F454254

General Info

Members Datasets Scaffolds Average Seq Length
492 228 984 94

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10333590|Ga0105240_103335901
Length 107
Sequence MQESFMNTKLYVGNLPYETTESDLQALFAAAGPVSTINIVRDRATGQPRGFAFVEMTDTASAQRAITELDQHQLGGRSLTVNEAKPMPARSNGGGFGEGRQRRDSRW

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
176 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
177 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
178 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
210 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
211 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
214 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
215 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 2.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0
Rhizoplane 1.83
Rhizosphere 97.15
Stem 0
Stem Tuber 0
Unclassified 23.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10333590 3300009093 Bacteria 1725
2 Ga0058859_11724100 3300004798 Unclassified 939
3 Ga0058863_11455670 3300004799 Bacteria 601
4 Ga0058862_12383312 3300004803 Bacteria 665
5 Ga0065712_10300078 3300005290 Unclassified 862
6 Ga0065715_10210130 3300005293 Bacteria 1311
7 Ga0065707_10230553 3300005295 Bacteria 1190
8 Ga0070676_10005607 3300005328 Bacteria 6689
9 Ga0070683_100765341 3300005329 Bacteria 925
10 Ga0070690_100005156 3300005330 Bacteria 7313
11 Ga0070670_100002863 3300005331 Bacteria 14273
12 Ga0070670_100338546 3300005331 Bacteria 1320
13 Ga0070670_100988130 3300005331 Bacteria 765
14 Ga0070677_10006087 3300005333 Bacteria 4003
15 Ga0070677_10064057 3300005333 Bacteria 1525
16 Ga0070677_10114939 3300005333 Bacteria 1207
17 Ga0068869_100001349 3300005334 Bacteria 14533
18 Ga0068869_100086471 3300005334 Bacteria 2350
19 Ga0068869_101511477 3300005334 Bacteria 596
20 Ga0068868_102181813 3300005338 Unclassified 527
21 Ga0070689_100003076 3300005340 Bacteria 10993
22 Ga0070689_100050243 3300005340 Bacteria 3222
23 Ga0070691_10623174 3300005341 Bacteria 639
24 Ga0070687_100008423 3300005343 Bacteria 4368
25 Ga0070687_100180286 3300005343 Bacteria 1265
26 Ga0070661_100684137 3300005344 Bacteria 835
27 Ga0070661_101385337 3300005344 Bacteria 591
28 Ga0070661_101482608 3300005344 Unclassified 572
29 Ga0070692_10352266 3300005345 Bacteria 915
30 Ga0070692_10614376 3300005345 Bacteria 721
31 Ga0070668_100265417 3300005347 Bacteria 1429
32 Ga0070669_100049569 3300005353 Bacteria 3065
33 Ga0070669_100437380 3300005353 Bacteria 1076
34 Ga0070669_100489528 3300005353 Unclassified 1019
35 Ga0070669_100495692 3300005353 Bacteria 1013
36 Ga0070669_101341900 3300005353 Unclassified 620
37 Ga0070669_101898008 3300005353 Bacteria 520
38 Ga0070675_100000720 3300005354 Bacteria 23027
39 Ga0070675_100127080 3300005354 Bacteria 2170
40 Ga0070675_100893603 3300005354 Bacteria 814
41 Ga0070675_102083384 3300005354 Bacteria 523
42 Ga0070671_100020362 3300005355 Bacteria 5409
43 Ga0070671_100117756 3300005355 Bacteria 2234
44 Ga0070671_100307788 3300005355 Bacteria 1349
45 Ga0070671_100342672 3300005355 Unclassified 1275
46 Ga0070671_101445212 3300005355 Unclassified 608
47 Ga0070674_100003693 3300005356 Bacteria 8623
48 Ga0070674_100031406 3300005356 Bacteria 3519
49 Ga0070674_100802594 3300005356 Bacteria 813
50 Ga0070674_101286662 3300005356 Bacteria 652
51 Ga0070673_100026026 3300005364 Bacteria 4315
52 Ga0070673_100135902 3300005364 Unclassified 2069
53 Ga0070673_100346977 3300005364 Bacteria 1317
54 Ga0070688_100008376 3300005365 Bacteria 5609
55 Ga0070688_100265178 3300005365 Bacteria 1228
56 Ga0070688_100525903 3300005365 Bacteria 896
57 Ga0070659_100220616 3300005366 Bacteria 1565
58 Ga0070667_100145738 3300005367 Bacteria 2077
59 Ga0070709_10217139 3300005434 Unclassified 1362
60 Ga0070701_10020113 3300005438 Bacteria 3165
61 Ga0070701_10310822 3300005438 Bacteria 972
62 Ga0070705_100035956 3300005440 Unclassified 2780
63 Ga0070700_100052313 3300005441 Bacteria 2546
64 Ga0070700_100877655 3300005441 Bacteria 728
65 Ga0070700_101579513 3300005441 Bacteria 560
66 Ga0070694_100896168 3300005444 Bacteria 732
67 Ga0070663_100147844 3300005455 Bacteria 1799
68 Ga0070663_100513104 3300005455 Bacteria 997
69 Ga0070678_100050115 3300005456 Bacteria 3018
70 Ga0070678_101552097 3300005456 Bacteria 621
71 Ga0070662_100092985 3300005457 Bacteria 2268
72 Ga0070662_100321320 3300005457 Unclassified 1262
73 Ga0070662_101172000 3300005457 Bacteria 660
74 Ga0068867_100007728 3300005459 Bacteria 7602
75 Ga0068867_102418618 3300005459 Unclassified 500
76 Ga0070685_10034117 3300005466 Bacteria 2864
77 Ga0070685_10738757 3300005466 Bacteria 721
78 Ga0070707_100687494 3300005468 Unclassified 986
79 Ga0070707_100990548 3300005468 Unclassified 806
80 Ga0070698_100615260 3300005471 Bacteria 1027
