F454039

General Info

Members Datasets Scaffolds Average Seq Length
491 201 491 230

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10004211|JGI25406J46586_100042111
Length 255
Sequence MFITLDFRRLTRRIPFNLICAVLIFLAASQAAKADELAVWNFNDSNLNVDHGSGTLTTNINAVNVLFAAGTTNNARQGDPAGQALSLQGGTGNANNGRNLTFNVSTVGFSNITVSLATQGTSTGFNSNQFQYSLDGISFIDFGAPFTPATAFGTVPIVFSLAAIVGLNNNPNAAFRIVFNGATSSTGNNRIDNIVVEGTSIDTAEVPEPMSVLLLASGLGGLYKLKKRKRTTHGRPRRAAPTVVANQTTSAGGAR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
170 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
179 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
180 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
181 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
182 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
183 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
184 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
185 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
186 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
187 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
188 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
189 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
190 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
191 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
192 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
193 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.43
Rhizosphere 98.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2330233 2162886007 Bacteria 1605
2 JGI25406J46586_10004211 3300003203 Bacteria 6718
3 Ga0065714_10064424 3300005288 Bacteria 236118
4 Ga0065704_10005604 3300005289 Unclassified 3481
5 Ga0065712_10000117 3300005290 Bacteria 235194
6 Ga0065715_10003510 3300005293 Bacteria 4159
7 Ga0065715_10014371 3300005293 Bacteria 2242
8 Ga0065715_10090755 3300005293 Bacteria 6513
9 Ga0065715_10092012 3300005293 Bacteria 5386
10 Ga0065715_10170584 3300005293 Unclassified 1550
11 Ga0065715_10191518 3300005293 Bacteria 1407
12 Ga0065707_10000629 3300005295 Bacteria 15551
13 Ga0065707_10474264 3300005295 Unclassified 779
14 Ga0070676_10027506 3300005328 Bacteria 3226
15 Ga0070670_100005052 3300005331 Bacteria 11103
16 Ga0070670_100224096 3300005331 Unclassified 1636
17 Ga0070670_100264510 3300005331 Bacteria 1500
18 Ga0068869_100150233 3300005334 Unclassified 1806
19 Ga0070666_10107909 3300005335 Unclassified 1924
20 Ga0070680_100001485 3300005336 Bacteria 17047
21 Ga0070682_100010093 3300005337 Bacteria 5353
22 Ga0068868_100012234 3300005338 Bacteria 6271
23 Ga0068868_100451517 3300005338 Bacteria 1118
24 Ga0070660_100024124 3300005339 Unclassified 4512
25 Ga0070689_100043530 3300005340 Unclassified 3451
26 Ga0070689_100088187 3300005340 Bacteria 2441
27 Ga0070687_100034863 3300005343 Bacteria 2494
28 Ga0070687_100142339 3300005343 Unclassified 1398
29 Ga0070692_10056629 3300005345 Bacteria 2053
30 Ga0070668_100588264 3300005347 Unclassified 972
31 Ga0070669_100167668 3300005353 Unclassified 1710
32 Ga0070669_100193803 3300005353 Bacteria 1595
33 Ga0070669_100336569 3300005353 Unclassified 1222
34 Ga0070675_100018498 3300005354 Bacteria 5547
35 Ga0070675_100456897 3300005354 Bacteria 1146
36 Ga0070675_100725193 3300005354 Unclassified 906
37 Ga0070675_100855638 3300005354 Unclassified 832
38 Ga0070671_100012017 3300005355 Bacteria 6964
39 Ga0070671_100164886 3300005355 Unclassified 1873
40 Ga0070673_100006763 3300005364 Bacteria 7482
41 Ga0070673_100135901 3300005364 Bacteria 2069
42 Ga0070673_100680506 3300005364 Bacteria 943
43 Ga0070688_100617881 3300005365 Unclassified 831
44 Ga0070659_100008215 3300005366 Bacteria 7621
45 Ga0070659_100239242 3300005366 Bacteria 1502
46 Ga0070667_100090294 3300005367 Unclassified 2633
47 Ga0070667_100585756 3300005367 Unclassified 1027
48 Ga0070703_10034082 3300005406 Bacteria 1552
49 Ga0070701_10139947 3300005438 Unclassified 1383
50 Ga0070701_10169461 3300005438 Bacteria 1270
51 Ga0070701_10250888 3300005438 Unclassified 1068
52 Ga0070705_100238438 3300005440 Bacteria 1270
53 Ga0070705_100302015 3300005440 Bacteria 1148
54 Ga0070705_100382537 3300005440 Unclassified 1036
55 Ga0070700_100000339 3300005441 Bacteria 24180
56 Ga0070700_100004525 3300005441 Bacteria 7271
57 Ga0070700_100018601 3300005441 Unclassified 3997
58 Ga0070700_100607294 3300005441 Unclassified 858
59 Ga0070694_100060785 3300005444 Bacteria 2578
60 Ga0070694_100104820 3300005444 Bacteria 2006
61 Ga0070694_100191357 3300005444 Bacteria 1519
62 Ga0070694_100310629 3300005444 Bacteria 1211
63 Ga0070663_100111470 3300005455 Unclassified 2056
64 Ga0070678_100086616 3300005456 Unclassified 2390
65 Ga0070662_100125253 3300005457 Bacteria 1974
