cif.gz_B structure of conserved protein pa5202 from pseudomonas aeruginosa 0.883 4 123
3lz7-assembly1.cif.gz_A crystal structure of thioesterase hi1161 ec3.1.2.- from haemophilus influenzae. orthorombic crystal form. northeast structural genomics consortium target ir63 0.8817 7 124
3nwz-assembly3.cif.gz_B crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.8784 1 125
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.8748 5 122
ID Description Score Start End Superfamily
af_A0A1D6F200_19_155_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8701 13 121 3.10.129.10
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8633 4 123 3.10.129.10
3e1eD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8606 4 125 3.10.129.10
af_Q9FI76_3_136_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8578 5 123 3.10.129.10
af_A0A0R0II97_1_126_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8556 33 123 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7Y1T648-F1-model_v4 deleted 0.9719 4 125
AF-A0A537LWU9-F1-model_v4 PaaI family thioesterase 0.962 1 124 GO:0016289
AF-A0A537LWU9-F1-model_v4 PaaI family thioesterase 0.9472 1 124 GO:0016289
AF-A0A7Y1T648-F1-model_v4 deleted 0.9417 4 125
AF-A0A4Y9RLR3-F1-model_v4 PaaI family thioesterase 0.9381 5 123

Map