81 Ga0070698_100733884 3300005471 Unclassified 930
82 Ga0070698_101974624 3300005471 Bacteria 537
83 Ga0070699_100006091 3300005518 Bacteria 10554
84 Ga0070697_100556444 3300005536 Unclassified 1006
85 Ga0070697_100684844 3300005536 Unclassified 904
86 Ga0070697_101516706 3300005536 Bacteria 599
87 Ga0070672_100084263 3300005543 Bacteria 2552
88 Ga0070672_100843252 3300005543 Bacteria 808
89 Ga0070686_100007696 3300005544 Bacteria 6022
90 Ga0070695_100484288 3300005545 Bacteria 954
91 Ga0070695_100675098 3300005545 Bacteria 818
92 Ga0070695_101815618 3300005545 Unclassified 512
93 Ga0070696_100316704 3300005546 Unclassified 1199
94 Ga0070696_100694439 3300005546 Unclassified 829
95 Ga0070696_101855126 3300005546 Unclassified 522
96 Ga0070665_100904576 3300005548 Bacteria 895
97 Ga0070665_101896566 3300005548 Bacteria 602
98 Ga0070704_100059633 3300005549 Unclassified 2723
99 Ga0070704_101699260 3300005549 Unclassified 583
100 Ga0068855_101785709 3300005563 Unclassified 625
101 Ga0070664_100329639 3300005564 Bacteria 1384
102 Ga0070664_100741877 3300005564 Bacteria 916
103 Ga0070664_100925108 3300005564 Bacteria 818
104 Ga0070664_101203204 3300005564 Bacteria 715
105 Ga0068857_100673285 3300005577 Unclassified 982
106 Ga0068857_101025667 3300005577 Bacteria 795
107 Ga0068854_100073566 3300005578 Bacteria 2505
108 Ga0068854_101823908 3300005578 Bacteria 558
109 Ga0068856_101874476 3300005614 Bacteria 611
110 Ga0070702_100135902 3300005615 Bacteria 1560
111 Ga0070702_100513942 3300005615 Bacteria 882
112 Ga0068852_100947430 3300005616 Bacteria 879
113 Ga0068852_102186919 3300005616 Bacteria 575
114 Ga0068859_100006472 3300005617 Bacteria 11886
115 Ga0068859_100023921 3300005617 Bacteria 6130
116 Ga0068859_100377276 3300005617 Bacteria 1514
117 Ga0068859_100451486 3300005617 Bacteria 1382
118 Ga0068864_100004388 3300005618 Bacteria 11585
119 Ga0068864_100072448 3300005618 Bacteria 3003
120 Ga0068864_100107261 3300005618 Bacteria 2484
121 Ga0068864_100731261 3300005618 Bacteria 969
122 Ga0068866_10029404 3300005718 Bacteria 2628
123 Ga0068866_10086388 3300005718 Bacteria 1697
124 Ga0068866_11396496 3300005718 Bacteria 512
125 Ga0068861_100051582 3300005719 Bacteria 3123
126 Ga0068861_100471522 3300005719 Bacteria 1129
127 Ga0068861_100697412 3300005719 Bacteria 943
128 Ga0068851_10045469 3300005834 Bacteria 2219
129 Ga0068870_10033739 3300005840 Bacteria 2614
130 Ga0068870_10192727 3300005840 Bacteria 1231
131 Ga0068870_10241875 3300005840 Bacteria 1115
132 Ga0068870_11288667 3300005840 Bacteria 532
133 Ga0068863_100376953 3300005841 Bacteria 1385
134 Ga0068863_100765491 3300005841 Bacteria 962
135 Ga0068858_100007379 3300005842 Bacteria 10638
136 Ga0068858_100073199 3300005842 Bacteria 3181
137 Ga0068858_100124476 3300005842 Bacteria 2413
138 Ga0068860_100010695 3300005843 Bacteria 9064
139 Ga0068860_100024788 3300005843 Bacteria 5794
140 Ga0068860_101592633 3300005843 Unclassified 675
141 Ga0068862_101745885 3300005844 Bacteria 631
142 Ga0081455_10329777 3300005937 Bacteria 1084
143 Ga0081538_10265449 3300005981 Bacteria 646
144 Ga0070717_10878452 3300006028 Unclassified 816
145 Ga0075364_10277177 3300006051 Unclassified 1141
146 Ga0075362_10296242 3300006177 Unclassified 802
147 Ga0075367_10121275 3300006178 Bacteria 1611
148 Ga0075366_10770295 3300006195 Unclassified 598
149 Ga0097621_100466496 3300006237 Bacteria 1139
150 Ga0097621_101063280 3300006237 Bacteria 759
151 Ga0068871_100546558 3300006358 Bacteria 1049
152 Ga0068871_100976041 3300006358 Bacteria 788
153 Ga0068871_101712682 3300006358 Unclassified 596
154 Ga0075428_100023627 3300006844 Bacteria 6805
155 Ga0075428_100026824 3300006844 Bacteria 6379
156 Ga0075428_100304705 3300006844 Bacteria 1713
157 Ga0075428_100995058 3300006844 Bacteria 888
158 Ga0075428_101330241 3300006844 Bacteria 755
159 Ga0075428_101413470 3300006844 Bacteria 730
160 Ga0075430_100012224 3300006846 Bacteria 7309
161 Ga0075430_100017467 3300006846 Bacteria 6111
162 Ga0075430_100564052 3300006846 Bacteria 939
163 Ga0075431_100191372 3300006847 Bacteria 2096
164 Ga0075431_100260098 3300006847 Unclassified 1761
165 Ga0075431_100722118 3300006847 Bacteria 973
166 Ga0075431_100850317 3300006847 Bacteria 884
167 Ga0075431_101259497 3300006847 Unclassified 701
168 Ga0075433_10011986 3300006852 Bacteria 6991
169 Ga0075433_10144089 3300006852 Unclassified 2118
170 Ga0075433_10488587 3300006852 Bacteria 1084
171 Ga0075433_10941860 3300006852 Bacteria 753
172 Ga0075433_11090233 3300006852 Bacteria 694
173 Ga0075434_100001320 3300006871 Bacteria 20725
174 Ga0075434_100020715 3300006871 Bacteria 6383
175 Ga0075434_100195589 3300006871 Bacteria 2042
176 Ga0075434_100872723 3300006871 Bacteria 915
177 Ga0075429_100596098 3300006880 Bacteria 968