66 Ga0070681_10000059 3300005458 Bacteria 78995
67 Ga0070681_10001827 3300005458 Bacteria 19182
68 Ga0070681_10002994 3300005458 Bacteria 15675
69 Ga0070685_10079784 3300005466 Unclassified 1959
70 Ga0070706_100000146 3300005467 Bacteria 89818
71 Ga0070706_100002020 3300005467 Bacteria 20818
72 Ga0070706_100055012 3300005467 Bacteria 3673
73 Ga0070707_100036985 3300005468 Bacteria 4658
74 Ga0070707_100112686 3300005468 Bacteria 2639
75 Ga0070707_100526446 3300005468 Unclassified 1144
76 Ga0070698_100007663 3300005471 Bacteria 11679
77 Ga0070698_100013866 3300005471 Bacteria 8522
78 Ga0070698_100022421 3300005471 Bacteria 6606
79 Ga0070699_100001419 3300005518 Bacteria 22009
80 Ga0070679_100006336 3300005530 Bacteria 11018
81 Ga0070679_100029217 3300005530 Bacteria 5439
82 Ga0070697_100023304 3300005536 Bacteria 4923
83 Ga0070697_100149979 3300005536 Bacteria 1965
84 Ga0070697_100161194 3300005536 Bacteria 1895
85 Ga0068853_100002135 3300005539 Bacteria 14717
86 Ga0068853_100042955 3300005539 Bacteria 3867
87 Ga0068853_100071358 3300005539 Unclassified 3024
88 Ga0068853_100137718 3300005539 Bacteria 2189
89 Ga0070672_100020036 3300005543 Bacteria 4872
90 Ga0070672_100087506 3300005543 Bacteria 2507
91 Ga0070686_100082174 3300005544 Bacteria 2136
92 Ga0070695_100029911 3300005545 Bacteria 3388
93 Ga0070695_100111820 3300005545 Bacteria 1855
94 Ga0070695_100125867 3300005545 Unclassified 1759
95 Ga0070695_100212389 3300005545 Bacteria 1390
96 Ga0070695_100380677 3300005545 Bacteria 1065
97 Ga0070695_100448027 3300005545 Unclassified 988
98 Ga0070696_100033954 3300005546 Unclassified 3508
99 Ga0070696_100079685 3300005546 Bacteria 2317
100 Ga0070696_100716702 3300005546 Unclassified 817
101 Ga0070693_100048562 3300005547 Bacteria 2418
102 Ga0070693_100066423 3300005547 Unclassified 2111
103 Ga0070693_100258875 3300005547 Bacteria 1156
104 Ga0070693_100516544 3300005547 Unclassified 850
105 Ga0070693_100646611 3300005547 Unclassified 768
106 Ga0070704_100015585 3300005549 Bacteria 4778
107 Ga0070704_100018417 3300005549 Unclassified 4466
108 Ga0070704_100042998 3300005549 Unclassified 3130
109 Ga0070704_100074875 3300005549 Bacteria 2471
110 Ga0070704_100090047 3300005549 Bacteria 2284
111 Ga0070704_100171487 3300005549 Bacteria 1726
112 Ga0070704_100908186 3300005549 Unclassified 792
113 Ga0068855_100083880 3300005563 Bacteria 3691
114 Ga0068855_100514098 3300005563 Bacteria 1300
115 Ga0070664_100009532 3300005564 Bacteria 7874
116 Ga0068857_100021195 3300005577 Bacteria 5718
117 Ga0068857_100029578 3300005577 Unclassified 4834
118 Ga0068857_100184158 3300005577 Bacteria 1901
119 Ga0068857_100658878 3300005577 Unclassified 992
120 Ga0068857_100698614 3300005577 Unclassified 963
121 Ga0068854_100366401 3300005578 Bacteria 1183
122 Ga0068854_100402040 3300005578 Unclassified 1134
123 Ga0068854_100466332 3300005578 Unclassified 1058
124 Ga0068854_100696385 3300005578 Unclassified 876
125 Ga0068856_100002834 3300005614 Bacteria 17755
126 Ga0070702_100061320 3300005615 Unclassified 2189
127 Ga0070702_100063493 3300005615 Bacteria 2156
128 Ga0070702_100491869 3300005615 Bacteria 899
129 Ga0068852_100455934 3300005616 Bacteria 1266
130 Ga0068852_100559041 3300005616 Bacteria 1145
131 Ga0068859_100004843 3300005617 Bacteria 13701
132 Ga0068859_100048869 3300005617 Unclassified 4249
133 Ga0068859_100059679 3300005617 Unclassified 3843
134 Ga0068859_100070073 3300005617 Unclassified 3542
135 Ga0068859_100081088 3300005617 Unclassified 3286
136 Ga0068859_100087662 3300005617 Bacteria 3161
137 Ga0068859_100180550 3300005617 Unclassified 2193
138 Ga0068859_100184781 3300005617 Bacteria 2168
139 Ga0068859_100186302 3300005617 Unclassified 2159
140 Ga0068859_100217270 3300005617 Bacteria 1999
141 Ga0068859_100568808 3300005617 Unclassified 1227
142 Ga0068859_100780528 3300005617 Bacteria 1044
143 Ga0068864_100033768 3300005618 Bacteria 4350
144 Ga0068864_100068180 3300005618 Unclassified 3090
145 Ga0068864_100133553 3300005618 Bacteria 2232
146 Ga0068864_100190549 3300005618 Unclassified 1879
147 Ga0068864_100216065 3300005618 Bacteria 1767
148 Ga0068864_100667706 3300005618 Bacteria 1013
149 Ga0068861_100004130 3300005719 Bacteria 9738
150 Ga0068861_100106003 3300005719 Bacteria 2245
151 Ga0068861_100293125 3300005719 Unclassified 1406
152 Ga0068861_100588625 3300005719 Unclassified 1019
153 Ga0068851_10002239 3300005834 Bacteria 8507
154 Ga0068870_10196554 3300005840 Unclassified 1220
155 Ga0068870_10201040 3300005840 Unclassified 1208
156 Ga0068863_100136756 3300005841 Bacteria 2341
157 Ga0068863_100157822 3300005841 Bacteria 2172
158 Ga0068863_100577459 3300005841 Unclassified 1111
159 Ga0068858_100029238 3300005842 Bacteria 5116
160 Ga0068858_100141400 3300005842 Bacteria 2259
161 Ga0068858_100194423 3300005842 Bacteria 1917
162 Ga0068858_100495749 3300005842 Bacteria 1180
163 Ga0068858_100543499 3300005842 Bacteria 1124
164 Ga0068860_100009979 3300005843 Bacteria 9412
165 Ga0068860_100072657 3300005843 Unclassified 3269
166 Ga0068860_100742177 3300005843 Unclassified 993
167 Ga0068862_100023710 3300005844 Bacteria 5143
168 Ga0068862_100300142 3300005844 Bacteria 1477
169 Ga0068862_100581385 3300005844 Bacteria 1073
170 Ga0081539_10001528 3300005985 Bacteria 38775
171 Ga0081539_10002349 3300005985 Bacteria 27185
172 Ga0075432_10010578 3300006058 Unclassified 3133
173 Ga0097621_100001118 3300006237 Bacteria 18699
174 Ga0097621_100058489 3300006237 Unclassified 3154
175 Ga0097621_100196581 3300006237 Bacteria 1749
176 Ga0068871_100014977 3300006358 Bacteria 5797
177 Ga0068871_100019099 3300006358 Bacteria 5227
178 Ga0075430_100012549 3300006846 Bacteria 7214
179 Ga0075431_100115632 3300006847 Unclassified 2769
180 Ga0075433_10011710 3300006852 Bacteria 7064
181 Ga0075433_10011879 3300006852 Bacteria 7015
182 Ga0075433_10071304 3300006852 Bacteria 3054
183 Ga0075433_10118310 3300006852 Unclassified 2352
184 Ga0075433_10234644 3300006852 Bacteria 1629
185 Ga0075433_10355410 3300006852 Bacteria 1294
186 Ga0075433_10753799 3300006852 Unclassified 851
187 Ga0075434_100042493 3300006871 Unclassified 4506
188 Ga0075434_100369813 3300006871 Unclassified 1455
189 Ga0075434_100765181 3300006871 Unclassified 982
190 Ga0097620_100004843 3300006931 Bacteria 13701
191 Ga0097620_100048868 3300006931 Unclassified 4249
192 Ga0097620_100048971 3300006931 Unclassified 4244
193 Ga0097620_100059673 3300006931 Unclassified 3843
194 Ga0097620_100070073 3300006931 Unclassified 3542
195 Ga0097620_100081093 3300006931 Unclassified 3286
196 Ga0097620_100083556 3300006931 Bacteria 3236
197 Ga0097620_100087660 3300006931 Bacteria 3161
198 Ga0097620_100180542 3300006931 Unclassified 2193
199 Ga0097620_100184788 3300006931 Bacteria 2168
200 Ga0097620_100186300 3300006931 Unclassified 2159
201 Ga0097620_100217274 3300006931 Bacteria 1999
202 Ga0097620_100568804 3300006931 Unclassified 1227
203 Ga0097620_100780530 3300006931 Bacteria 1044
204 Ga0075435_100272311 3300007076 Bacteria 1444
205 Ga0075435_100387659 3300007076 Bacteria 1201
206 Ga0105251_10061761 3300009011 Unclassified 1761
207 Ga0105240_10326272 3300009093 Unclassified 1748
208 Ga0111539_10000643 3300009094 Bacteria 45175
209 Ga0111539_10053045 3300009094 Bacteria 4827
210 Ga0111539_10265984 3300009094 Bacteria 1996
211 Ga0105245_11115978 3300009098 Unclassified 835
212 Ga0105247_10002991 3300009101 Bacteria 11207
213 Ga0105247_10066473 3300009101 Bacteria 2245
214 Ga0105247_10081782 3300009101 Bacteria 2037
215 Ga0114129_10016771 3300009147 Bacteria 10428
216 Ga0114129_10066342 3300009147 Bacteria 5035
217 Ga0114129_10263046 3300009147 Bacteria 2311
218 Ga0114129_10379340 3300009147 Bacteria 1867
219 Ga0114129_10566755 3300009147 Bacteria 1475
220 Ga0114129_10846805 3300009147 Unclassified 1163
221 Ga0114129_10850344 3300009147 Bacteria 1160
222 Ga0105243_10010203 3300009148 Bacteria 7140
223 Ga0105243_10292297 3300009148 Bacteria 1473
224 Ga0105243_10371009 3300009148 Bacteria 1320
225 Ga0105243_10777058 3300009148 Bacteria 942
226 Ga0105241_10024831 3300009174 Bacteria 4453
227 Ga0105241_10121379 3300009174 Bacteria 2105
228 Ga0105241_10432270 3300009174 Unclassified 1161
229 Ga0105241_10542608 3300009174 Bacteria 1043
230 Ga0105241_10546829 3300009174 Bacteria 1039
231 Ga0105242_10020415 3300009176 Bacteria 5195
232 Ga0105242_10305752 3300009176 Unclassified 1453
233 Ga0105248_10003524 3300009177 Bacteria 17356
234 Ga0105248_10004854 3300009177 Bacteria 14888
235 Ga0105248_10019074 3300009177 Bacteria 7584
236 Ga0105248_10137502 3300009177 Bacteria 2756
237 Ga0105248_10329178 3300009177 Bacteria 1720
238 Ga0105248_10520707 3300009177 Unclassified 1341
239 Ga0105248_10598859 3300009177 Bacteria 1244
240 Ga0105248_10620659 3300009177 Unclassified 1220
241 Ga0105248_10660569 3300009177 Bacteria 1179
242 Ga0105248_10905829 3300009177 Unclassified 996
243 Ga0105237_10003725 3300009545 Bacteria 17950
244 Ga0105237_10157823 3300009545 Bacteria 2266
245 Ga0105237_10323475 3300009545 Bacteria 1546
246 Ga0105238_10017969 3300009551 Bacteria 7188
247 Ga0105238_10115533 3300009551 Bacteria 2663
248 Ga0105249_10045998 3300009553 Bacteria 3971
249 Ga0105249_10057857 3300009553 Unclassified 3552
250 Ga0105249_10175287 3300009553 Bacteria 2082
251 Ga0105239_10358724 3300010375 Unclassified 1646
252 Ga0105239_10583673 3300010375 Bacteria 1274