178 Ga0068865_100002620 3300006881 Bacteria 10696
179 Ga0068865_100098467 3300006881 Unclassified 2137
180 Ga0075436_100352984 3300006914 Bacteria 1060
181 Ga0075436_100676079 3300006914 Unclassified 764
182 Ga0075436_101400506 3300006914 Unclassified 530
183 Ga0097620_100006472 3300006931 Bacteria 11886
184 Ga0097620_100023921 3300006931 Bacteria 6130
185 Ga0097620_100377302 3300006931 Bacteria 1514
186 Ga0097620_100451507 3300006931 Bacteria 1382
187 Ga0075435_100015257 3300007076 Bacteria 5771
188 Ga0075435_100027608 3300007076 Bacteria 4443
189 Ga0075435_100074491 3300007076 Bacteria 2777
190 Ga0075435_100518273 3300007076 Bacteria 1031
191 Ga0075435_100959705 3300007076 Bacteria 746
192 Ga0105250_10364972 3300009092 Unclassified 635
193 Ga0111539_10000538 3300009094 Bacteria 48180
194 Ga0111539_10031943 3300009094 Bacteria 6396
195 Ga0111539_10202006 3300009094 Bacteria 2318
196 Ga0111539_10680703 3300009094 Bacteria 1197
197 Ga0111539_10748289 3300009094 Bacteria 1138
198 Ga0111539_10961428 3300009094 Bacteria 993
199 Ga0105245_11577868 3300009098 Bacteria 708
200 Ga0114129_10000410 3300009147 Bacteria 50569
201 Ga0114129_10022600 3300009147 Bacteria 8921
202 Ga0114129_10044723 3300009147 Bacteria 6229
203 Ga0114129_10119765 3300009147 Bacteria 3625
204 Ga0114129_10611277 3300009147 Unclassified 1411
205 Ga0105243_10482889 3300009148 Bacteria 1170
206 Ga0105243_11789008 3300009148 Bacteria 645
207 Ga0105241_11632848 3300009174 Unclassified 624
208 Ga0105242_10003081 3300009176 Bacteria 13008
209 Ga0105242_11187452 3300009176 Bacteria 781
210 Ga0105248_10019113 3300009177 Bacteria 7578
211 Ga0105248_10336674 3300009177 Bacteria 1699
212 Ga0105248_10419444 3300009177 Bacteria 1507
213 Ga0105248_11543836 3300009177 Bacteria 752
214 Ga0105248_12638859 3300009177 Unclassified 573
215 Ga0105238_10066414 3300009551 Bacteria 3608
216 Ga0105238_10458574 3300009551 Bacteria 1272
217 Ga0105249_12092702 3300009553 Unclassified 639
218 Ga0105239_11660045 3300010375 Bacteria 739
219 Ga0105246_10025964 3300011119 Unclassified 3821
220 Ga0105246_10714494 3300011119 Bacteria 880
221 Ga0157374_10139917 3300013296 Unclassified 2349
222 Ga0157378_10393851 3300013297 Bacteria 1363
223 Ga0157378_10407550 3300013297 Bacteria 1341
224 Ga0157375_10173711 3300013308 Unclassified 2303
225 Ga0157375_10596960 3300013308 Bacteria 1263
226 Ga0157375_11140857 3300013308 Bacteria 913
227 Ga0157375_12589933 3300013308 Bacteria 606
228 Ga0163163_10076490 3300014325 Bacteria 3342
229 Ga0163163_10116327 3300014325 Bacteria 2705
230 Ga0163163_11484367 3300014325 Bacteria 739
231 Ga0157380_10047475 3300014326 Bacteria 3378
232 Ga0157380_10070292 3300014326 Bacteria 2828
233 Ga0157380_10800939 3300014326 Bacteria 959
234 Ga0157380_11347475 3300014326 Bacteria 762
235 Ga0157377_10089691 3300014745 Bacteria 1813
236 Ga0157377_10987640 3300014745 Unclassified 636
237 Ga0157379_10321357 3300014968 Bacteria 1413
238 Ga0157379_11152559 3300014968 Unclassified 744
239 Ga0163161_10344551 3300017792 Unclassified 1183
240 Ga0207697_10329070 3300025315 Bacteria 678
241 Ga0207656_10101863 3300025321 Bacteria 1317
242 Ga0207696_1144952 3300025711 Unclassified 635
243 Ga0207682_10014825 3300025893 Bacteria 3036
244 Ga0207682_10069065 3300025893 Unclassified 1494
245 Ga0207682_10076746 3300025893 Bacteria 1424
246 Ga0207682_10162601 3300025893 Bacteria 1012
247 Ga0207642_10007314 3300025899 Unclassified 3722
248 Ga0207688_10220546 3300025901 Unclassified 1142
249 Ga0207688_10305405 3300025901 Bacteria 973
250 Ga0207680_10327243 3300025903 Bacteria 1073
251 Ga0207680_10415263 3300025903 Bacteria 952
252 Ga0207680_10610630 3300025903 Bacteria 780
253 Ga0207645_10003286 3300025907 Bacteria 12330
254 Ga0207645_10313665 3300025907 Bacteria 1045
255 Ga0207645_10456265 3300025907 Bacteria 863
256 Ga0207643_10000798 3300025908 Bacteria 19183
257 Ga0207643_10069010 3300025908 Bacteria 2031
258 Ga0207643_10118493 3300025908 Bacteria 1566
259 Ga0207643_10324604 3300025908 Bacteria 962
260 Ga0207695_10098965 3300025913 Bacteria 2915
261 Ga0207662_10008158 3300025918 Bacteria 5726
262 Ga0207662_10044848 3300025918 Bacteria 2612
263 Ga0207662_10100475 3300025918 Unclassified 1792
264 Ga0207662_10113792 3300025918 Bacteria 1690
265 Ga0207646_11167012 3300025922 Unclassified 676
266 Ga0207646_11229388 3300025922 Unclassified 656
267 Ga0207646_11923531 3300025922 Bacteria 504
268 Ga0207681_10002323 3300025923 Bacteria 12097
269 Ga0207681_10008900 3300025923 Bacteria 6130
270 Ga0207681_10085539 3300025923 Bacteria 2238
271 Ga0207681_10187147 3300025923 Bacteria 1581
272 Ga0207681_10293524 3300025923 Bacteria 1284
273 Ga0207681_10534884 3300025923 Unclassified 963
274 Ga0207694_10011933 3300025924 Bacteria 6551
275 Ga0207694_11193089 3300025924 Bacteria 644