253 Ga0105239_10703514 3300010375 Unclassified 1155
254 Ga0105239_10915412 3300010375 Bacteria 1007
255 Ga0105239_10996570 3300010375 Unclassified 963
256 Ga0105246_10005146 3300011119 Bacteria 7952
257 Ga0157373_10039698 3300013100 Bacteria 3369
258 Ga0157373_10640739 3300013100 Unclassified 775
259 Ga0157371_10631690 3300013102 Unclassified 798
260 Ga0157378_10004042 3300013297 Bacteria 12955
261 Ga0157378_10312254 3300013297 Bacteria 1525
262 Ga0163162_10006421 3300013306 Bacteria 11387
263 Ga0163162_10131953 3300013306 Unclassified 2607
264 Ga0163162_10470167 3300013306 Bacteria 1389
265 Ga0163162_10573535 3300013306 Unclassified 1256
266 Ga0163162_10972471 3300013306 Bacteria 959
267 Ga0163162_11149072 3300013306 Bacteria 880
268 Ga0157372_10033341 3300013307 Bacteria 5655
269 Ga0157372_10274828 3300013307 Unclassified 1958
270 Ga0157375_10002366 3300013308 Bacteria 16302
271 Ga0157375_10055622 3300013308 Unclassified 3902
272 Ga0157375_10088574 3300013308 Bacteria 3150
273 Ga0157375_10118752 3300013308 Unclassified 2751
274 Ga0163163_10000879 3300014325 Bacteria 25575
275 Ga0163163_10013358 3300014325 Bacteria 7516
276 Ga0163163_10017580 3300014325 Bacteria 6673
277 Ga0163163_10145747 3300014325 Unclassified 2411
278 Ga0163163_10184628 3300014325 Unclassified 2133
279 Ga0163163_10244804 3300014325 Unclassified 1843
280 Ga0163163_10285715 3300014325 Bacteria 1702
281 Ga0163163_10453882 3300014325 Unclassified 1342
282 Ga0163163_10457086 3300014325 Unclassified 1337
283 Ga0163163_10586207 3300014325 Unclassified 1178
284 Ga0163163_11256885 3300014325 Bacteria 803
285 Ga0157380_10030653 3300014326 Bacteria 4121
286 Ga0157380_10348997 3300014326 Bacteria 1384
287 Ga0157379_10071861 3300014968 Bacteria 3095
288 Ga0157376_10232119 3300014969 Bacteria 1715
289 Ga0207656_10002835 3300025321 Bacteria 5900
290 Ga0207653_10005743 3300025885 Bacteria 3869
291 Ga0207710_10001694 3300025900 Bacteria 10687
292 Ga0207710_10132136 3300025900 Unclassified 1199
293 Ga0207680_10196815 3300025903 Unclassified 1371
294 Ga0207647_10008061 3300025904 Bacteria 7574
295 Ga0207647_10203869 3300025904 Bacteria 1144
296 Ga0207645_10241008 3300025907 Unclassified 1195
297 Ga0207645_10273949 3300025907 Bacteria 1119
298 Ga0207643_10000740 3300025908 Bacteria 20063
299 Ga0207643_10151149 3300025908 Unclassified 1392
300 Ga0207643_10274886 3300025908 Bacteria 1043
301 Ga0207684_10000327 3300025910 Bacteria 67005
302 Ga0207684_10014097 3300025910 Bacteria 6903
303 Ga0207684_10595883 3300025910 Unclassified 944
304 Ga0207654_10111829 3300025911 Unclassified 1701
305 Ga0207654_10187833 3300025911 Bacteria 1352
306 Ga0207654_10323174 3300025911 Bacteria 1055
307 Ga0207654_10497711 3300025911 Bacteria 860
308 Ga0207707_10000097 3300025912 Bacteria 88081
309 Ga0207707_10008125 3300025912 Bacteria 9112
310 Ga0207707_10014773 3300025912 Bacteria 6803
311 Ga0207695_10417563 3300025913 Unclassified 1226
312 Ga0207671_10001860 3300025914 Bacteria 23563
313 Ga0207671_10196131 3300025914 Bacteria 1576
314 Ga0207660_10024248 3300025917 Unclassified 4105
315 Ga0207662_10013940 3300025918 Unclassified 4499
316 Ga0207662_10041400 3300025918 Bacteria 2712
317 Ga0207662_10051671 3300025918 Bacteria 2445
318 Ga0207657_10052505 3300025919 Unclassified 3537
319 Ga0207652_10004707 3300025921 Bacteria 11063
320 Ga0207652_10020793 3300025921 Bacteria 5409
321 Ga0207646_10137028 3300025922 Bacteria 2204
322 Ga0207646_10165367 3300025922 Bacteria 1997
323 Ga0207681_10134725 3300025923 Bacteria 1831
324 Ga0207681_10153379 3300025923 Unclassified 1729
325 Ga0207681_10306532 3300025923 Unclassified 1258
326 Ga0207694_10010187 3300025924 Bacteria 7085
327 Ga0207650_10000143 3300025925 Bacteria 87521
328 Ga0207650_10018188 3300025925 Bacteria 4929
329 Ga0207650_10188394 3300025925 Bacteria 1647
330 Ga0207650_10238799 3300025925 Unclassified 1468
331 Ga0207659_10132478 3300025926 Unclassified 1926
332 Ga0207644_10262917 3300025931 Unclassified 1380
333 Ga0207644_10689479 3300025931 Unclassified 851
334 Ga0207690_10007233 3300025932 Bacteria 6592
335 Ga0207690_10165185 3300025932 Bacteria 1654
336 Ga0207706_10130871 3300025933 Unclassified 2207
337 Ga0207686_10106708 3300025934 Bacteria 1881
338 Ga0207686_10682298 3300025934 Unclassified 815
339 Ga0207709_10004361 3300025935 Bacteria 8188
340 Ga0207670_10005158 3300025936 Bacteria 7143
341 Ga0207670_10044141 3300025936 Unclassified 2948
342 Ga0207670_10373278 3300025936 Bacteria 1134
343 Ga0207704_10477747 3300025938 Bacteria 1000
344 Ga0207691_10217127 3300025940 Unclassified 1659
345 Ga0207691_10358101 3300025940 Bacteria 1248
346 Ga0207691_10387851 3300025940 Bacteria 1192