276 Ga0207650_10010041 3300025925 Bacteria 6483
277 Ga0207650_10236126 3300025925 Bacteria 1476
278 Ga0207659_10001151 3300025926 Bacteria 15752
279 Ga0207659_10001582 3300025926 Bacteria 13494
280 Ga0207659_10017668 3300025926 Bacteria 4661
281 Ga0207659_10049430 3300025926 Bacteria 2983
282 Ga0207659_11011692 3300025926 Bacteria 715
283 Ga0207687_10916074 3300025927 Bacteria 750
284 Ga0207687_11755659 3300025927 Bacteria 531
285 Ga0207644_10001879 3300025931 Bacteria 13678
286 Ga0207644_10367772 3300025931 Bacteria 1171
287 Ga0207644_10396163 3300025931 Bacteria 1128
288 Ga0207644_10796573 3300025931 Unclassified 790
289 Ga0207690_11011827 3300025932 Bacteria 691
290 Ga0207690_11316427 3300025932 Bacteria 604
291 Ga0207706_10052979 3300025933 Bacteria 3582
292 Ga0207706_10702577 3300025933 Bacteria 864
293 Ga0207706_11269520 3300025933 Bacteria 610
294 Ga0207686_10018003 3300025934 Bacteria 3993
295 Ga0207686_11082416 3300025934 Bacteria 653
296 Ga0207709_10006067 3300025935 Bacteria 6811
297 Ga0207709_10069419 3300025935 Bacteria 2230
298 Ga0207670_10008307 3300025936 Bacteria 5851
299 Ga0207670_10017981 3300025936 Plasmid 4284
300 Ga0207670_10091157 3300025936 Bacteria 2155
301 Ga0207669_10003962 3300025937 Bacteria 6464
302 Ga0207669_10873051 3300025937 Bacteria 750
303 Ga0207669_11221385 3300025937 Bacteria 637
304 Ga0207704_10004609 3300025938 Bacteria 6318
305 Ga0207704_10142535 3300025938 Bacteria 1679
306 Ga0207704_10740845 3300025938 Unclassified 817
307 Ga0207691_10011845 3300025940 Bacteria 8371
308 Ga0207691_10172592 3300025940 Bacteria 1893
309 Ga0207691_10262865 3300025940 Bacteria 1487
310 Ga0207711_10045150 3300025941 Bacteria 3765
311 Ga0207711_10146388 3300025941 Bacteria 2129
312 Ga0207711_10318772 3300025941 Bacteria 1436
313 Ga0207689_10004204 3300025942 Bacteria 13092
314 Ga0207689_10057056 3300025942 Bacteria 3212
315 Ga0207689_10159872 3300025942 Bacteria 1856
316 Ga0207689_10170448 3300025942 Bacteria 1794
317 Ga0207689_11216525 3300025942 Bacteria 634
318 Ga0207661_10680499 3300025944 Bacteria 946
319 Ga0207679_10228646 3300025945 Bacteria 1569
320 Ga0207679_10662285 3300025945 Bacteria 945
321 Ga0207679_10697073 3300025945 Bacteria 921
322 Ga0207651_10026464 3300025960 Bacteria 3624
323 Ga0207651_10072368 3300025960 Bacteria 2447
324 Ga0207651_10098846 3300025960 Bacteria 2159
325 Ga0207712_10105975 3300025961 Bacteria 2099
326 Ga0207712_11990056 3300025961 Bacteria 520
327 Ga0207668_10030255 3300025972 Bacteria 3557
328 Ga0207668_10461471 3300025972 Bacteria 1086
329 Ga0207668_10497462 3300025972 Bacteria 1048
330 Ga0207640_10066231 3300025981 Bacteria 2413
331 Ga0207640_10416826 3300025981 Bacteria 1098
332 Ga0207658_10295866 3300025986 Bacteria 1393
333 Ga0207677_11165634 3300026023 Unclassified 704
334 Ga0207677_12251736 3300026023 Unclassified 507
335 Ga0207703_10026711 3300026035 Bacteria 4547
336 Ga0207703_10076756 3300026035 Bacteria 2772
337 Ga0207703_10483061 3300026035 Bacteria 1161
338 Ga0207703_11475942 3300026035 Bacteria 654
339 Ga0207678_10169420 3300026067 Bacteria 1864
340 Ga0207678_10425319 3300026067 Bacteria 1152
341 Ga0207708_10033893 3300026075 Bacteria 3882
342 Ga0207708_10034447 3300026075 Bacteria 3852
343 Ga0207708_10155007 3300026075 Bacteria 1806
344 Ga0207708_11308046 3300026075 Unclassified 635
345 Ga0207708_11827810 3300026075 Bacteria 533
346 Ga0207702_11013819 3300026078 Bacteria 824
347 Ga0207641_10080464 3300026088 Unclassified 2827
348 Ga0207641_10555305 3300026088 Bacteria 1120
349 Ga0207641_10679530 3300026088 Bacteria 1013
350 Ga0207648_10002414 3300026089 Bacteria 20118
351 Ga0207648_10005116 3300026089 Bacteria 13291
352 Ga0207648_11209877 3300026089 Bacteria 710
353 Ga0207648_11331807 3300026089 Bacteria 675
354 Ga0207648_11824977 3300026089 Bacteria 570
355 Ga0207676_10028393 3300026095 Bacteria 4179
356 Ga0207676_10036535 3300026095 Bacteria 3738
357 Ga0207676_10105682 3300026095 Bacteria 2344
358 Ga0207676_10182361 3300026095 Bacteria 1839
359 Ga0207676_10183303 3300026095 Bacteria 1835
360 Ga0207674_10002954 3300026116 Bacteria 21110
361 Ga0207674_10056360 3300026116 Bacteria 3992
362 Ga0207674_11965808 3300026116 Bacteria 550
363 Ga0207675_100011835 3300026118 Bacteria 8156
364 Ga0207675_100014871 3300026118 Bacteria 7263
365 Ga0207698_11903504 3300026142 Unclassified 609
366 Ga0209983_1110850 3300027665 Bacteria 624
367 Ga0209998_10155326 3300027717 Bacteria 589
368 Ga0209974_10109730 3300027876 Unclassified 970
369 Ga0207428_10001764 3300027907 Bacteria 22179
370 Ga0207428_10807824 3300027907 Unclassified 666
371 Ga0268266_11227436 3300028379 Bacteria 725
372 Ga0268266_12154851 3300028379 Bacteria 530
373 Ga0268265_10002294 3300028380 Bacteria 14564
374 Ga0268265_12096905 3300028380 Bacteria 572
375 Ga0268264_10017071 3300028381 Bacteria 5944
376 Ga0268264_10047086 3300028381 Plasmid 3584
377 Ga0268264_10538252 3300028381 Unclassified 1144
378 Ga0268264_11541566 3300028381 Unclassified 675
379 Ga0307408_100010627 3300031548 Bacteria 6073
380 Ga0307408_100564494 3300031548 Bacteria 1006
381 Ga0307408_101628991 3300031548 Unclassified 613
382 Ga0307405_10023833 3300031731 Unclassified 3485
383 Ga0307405_10142383 3300031731 Unclassified 1674
384 Ga0307413_10025255 3300031824 Unclassified 3254
385 Ga0307413_10280606 3300031824 Unclassified 1253
386 Ga0307410_10016065 3300031852 Bacteria 4453
387 Ga0307410_11465294 3300031852 Unclassified 600
388 Ga0307406_10173121 3300031901 Bacteria 1564
389 Ga0307406_10274463 3300031901 Bacteria 1282
390 Ga0307406_11476999 3300031901 Bacteria 598
391 Ga0307407_10012971 3300031903 Unclassified 4027
392 Ga0307412_10000537 3300031911 Bacteria 22599
393 Ga0307412_10132100 3300031911 Bacteria 1815
394 Ga0307412_10188809 3300031911 Unclassified 1556
395 Ga0307409_100008546 3300031995 Bacteria 6225
396 Ga0307409_100401316 3300031995 Unclassified 1310
397 Ga0307409_100813308 3300031995 Bacteria 943
398 Ga0307416_100017724 3300032002 Unclassified 4992
399 Ga0307416_100481559 3300032002 Bacteria 1301
400 Ga0307416_100850172 3300032002 Unclassified 1010
401 Ga0307416_103096473 3300032002 Bacteria 556
402 Ga0307414_10003606 3300032004 Bacteria 8285
403 Ga0307411_10029269 3300032005 Unclassified 3360
404 Ga0307411_10053812 3300032005 Unclassified 2640
405 Ga0307415_100408512 3300032126 Unclassified 1161
406 Ga0307415_100537612 3300032126 Unclassified 1029
407 Ga0307415_102588913 3300032126 Bacteria 500
408 Ga0373951_0150830 3300035091 Bacteria 651
409 Ga0373923_0012979 3300035111 Bacteria 3095
410 Ga0373941_0415569 3300035115 Bacteria 559
411 Ga0373933_0234139 3300035724 Bacteria 1180
412 Ga0373937_0004422 3300036401 Bacteria 11952
413 Ga0451805_109762 3300041461 Bacteria 563
414 Ga0439444_0095180 3300042437 Unclassified 669
415 Ga0439460_0110231 3300042461 Unclassified 892
416 Ga0450916_053108 3300042530 Unclassified 643
417 Ga0451577_0205803 3300042876 Unclassified 1777
418 Ga0439440_0250474 3300042993 Bacteria 539
419 Ga0451576_0176456 3300045051 Bacteria 2231
420 Ga0451576_0274502 3300045051 Bacteria 1762
421 Ga0451576_1036863 3300045051 Bacteria 859
422 Ga0495603_0072950 3300046455 Bacteria 2017
423 Ga0495594_0409035 3300046499 Bacteria 772
424 Ga0495608_0084613 3300046511 Unclassified 2057
425 Ga0495663_0398383 3300046525 Unclassified 506
426 Ga0495642_0351549 3300046528 Bacteria 648
427 Ga0495621_0085738 3300046539 Bacteria 1181
428 Ga0495633_0574359 3300046558 Bacteria 507
429 Ga0495668_0451283 3300046616 Bacteria 708
430 Ga0495674_0210191 3300047319 Unclassified 1612
431 Ga0496102_1012888 3300048905 Bacteria 751
432 Ga0496102_1191752 3300048905 Bacteria 681
433 Ga0496104_1563615 3300048907 Bacteria 562
434 Ga0496105_0723807 3300048908 Bacteria 762
435 Ga0496106_0294726 3300048909 Unclassified 1301
436 Ga0496108_0899642 3300048911 Bacteria 760
437 Ga0496113_0771224 3300048916 Unclassified 765
438 Ga0496114_0583709 3300048917 Bacteria 986
439 Ga0501306_009693 3300049127 Unclassified 1199
440 Ga0501309_031808 3300049129 Unclassified 781
441 Ga0501309_066039 3300049129 Unclassified 589
442 Ga0501305_012151 3300049161 Bacteria 1174
443 Ga0501307_061357 3300049162 Unclassified 584
444 Ga0501039_0768758 3300049575 Bacteria 752
445 Ga0501039_1076682 3300049575 Unclassified 623
446 Ga0501041_0472018 3300049577 Unclassified 797
447 Ga0501042_0276388 3300049578 Bacteria 1213
448 Ga0501042_1341762 3300049578 Unclassified 522
449 Ga0501071_0653594 3300049587 Bacteria 809
450 Ga0501073_0513717 3300049589 Unclassified 828
451 Ga0501075_0565365 3300049591 Bacteria 868
452 Ga0501076_0777017 3300049592 Unclassified 790
453 Ga0501076_1055309 3300049592 Bacteria 669
454 Ga0501238_083700 3300049671 Bacteria 504
455 Ga0501247_007791 3300049677 Unclassified 1238
456 Ga0501249_019879 3300049679 Unclassified 1459
457 Ga0501081_0152312 3300049743 Bacteria 1662
458 Ga0501081_1316248 3300049743 Unclassified 548
459 Ga0501268_137691 3300049765 Unclassified 554
460 Ga0501272_019455 3300049769 Unclassified 809
461 Ga0501212_033716 3300049851 Unclassified 832
462 nmdc:mga05p37_469436_c1 3300050507 Bacteria 1452
463 nmdc:mga05p37_54_c1 3300050507 Bacteria 25000
464 nmdc:mga09592_199024_c1 3300050508 Unclassified 1735
465 nmdc:mga09592_592404_c1 3300050508 Bacteria 950
466 nmdc:mga09592_613274_c1 3300050508 Unclassified 931
467 nmdc:mga0qj67_423873_c1 3300050509 Unclassified 1073
468 nmdc:mga06r32_12906_c1 3300050510 Bacteria 7552
469 nmdc:mga06r32_435656_c1 3300050510 Unclassified 1291
470 nmdc:mga06r32_733373_c1 3300050510 Bacteria 952
471 nmdc:mga08y16_1117298_c1 3300050511 Unclassified 762