347 Ga0207711_10011050 3300025941 Bacteria 7504
348 Ga0207711_10052903 3300025941 Unclassified 3481
349 Ga0207711_10394573 3300025941 Unclassified 1285
350 Ga0207711_10732590 3300025941 Unclassified 922
351 Ga0207689_10058293 3300025942 Bacteria 3176
352 Ga0207689_10529615 3300025942 Bacteria 989
353 Ga0207679_10036527 3300025945 Unclassified 3485
354 Ga0207679_10073440 3300025945 Bacteria 2588
355 Ga0207679_10073685 3300025945 Unclassified 2584
356 Ga0207679_10119508 3300025945 Bacteria 2095
357 Ga0207679_10198632 3300025945 Unclassified 1674
358 Ga0207679_10356457 3300025945 Unclassified 1276
359 Ga0207679_10477249 3300025945 Bacteria 1110
360 Ga0207679_10954083 3300025945 Unclassified 786
361 Ga0207667_10265773 3300025949 Unclassified 1754
362 Ga0207667_10553447 3300025949 Bacteria 1163
363 Ga0207667_10756799 3300025949 Unclassified 970
364 Ga0207651_10024983 3300025960 Unclassified 3706
365 Ga0207651_10090577 3300025960 Bacteria 2236
366 Ga0207651_10585703 3300025960 Bacteria 974
367 Ga0207712_10018505 3300025961 Bacteria 4539
368 Ga0207712_10161255 3300025961 Bacteria 1743
369 Ga0207668_10523077 3300025972 Unclassified 1024
370 Ga0207640_10128568 3300025981 Unclassified 1827
371 Ga0207640_10404513 3300025981 Unclassified 1113
372 Ga0207640_10469206 3300025981 Unclassified 1041
373 Ga0207677_10002150 3300026023 Bacteria 10360
374 Ga0207703_10014860 3300026035 Bacteria 6076
375 Ga0207703_10384713 3300026035 Bacteria 1299
376 Ga0207703_10416827 3300026035 Bacteria 1249
377 Ga0207703_10504485 3300026035 Unclassified 1136
378 Ga0207703_10704646 3300026035 Bacteria 960
379 Ga0207639_10018456 3300026041 Bacteria 4957
380 Ga0207639_10062640 3300026041 Bacteria 2877
381 Ga0207639_10248392 3300026041 Unclassified 1550
382 Ga0207678_10137633 3300026067 Unclassified 2084
383 Ga0207708_10000499 3300026075 Bacteria 30185
384 Ga0207708_10013997 3300026075 Bacteria 5992
385 Ga0207708_10045118 3300026075 Unclassified 3359
386 Ga0207708_10049293 3300026075 Bacteria 3206
387 Ga0207702_10034428 3300026078 Bacteria 4234
388 Ga0207641_10052921 3300026088 Unclassified 3440
389 Ga0207641_10258665 3300026088 Bacteria 1629
390 Ga0207641_10607137 3300026088 Bacteria 1072
391 Ga0207641_10648890 3300026088 Bacteria 1036
392 Ga0207641_11163476 3300026088 Unclassified 771
393 Ga0207648_10341536 3300026089 Bacteria 1348
394 Ga0207676_10005088 3300026095 Bacteria 9303
395 Ga0207676_10007355 3300026095 Bacteria 7810
396 Ga0207676_10053115 3300026095 Bacteria 3170
397 Ga0207676_10095886 3300026095 Unclassified 2447
398 Ga0207676_10467647 3300026095 Bacteria 1192
399 Ga0207676_10610467 3300026095 Unclassified 1049
400 Ga0207674_10000129 3300026116 Bacteria 88458
401 Ga0207674_10152136 3300026116 Unclassified 2270
402 Ga0207674_10159160 3300026116 Unclassified 2213
403 Ga0207674_10418865 3300026116 Unclassified 1294
404 Ga0207675_100007393 3300026118 Bacteria 10380
405 Ga0207675_100059348 3300026118 Bacteria 3570
406 Ga0207675_100186716 3300026118 Bacteria 1987
407 Ga0207675_100189679 3300026118 Bacteria 1971
408 Ga0207675_100597407 3300026118 Bacteria 1106
409 Ga0207683_10357842 3300026121 Unclassified 1340
410 Ga0207698_10027818 3300026142 Unclassified 4020
411 Ga0207698_10869622 3300026142 Bacteria 907
412 Ga0207698_11003457 3300026142 Unclassified 845
413 Ga0207428_10001094 3300027907 Bacteria 29497
414 Ga0207428_10238832 3300027907 Bacteria 1358
415 Ga0268266_10446628 3300028379 Bacteria 1229
416 Ga0268265_10036076 3300028380 Bacteria 3619
417 Ga0268265_10154168 3300028380 Viruses 1942
418 Ga0268265_10365809 3300028380 Bacteria 1322
419 Ga0268265_10429810 3300028380 Unclassified 1228
420 Ga0268264_10018706 3300028381 Bacteria 5664
421 Ga0268264_10048980 3300028381 Unclassified 3514
422 Ga0268264_10118489 3300028381 Bacteria 2330
423 Ga0268264_10297517 3300028381 Unclassified 1518
424 Ga0268264_10630430 3300028381 Bacteria 1059
425 Ga0268264_10903307 3300028381 Unclassified 886
426 Ga0268264_11084072 3300028381 Unclassified 809
427 Ga0307408_100009882 3300031548 Bacteria 6288
428 Ga0307405_10317592 3300031731 Bacteria 1188
429 Ga0307410_10049984 3300031852 Bacteria 2809
430 Ga0307406_10070590 3300031901 Unclassified 2288
431 Ga0307407_10358938 3300031903 Bacteria 1034
432 Ga0307409_100329495 3300031995 Bacteria 1432
433 Ga0307414_10009170 3300032004 Bacteria 5668
434 Ga0307415_100044970 3300032126 Unclassified 2957
435 Ga0373940_0010562 3300035088 Bacteria 2174
436 Ga0373951_0000548 3300035091 Bacteria 10559
437 Ga0395900_0304408 3300037418 Bacteria 1579
438 Ga0395898_0473840 3300037466 Bacteria 1191
439 Ga0395905_0273945 3300037471 Bacteria 1574
440 Ga0395901_0371056 3300038443 Unclassified 1474