472 nmdc:mga08y16_1430_c1 3300050511 Bacteria 23960
473 nmdc:mga08y16_2667_c1 3300050511 Bacteria 18349
474 nmdc:mga08y16_551421_c1 3300050511 Bacteria 1166
475 nmdc:mga08y16_601162_c1 3300050511 Bacteria 1109
476 nmdc:mga0n895_307627_c1 3300050512 Bacteria 1606
477 nmdc:mga0n895_330476_c1 3300050512 Bacteria 1545
478 nmdc:mga0n895_50361_c1 3300050512 Bacteria 4083
479 nmdc:mga0n895_824293_c1 3300050512 Bacteria 917
480 nmdc:mga0rr50_100472_c1 3300050513 Bacteria 2272
481 nmdc:mga0rr50_11920_c1 3300050513 Bacteria 5590
482 nmdc:mga0rr50_965713_c1 3300050513 Bacteria 726
483 nmdc:mga08x19_1118183_c1 3300050514 Unclassified 559
484 nmdc:mga08x19_574727_c1 3300050514 Unclassified 798
485 nmdc:mga0a205_199571_c1 3300050515 Unclassified 1891
486 nmdc:mga0a205_41944_c1 3300050515 Bacteria 4409
487 nmdc:mga0a205_6628_c1 3300050515 Bacteria 10481
488 nmdc:mga0a205_937166_c1 3300050515 Bacteria 713
489 Ga0495601_0028979 3300053077 Bacteria 3432
490 Ga0501084_1275260 3300054114 Unclassified 616
491 Ga0587114_051296 3300059655 Unclassified 699
492 Ga0501082_0388902 3300060353 Unclassified 1217
493 Ga0105240_10333590
494 Ga0058859_11724100
495 Ga0058863_11455670
496 Ga0058862_12383312
497 Ga0065712_10300078
498 Ga0065715_10210130
499 Ga0065707_10230553
500 Ga0070676_10005607
501 Ga0070683_100765341
502 Ga0070690_100005156
503 Ga0070670_100002863
504 Ga0070670_100338546
505 Ga0070670_100988130
506 Ga0070677_10006087
507 Ga0070677_10064057
508 Ga0070677_10114939
509 Ga0068869_100001349
510 Ga0068869_100086471
511 Ga0068869_101511477
512 Ga0068868_102181813
513 Ga0070689_100003076
514 Ga0070689_100050243
515 Ga0070691_10623174
516 Ga0070687_100008423
517 Ga0070687_100180286
518 Ga0070661_100684137
519 Ga0070661_101385337
520 Ga0070661_101482608
521 Ga0070692_10352266
522 Ga0070692_10614376
523 Ga0070668_100265417
524 Ga0070669_100049569
525 Ga0070669_100437380
526 Ga0070669_100489528
527 Ga0070669_100495692
528 Ga0070669_101341900
529 Ga0070669_101898008
530 Ga0070675_100000720
531 Ga0070675_100127080
532 Ga0070675_100893603
533 Ga0070675_102083384
534 Ga0070671_100020362
535 Ga0070671_100117756
536 Ga0070671_100307788
537 Ga0070671_100342672
538 Ga0070671_101445212
539 Ga0070674_100003693
540 Ga0070674_100031406
541 Ga0070674_100802594
542 Ga0070674_101286662
543 Ga0070673_100026026
544 Ga0070673_100135902
545 Ga0070673_100346977
546 Ga0070688_100008376
547 Ga0070688_100265178
548 Ga0070688_100525903
549 Ga0070659_100220616
550 Ga0070667_100145738
551 Ga0070709_10217139
552 Ga0070701_10020113
553 Ga0070701_10310822
554 Ga0070705_100035956
555 Ga0070700_100052313
556 Ga0070700_100877655
557 Ga0070700_101579513
558 Ga0070694_100896168
559 Ga0070663_100147844
560 Ga0070663_100513104
561 Ga0070678_100050115
562 Ga0070678_101552097
563 Ga0070662_100092985
564 Ga0070662_100321320
565 Ga0070662_101172000
566 Ga0068867_100007728
567 Ga0068867_102418618
568 Ga0070685_10034117
569 Ga0070685_10738757
570 Ga0070707_100687494
571 Ga0070707_100990548
572 Ga0070698_100615260
573 Ga0070698_100733884
574 Ga0070698_101974624
575 Ga0070699_100006091
576 Ga0070697_100556444
577 Ga0070697_100684844
578 Ga0070697_101516706
579 Ga0070672_100084263
580 Ga0070672_100843252
581 Ga0070686_100007696
582 Ga0070695_100484288
583 Ga0070695_100675098
584 Ga0070695_101815618
585 Ga0070696_100316704
586 Ga0070696_100694439
587 Ga0070696_101855126
588 Ga0070665_100904576
589 Ga0070665_101896566
590 Ga0070704_100059633
591 Ga0070704_101699260
592 Ga0068855_101785709
593 Ga0070664_100329639
594 Ga0070664_100741877
595 Ga0070664_100925108
596 Ga0070664_101203204
597 Ga0068857_100673285
598 Ga0068857_101025667
599 Ga0068854_100073566
600 Ga0068854_101823908
601 Ga0068856_101874476
602 Ga0070702_100135902
603 Ga0070702_100513942
604 Ga0068852_100947430
605 Ga0068852_102186919
606 Ga0068859_100006472
607 Ga0068859_100023921
608 Ga0068859_100377276
609 Ga0068859_100451486
610 Ga0068864_100004388
611 Ga0068864_100072448
612 Ga0068864_100107261
613 Ga0068864_100731261
614 Ga0068866_10029404
615 Ga0068866_10086388
616 Ga0068866_11396496
617 Ga0068861_100051582
618 Ga0068861_100471522
619 Ga0068861_100697412
620 Ga0068851_10045469
621 Ga0068870_10033739
622 Ga0068870_10192727
623 Ga0068870_10241875
624 Ga0068870_11288667
625 Ga0068863_100376953
626 Ga0068863_100765491
627 Ga0068858_100007379
628 Ga0068858_100073199
629 Ga0068858_100124476
630 Ga0068860_100010695
631 Ga0068860_100024788
632 Ga0068860_101592633
633 Ga0068862_101745885
634 Ga0081455_10329777
635 Ga0081538_10265449
636 Ga0070717_10878452
637 Ga0075364_10277177
638 Ga0075362_10296242
639 Ga0075367_10121275
640 Ga0075366_10770295
641 Ga0097621_100466496
642 Ga0097621_101063280
643 Ga0068871_100546558
644 Ga0068871_100976041
645 Ga0068871_101712682
646 Ga0075428_100023627
647 Ga0075428_100026824