441 Ga0395901_0754678 3300038443 Bacteria 966
442 Ga0242420_017420 3300038996 Unclassified 1257
443 Ga0439464_0011228 3300042439 Bacteria 2371
444 Ga0495658_0040216 3300046683 Unclassified 2599
445 Ga0496102_0036102 3300048905 Bacteria 4452
446 Ga0496104_0169119 3300048907 Unclassified 2096
447 Ga0496106_0066239 3300048909 Unclassified 2751
448 Ga0496107_0647263 3300048910 Bacteria 779
449 Ga0496108_0085849 3300048911 Bacteria 2672
450 Ga0496112_0239413 3300048915 Bacteria 1768
451 Ga0496112_0314224 3300048915 Unclassified 1512
452 Ga0501298_005127 3300049521 Unclassified 2089
453 Ga0501298_044013 3300049521 Unclassified 911
454 Ga0501198_000148 3300049649 Bacteria 9701
455 Ga0501199_022491 3300049650 Unclassified 739
456 Ga0501223_001722 3300049663 Unclassified 4991
457 Ga0501224_008107 3300049664 Bacteria 1532
458 Ga0501227_000312 3300049665 Bacteria 10116
459 Ga0501227_026006 3300049665 Bacteria 1377
460 Ga0501230_037588 3300049667 Unclassified 927
461 Ga0501233_003470 3300049668 Bacteria 2835
462 Ga0501233_032139 3300049668 Bacteria 1192
463 Ga0501236_004424 3300049670 Bacteria 1666
464 Ga0501240_000603 3300049673 Unclassified 3042
465 Ga0501249_006674 3300049679 Bacteria 2378
466 Ga0501221_041112 3300049704 Bacteria 1009
467 Ga0501225_0004134 3300049705 Unclassified 4339
468 Ga0501234_004806 3300049707 Bacteria 2118
469 Ga0501273_003156 3300049770 Bacteria 1729
470 Ga0501279_033362 3300049775 Bacteria 769
471 nmdc:mga05p37_59070_c1 3300050507 Unclassified 4723
472 nmdc:mga05p37_61218_c1 3300050507 Bacteria 4634
473 nmdc:mga05p37_8894_c1 3300050507 Bacteria 11865
474 nmdc:mga09592_118250_c1 3300050508 Unclassified 2275
475 nmdc:mga0qj67_37555_c1 3300050509 Unclassified 3795
476 nmdc:mga06r32_212348_c1 3300050510 Bacteria 1923
477 nmdc:mga08y16_1563_c1 3300050511 Bacteria 23088
478 nmdc:mga08y16_344408_c1 3300050511 Bacteria 1532
479 nmdc:mga0n895_1268405_c1 3300050512 Unclassified 709
480 nmdc:mga0n895_32432_c1 3300050512 Bacteria 5014
481 nmdc:mga0n895_87643_c1 3300050512 Unclassified 3111
482 nmdc:mga0rr50_43191_c1 3300050513 Unclassified 3297
483 nmdc:mga0a205_108979_c1 3300050515 Bacteria 2668
484 nmdc:mga0a205_118549_c1 3300050515 Unclassified 2545
485 nmdc:mga0a205_348468_c1 3300050515 Bacteria 1349
486 nmdc:mga0a205_36481_c1 3300050515 Bacteria 4723
487 nmdc:mga0a205_38709_c1 3300050515 Unclassified 4588
488 nmdc:mga0a205_436189_c1 3300050515 Bacteria 1171
489 nmdc:mga0a205_44251_c1 3300050515 Bacteria 4291
490 nmdc:mga0a205_44374_c1 3300050515 Unclassified 4285
491 nmdc:mga0a205_79588_c1 3300050515 Bacteria 3167

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005843 Ga0068860_100009979 Ga0068860_10000997913 200
2 3300028381 Ga0268264_10018706 Ga0268264_100187062 200
3 3300005355 Ga0070671_100012017 Ga0070671_1000120171 201
4 3300025931 Ga0207644_10262917 Ga0207644_102629172 201
5 3300050515 nmdc:mga0a205_118549_c1 nmdc:mga0a205_118549_c1_63_683 201
6 3300009147 Ga0114129_10263046 Ga0114129_102630463 202
7 3300050507 nmdc:mga05p37_61218_c1 nmdc:mga05p37_61218_c1_3850_4491 202
8 3300050515 nmdc:mga0a205_348468_c1 nmdc:mga0a205_348468_c1_379_1020 202
9 3300050512 nmdc:mga0n895_87643_c1 nmdc:mga0n895_87643_c1_2447_3076 204
10 3300005354 Ga0070675_100018498 Ga0070675_1000184982 205
11 3300005578 Ga0068854_100402040 Ga0068854_1004020401 206
12 3300013100 Ga0157373_10640739 Ga0157373_106407391 206
13 3300025933 Ga0207706_10130871 Ga0207706_101308714 206
14 3300038443 Ga0395901_0754678 Ga0395901_0754678_40_675 206
15 3300025945 Ga0207679_10119508 Ga0207679_101195081 207
16 3300026078 Ga0207702_10034428 Ga0207702_100344286 208
17 3300037471 Ga0395905_0273945 Ga0395905_0273945_818_1528 208
18 3300038443 Ga0395901_0371056 Ga0395901_0371056_405_1094 209
19 3300005577 Ga0068857_100698614 Ga0068857_1006986141 210
20 3300005618 Ga0068864_100133553 Ga0068864_1001335533 210
21 3300009147 Ga0114129_10379340 Ga0114129_103793403 210
22 3300009148 Ga0105243_10777058 Ga0105243_107770582 210
23 3300009545 Ga0105237_10323475 Ga0105237_103234751 210
24 3300009553 Ga0105249_10057857 Ga0105249_100578572 210
25 3300010375 Ga0105239_10583673 Ga0105239_105836732 210
26 3300013307 Ga0157372_10033341 Ga0157372_100333414 210
27 3300038996 Ga0242420_017420 Ga0242420_017420_55_702 210
28 3300048905 Ga0496102_0036102 Ga0496102_0036102_237_884 210
29 3300048907 Ga0496104_0169119 Ga0496104_0169119_1206_1853 210
30 3300050512 nmdc:mga0n895_1268405_c1 nmdc:mga0n895_1268405_c1_34_681 210
31 3300050515 nmdc:mga0a205_44374_c1 nmdc:mga0a205_44374_c1_994_1641 210
32 3300014325 Ga0163163_11256885 Ga0163163_112568851 211
33 3300028379 Ga0268266_10446628 Ga0268266_104466282 211
34 3300005617 Ga0068859_100217270 Ga0068859_1002172702 212
35 3300006931 Ga0097620_100217274 Ga0097620_1002172742 212
36 3300025945 Ga0207679_10477249 Ga0207679_104772491 212
37 3300005618 Ga0068864_100216065 Ga0068864_1002160653 213
38 3300025904 Ga0207647_10203869 Ga0207647_102038691 214
39 3300005367 Ga0070667_100585756 Ga0070667_1005857561 215
40 3300005617 Ga0068859_100186302 Ga0068859_1001863022 215
41 3300005618 Ga0068864_100667706 Ga0068864_1006677062 215
42 3300006931 Ga0097620_100186300 Ga0097620_1001863002 215
43 3300009174 Ga0105241_10121379 Ga0105241_101213794 215
44 3300014325 Ga0163163_10457086 Ga0163163_104570861 215
45 3300005293 Ga0065715_10090755 Ga0065715_100907552 216
46 3300005335 Ga0070666_10107909 Ga0070666_101079093 216
47 3300005338 Ga0068868_100012234 Ga0068868_10001223412 216
48 3300005340 Ga0070689_100043530 Ga0070689_1000435302 216
49 3300005354 Ga0070675_100725193 Ga0070675_1007251932 216
50 3300005355 Ga0070671_100164886 Ga0070671_1001648861 216
51 3300005365 Ga0070688_100617881 Ga0070688_1006178811 216
52 3300005456 Ga0070678_100086616 Ga0070678_1000866161 216
53 3300005466 Ga0070685_10079784 Ga0070685_100797843 216
54 3300005617 Ga0068859_100048869 Ga0068859_1000488692 216
55 3300005618 Ga0068864_100190549 Ga0068864_1001905492 216
56 3300005840 Ga0068870_10196554 Ga0068870_101965541 216
57 3300005842 Ga0068858_100029238 Ga0068858_1000292382 216
58 3300006237 Ga0097621_100058489 Ga0097621_1000584896 216
59 3300006358 Ga0068871_100014977 Ga0068871_1000149772 216
60 3300006931 Ga0097620_100048868 Ga0097620_1000488682 216
61 3300009101 Ga0105247_10066473 Ga0105247_100664735 216
62 3300009176 Ga0105242_10305752 Ga0105242_103057521 216
63 3300009177 Ga0105248_10019074 Ga0105248_100190742 216
64 3300009177 Ga0105248_10137502 Ga0105248_101375024 216
65 3300013297 Ga0157378_10004042 Ga0157378_100040422 216
66 3300013306 Ga0163162_10006421 Ga0163162_100064217 216
67 3300013306 Ga0163162_10573535 Ga0163162_105735352 216
68 3300013308 Ga0157375_10118752 Ga0157375_101187525 216
69 3300014325 Ga0163163_10145747 Ga0163163_101457472 216
70 3300025903 Ga0207680_10196815 Ga0207680_101968152 216
71 3300025911 Ga0207654_10111829 Ga0207654_101118292 216
72 3300025926 Ga0207659_10132478 Ga0207659_101324783 216
73 3300025931 Ga0207644_10689479 Ga0207644_106894791 216
74 3300025936 Ga0207670_10044141 Ga0207670_100441412 216
75 3300025945 Ga0207679_10356457 Ga0207679_103564571 216
76 3300026023 Ga0207677_10002150 Ga0207677_100021504 216
77 3300026095 Ga0207676_10007355 Ga0207676_100073554 216
78 3300026121 Ga0207683_10357842 Ga0207683_103578421 216
79 3300028381 Ga0268264_10297517 Ga0268264_102975171 216
80 3300028381 Ga0268264_11084072 Ga0268264_110840721 216
81 3300005293 Ga0065715_10170584 Ga0065715_101705841 217
82 3300005353 Ga0070669_100167668 Ga0070669_1001676682 217
83 3300005367 Ga0070667_100090294 Ga0070667_1000902942 217
84 3300005441 Ga0070700_100000339 Ga0070700_10000033914 217
85 3300005543 Ga0070672_100020036 Ga0070672_1000200365 217
86 3300005842 Ga0068858_100141400 Ga0068858_1001414002 217
87 3300013306 Ga0163162_10131953 Ga0163162_101319531 217
88 3300013308 Ga0157375_10088574 Ga0157375_100885742 217
89 3300025923 Ga0207681_10153379 Ga0207681_101533792 217
90 3300025940 Ga0207691_10217127 Ga0207691_102171272 217
91 3300025972 Ga0207668_10523077 Ga0207668_105230771 217
92 3300026035 Ga0207703_10504485 Ga0207703_105044851 217
93 3300026075 Ga0207708_10000499 Ga0207708_100004999 217
94 3300026088 Ga0207641_11163476 Ga0207641_111634761 217
95 3300026142 Ga0207698_11003457 Ga0207698_110034571 217
96 3300046683 Ga0495658_0040216 Ga0495658_0040216_522_1223 217
97 3300005617 Ga0068859_100070073 Ga0068859_1000700732 218
98 3300006931 Ga0097620_100070073 Ga0097620_1000700733 218
99 3300009101 Ga0105247_10081782 Ga0105247_100817823 218
100 3300009177 Ga0105248_10004854 Ga0105248_100048546 218
101 3300025900 Ga0207710_10132136 Ga0207710_101321361 218
102 3300025941 Ga0207711_10052903 Ga0207711_100529032 218
103 3300025945 Ga0207679_10073440 Ga0207679_100734401 219
104 3300026095 Ga0207676_10467647 Ga0207676_104676472 219
105 3300005331 Ga0070670_100224096 Ga0070670_1002240962 220
106 3300005444 Ga0070694_100310629 Ga0070694_1003106292 220
107 3300005547 Ga0070693_100048562 Ga0070693_1000485624 220
108 3300005549 Ga0070704_100074875 Ga0070704_1000748753 220
109 3300005549 Ga0070704_100908186 Ga0070704_1009081861 220
110 3300005578 Ga0068854_100466332 Ga0068854_1004663321 220
111 3300006852 Ga0075433_10753799 Ga0075433_107537991 220
112 3300025981 Ga0207640_10469206 Ga0207640_104692062 220
113 3300005293 Ga0065715_10191518 Ga0065715_101915182 221
114 3300005617 Ga0068859_100184781 Ga0068859_1001847815 221