648 Ga0075428_100304705
649 Ga0075428_100995058
650 Ga0075428_101330241
651 Ga0075428_101413470
652 Ga0075430_100012224
653 Ga0075430_100017467
654 Ga0075430_100564052
655 Ga0075431_100191372
656 Ga0075431_100260098
657 Ga0075431_100722118
658 Ga0075431_100850317
659 Ga0075431_101259497
660 Ga0075433_10011986
661 Ga0075433_10144089
662 Ga0075433_10488587
663 Ga0075433_10941860
664 Ga0075433_11090233
665 Ga0075434_100001320
666 Ga0075434_100020715
667 Ga0075434_100195589
668 Ga0075434_100872723
669 Ga0075429_100596098
670 Ga0068865_100002620
671 Ga0068865_100098467
672 Ga0075436_100352984
673 Ga0075436_100676079
674 Ga0075436_101400506
675 Ga0097620_100006472
676 Ga0097620_100023921
677 Ga0097620_100377302
678 Ga0097620_100451507
679 Ga0075435_100015257
680 Ga0075435_100027608
681 Ga0075435_100074491
682 Ga0075435_100518273
683 Ga0075435_100959705
684 Ga0105250_10364972
685 Ga0111539_10000538
686 Ga0111539_10031943
687 Ga0111539_10202006
688 Ga0111539_10680703
689 Ga0111539_10748289
690 Ga0111539_10961428
691 Ga0105245_11577868
692 Ga0114129_10000410
693 Ga0114129_10022600
694 Ga0114129_10044723
695 Ga0114129_10119765
696 Ga0114129_10611277
697 Ga0105243_10482889
698 Ga0105243_11789008
699 Ga0105241_11632848
700 Ga0105242_10003081
701 Ga0105242_11187452
702 Ga0105248_10019113
703 Ga0105248_10336674
704 Ga0105248_10419444
705 Ga0105248_11543836
706 Ga0105248_12638859
707 Ga0105238_10066414
708 Ga0105238_10458574
709 Ga0105249_12092702
710 Ga0105239_11660045
711 Ga0105246_10025964
712 Ga0105246_10714494
713 Ga0157374_10139917
714 Ga0157378_10393851
715 Ga0157378_10407550
716 Ga0157375_10173711
717 Ga0157375_10596960
718 Ga0157375_11140857
719 Ga0157375_12589933
720 Ga0163163_10076490
721 Ga0163163_10116327
722 Ga0163163_11484367
723 Ga0157380_10047475
724 Ga0157380_10070292
725 Ga0157380_10800939
726 Ga0157380_11347475
727 Ga0157377_10089691
728 Ga0157377_10987640
729 Ga0157379_10321357
730 Ga0157379_11152559
731 Ga0163161_10344551
732 Ga0207697_10329070
733 Ga0207656_10101863
734 Ga0207696_1144952
735 Ga0207682_10014825
736 Ga0207682_10069065
737 Ga0207682_10076746
738 Ga0207682_10162601
739 Ga0207642_10007314
740 Ga0207688_10220546
741 Ga0207688_10305405
742 Ga0207680_10327243
743 Ga0207680_10415263
744 Ga0207680_10610630
745 Ga0207645_10003286
746 Ga0207645_10313665
747 Ga0207645_10456265
748 Ga0207643_10000798
749 Ga0207643_10069010
750 Ga0207643_10118493
751 Ga0207643_10324604
752 Ga0207695_10098965
753 Ga0207662_10008158
754 Ga0207662_10044848
755 Ga0207662_10100475
756 Ga0207662_10113792
757 Ga0207646_11167012
758 Ga0207646_11229388
759 Ga0207646_11923531
760 Ga0207681_10002323
761 Ga0207681_10008900
762 Ga0207681_10085539
763 Ga0207681_10187147
764 Ga0207681_10293524
765 Ga0207681_10534884
766 Ga0207694_10011933
767 Ga0207694_11193089
768 Ga0207650_10010041
769 Ga0207650_10236126
770 Ga0207659_10001151
771 Ga0207659_10001582
772 Ga0207659_10017668
773 Ga0207659_10049430
774 Ga0207659_11011692
775 Ga0207687_10916074
776 Ga0207687_11755659
777 Ga0207644_10001879
778 Ga0207644_10367772
779 Ga0207644_10396163
780 Ga0207644_10796573
781 Ga0207690_11011827
782 Ga0207690_11316427
783 Ga0207706_10052979
784 Ga0207706_10702577
785 Ga0207706_11269520
786 Ga0207686_10018003
787 Ga0207686_11082416
788 Ga0207709_10006067
789 Ga0207709_10069419
790 Ga0207670_10008307
791 Ga0207670_10017981
792 Ga0207670_10091157
793 Ga0207669_10003962
794 Ga0207669_10873051
795 Ga0207669_11221385
796 Ga0207704_10004609
797 Ga0207704_10142535
798 Ga0207704_10740845
799 Ga0207691_10011845
800 Ga0207691_10172592
801 Ga0207691_10262865
802 Ga0207711_10045150
803 Ga0207711_10146388
804 Ga0207711_10318772
805 Ga0207689_10004204
806 Ga0207689_10057056
807 Ga0207689_10159872
808 Ga0207689_10170448
809 Ga0207689_11216525
810 Ga0207661_10680499
811 Ga0207679_10228646
812 Ga0207679_10662285
813 Ga0207679_10697073
814 Ga0207651_10026464
815 Ga0207651_10072368
816 Ga0207651_10098846
817 Ga0207712_10105975
818 Ga0207712_11990056
819 Ga0207668_10030255
820 Ga0207668_10461471
821 Ga0207668_10497462
822 Ga0207640_10066231
823 Ga0207640_10416826
824 Ga0207658_10295866
825 Ga0207677_11165634
826 Ga0207677_12251736
827 Ga0207703_10026711
828 Ga0207703_10076756
829 Ga0207703_10483061
830 Ga0207703_11475942
831 Ga0207678_10169420
832 Ga0207678_10425319
833 Ga0207708_10033893
834 Ga0207708_10034447
835 Ga0207708_10155007
836 Ga0207708_11308046
837 Ga0207708_11827810
838 Ga0207702_11013819
839 Ga0207641_10080464
840 Ga0207641_10555305
841 Ga0207641_10679530
842 Ga0207648_10002414
843 Ga0207648_10005116
844 Ga0207648_11209877
845 Ga0207648_11331807
846 Ga0207648_11824977
847 Ga0207676_10028393
848 Ga0207676_10036535
849 Ga0207676_10105682
850 Ga0207676_10182361
851 Ga0207676_10183303
852 Ga0207674_10002954
853 Ga0207674_10056360
854 Ga0207674_11965808
855 Ga0207675_100011835
856 Ga0207675_100014871
857 Ga0207698_11903504
858 Ga0209983_1110850
859 Ga0209998_10155326
860 Ga0209974_10109730
861 Ga0207428_10001764
862 Ga0207428_10807824
863 Ga0268266_11227436
864 Ga0268266_12154851
865 Ga0268265_10002294
866 Ga0268265_12096905
867 Ga0268264_10017071
868 Ga0268264_10047086
869 Ga0268264_10538252
870 Ga0268264_11541566
871 Ga0307408_100010627
872 Ga0307408_100564494
873 Ga0307408_101628991
874 Ga0307405_10023833
875 Ga0307405_10142383
876 Ga0307413_10025255
877 Ga0307413_10280606
878 Ga0307410_10016065
879 Ga0307410_11465294
880 Ga0307406_10173121
881 Ga0307406_10274463
882 Ga0307406_11476999
883 Ga0307407_10012971
884 Ga0307412_10000537
885 Ga0307412_10132100
886 Ga0307412_10188809
887 Ga0307409_100008546
888 Ga0307409_100401316
889 Ga0307409_100813308
890 Ga0307416_100017724
891 Ga0307416_100481559
892 Ga0307416_100850172
893 Ga0307416_103096473
894 Ga0307414_10003606
895 Ga0307411_10029269
896 Ga0307411_10053812
897 Ga0307415_100408512
898 Ga0307415_100537612
899 Ga0307415_102588913
900 Ga0373951_0150830
901 Ga0373923_0012979
902 Ga0373941_0415569
903 Ga0373933_0234139
904 Ga0373937_0004422
905 Ga0451805_109762
906 Ga0439444_0095180
907 Ga0439460_0110231
908 Ga0450916_053108
909 Ga0451577_0205803
910 Ga0439440_0250474
911 Ga0451576_0176456
912 Ga0451576_0274502
913 Ga0451576_1036863
914 Ga0495603_0072950
915 Ga0495594_0409035
916 Ga0495608_0084613
917 Ga0495663_0398383
918 Ga0495642_0351549
919 Ga0495621_0085738
920 Ga0495633_0574359
921 Ga0495668_0451283
922 Ga0495674_0210191
923 Ga0496102_1012888
924 Ga0496102_1191752
925 Ga0496104_1563615
926 Ga0496105_0723807
927 Ga0496106_0294726
928 Ga0496108_0899642
929 Ga0496113_0771224
930 Ga0496114_0583709
931 Ga0501306_009693
932 Ga0501309_031808
933 Ga0501309_066039
934 Ga0501305_012151
935 Ga0501307_061357
936 Ga0501039_0768758
937 Ga0501039_1076682
938 Ga0501041_0472018
939 Ga0501042_0276388
940 Ga0501042_1341762
941 Ga0501071_0653594
942 Ga0501073_0513717
943 Ga0501075_0565365
944 Ga0501076_0777017
945 Ga0501076_1055309
946 Ga0501238_083700
947 Ga0501247_007791
948 Ga0501249_019879
949 Ga0501081_0152312
950 Ga0501081_1316248
951 Ga0501268_137691
952 Ga0501272_019455
953 Ga0501212_033716
954 nmdc:mga05p37_469436_c1
955 nmdc:mga05p37_54_c1
956 nmdc:mga09592_199024_c1
957 nmdc:mga09592_592404_c1
958 nmdc:mga09592_613274_c1
959 nmdc:mga0qj67_423873_c1
960 nmdc:mga06r32_12906_c1
961 nmdc:mga06r32_435656_c1
962 nmdc:mga06r32_733373_c1
963 nmdc:mga08y16_1117298_c1
964 nmdc:mga08y16_1430_c1
965 nmdc:mga08y16_2667_c1
966 nmdc:mga08y16_551421_c1
967 nmdc:mga08y16_601162_c1
968 nmdc:mga0n895_307627_c1
969 nmdc:mga0n895_330476_c1
970 nmdc:mga0n895_50361_c1
971 nmdc:mga0n895_824293_c1
972 nmdc:mga0rr50_100472_c1
973 nmdc:mga0rr50_11920_c1
974 nmdc:mga0rr50_965713_c1
975 nmdc:mga08x19_1118183_c1
976 nmdc:mga08x19_574727_c1
977 nmdc:mga0a205_199571_c1
978 nmdc:mga0a205_41944_c1
979 nmdc:mga0a205_6628_c1
980 nmdc:mga0a205_937166_c1
981 Ga0495601_0028979
982 Ga0501084_1275260
983 Ga0587114_051296
984 Ga0501082_0388902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00076

RRM_1

RNA recognition motif

10

80

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ilz-assembly1.cif.gz_A crystal structure of the rrm domain of human setd1b 0.984 4 77
3s8s-assembly1.cif.gz_A crystal structure of the rrm domain of human setd1a 0.9829 3 79
2rra-assembly1.cif.gz_A solution structure of rna binding domain in human tra2 beta protein in complex with rna (gaagaa) 0.9816 4 77
3bs9-assembly3.cif.gz_B x-ray structure of human tia-1 rrm2 0.9739 3 80
3cw1-assembly2.cif.gz_6 crystal structure of human spliceosomal u1 snrnp 0.9722 5 77
ID Description Score Start End Superfamily
af_Q8LHN4_54_155_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9949 4 77 3.30.70.330
af_A0A0G2K6T6_88_197_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9917 3 77 3.30.70.330
af_Q4D7Y1_186_276_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9903 3 77 3.30.70.330
af_E9AHW1_166_273_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9895 3 77 3.30.70.330
af_A4HTS6_2_104_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9879 4 80 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A6J5VME7-F1-model_v4 RRM domain-containing protein 0.9913 4 79 GO:0003729
GO:0005634
GO:0016020
AF-A0A811R8Q1-F1-model_v4 Kinesin-like protein 0.9869 1 79 GO:0003723
GO:0003777
GO:0005524
GO:0005874
GO:0007018
GO:0008017
AF-A0A3L6EC18-F1-model_v4 Kinesin-like protein 0.9859 2 79 GO:0003729
GO:0003777
GO:0005524
GO:0005874
GO:0007018
GO:0008017
AF-A0A6L4ZM51-F1-model_v4 RNA-binding region RNP-1 0.9776 1 79 GO:0003723
AF-A0A286UH43-F1-model_v4 RNA-binding domain-containing 0.9774 1 86 GO:0003723
GO:0005634
GO:0016020

Map