115 3300006852 Ga0075433_10071304 Ga0075433_100713044 221
116 3300006931 Ga0097620_100184788 Ga0097620_1001847885 221
117 3300009093 Ga0105240_10326272 Ga0105240_103262722 221
118 3300009094 Ga0111539_10053045 Ga0111539_100530452 221
119 3300009147 Ga0114129_10066342 Ga0114129_100663424 221
120 3300013307 Ga0157372_10274828 Ga0157372_102748282 221
121 3300025913 Ga0207695_10417563 Ga0207695_104175632 221
122 3300025925 Ga0207650_10018188 Ga0207650_100181883 221
123 3300049679 Ga0501249_006674 Ga0501249_006674_1266_1946 221
124 3300049770 Ga0501273_003156 Ga0501273_003156_232_912 221
125 3300049775 Ga0501279_033362 Ga0501279_033362_21_701 221
126 3300050507 nmdc:mga05p37_8894_c1 nmdc:mga05p37_8894_c1_355_1035 221
127 3300050515 nmdc:mga0a205_79588_c1 nmdc:mga0a205_79588_c1_2123_2803 221
128 3300042439 Ga0439464_0011228 Ga0439464_0011228_240_938 222
129 3300005615 Ga0070702_100491869 Ga0070702_1004918691 223
130 3300009147 Ga0114129_10016771 Ga0114129_100167712 223
131 3300025907 Ga0207645_10273949 Ga0207645_102739491 223
132 3300050507 nmdc:mga05p37_59070_c1 nmdc:mga05p37_59070_c1_2074_2766 223
133 3300050508 nmdc:mga09592_118250_c1 nmdc:mga09592_118250_c1_1467_2159 223
134 3300050509 nmdc:mga0qj67_37555_c1 nmdc:mga0qj67_37555_c1_2970_3662 223
135 3300050510 nmdc:mga06r32_212348_c1 nmdc:mga06r32_212348_c1_446_1138 223
136 3300003203 JGI25406J46586_10004211 JGI25406J46586_100042111 224
137 3300005338 Ga0068868_100451517 Ga0068868_1004515171 224
138 3300005343 Ga0070687_100034863 Ga0070687_1000348632 224
139 3300005345 Ga0070692_10056629 Ga0070692_100566292 224
140 3300005406 Ga0070703_10034082 Ga0070703_100340821 224
141 3300005458 Ga0070681_10002994 Ga0070681_1000299414 224
142 3300005539 Ga0068853_100137718 Ga0068853_1001377182 224
143 3300005545 Ga0070695_100029911 Ga0070695_1000299112 224
144 3300005545 Ga0070695_100212389 Ga0070695_1002123891 224
145 3300005546 Ga0070696_100079685 Ga0070696_1000796851 224
146 3300005547 Ga0070693_100258875 Ga0070693_1002588752 224
147 3300005549 Ga0070704_100015585 Ga0070704_1000155852 224
148 3300005549 Ga0070704_100171487 Ga0070704_1001714872 224
149 3300005563 Ga0068855_100514098 Ga0068855_1005140982 224
150 3300005577 Ga0068857_100184158 Ga0068857_1001841582 224
151 3300005616 Ga0068852_100455934 Ga0068852_1004559342 224
152 3300005617 Ga0068859_100081088 Ga0068859_1000810882 224
153 3300005617 Ga0068859_100087662 Ga0068859_1000876622 224
154 3300005834 Ga0068851_10002239 Ga0068851_100022395 224
155 3300005842 Ga0068858_100194423 Ga0068858_1001944232 224
156 3300005985 Ga0081539_10001528 Ga0081539_1000152826 224
157 3300005985 Ga0081539_10002349 Ga0081539_1000234916 224
158 3300006852 Ga0075433_10011879 Ga0075433_100118793 224
159 3300006852 Ga0075433_10355410 Ga0075433_103554102 224
160 3300006871 Ga0075434_100042493 Ga0075434_1000424936 224
161 3300006931 Ga0097620_100081093 Ga0097620_1000810932 224
162 3300006931 Ga0097620_100087660 Ga0097620_1000876602 224
163 3300009094 Ga0111539_10265984 Ga0111539_102659842 224
164 3300009147 Ga0114129_10850344 Ga0114129_108503441 224
165 3300009148 Ga0105243_10292297 Ga0105243_102922971 224
166 3300009177 Ga0105248_10598859 Ga0105248_105988592 224
167 3300009177 Ga0105248_10620659 Ga0105248_106206591 224
168 3300009545 Ga0105237_10003725 Ga0105237_1000372513 224
169 3300009545 Ga0105237_10157823 Ga0105237_101578233 224
170 3300010375 Ga0105239_10915412 Ga0105239_109154121 224
171 3300013306 Ga0163162_10972471 Ga0163162_109724712 224
172 3300014325 Ga0163163_10184628 Ga0163163_101846282 224
173 3300014326 Ga0157380_10348997 Ga0157380_103489972 224
174 3300014968 Ga0157379_10071861 Ga0157379_100718612 224
175 3300025321 Ga0207656_10002835 Ga0207656_100028352 224
176 3300025885 Ga0207653_10005743 Ga0207653_100057435 224
177 3300025912 Ga0207707_10014773 Ga0207707_100147734 224
178 3300025914 Ga0207671_10001860 Ga0207671_1000186012 224
179 3300025914 Ga0207671_10196131 Ga0207671_101961312 224
180 3300025918 Ga0207662_10051671 Ga0207662_100516713 224
181 3300025949 Ga0207667_10553447 Ga0207667_105534472 224
182 3300026035 Ga0207703_10014860 Ga0207703_100148602 224
183 3300026088 Ga0207641_10258665 Ga0207641_102586652 224
184 3300026118 Ga0207675_100186716 Ga0207675_1001867162 224
185 3300026142 Ga0207698_10027818 Ga0207698_100278181 224
186 3300027907 Ga0207428_10238832 Ga0207428_102388322 224
187 3300031548 Ga0307408_100009882 Ga0307408_10000988211 224
188 3300031731 Ga0307405_10317592 Ga0307405_103175921 224
189 3300031852 Ga0307410_10049984 Ga0307410_100499842 224
190 3300031901 Ga0307406_10070590 Ga0307406_100705901 224
191 3300031903 Ga0307407_10358938 Ga0307407_103589382 224
192 3300031995 Ga0307409_100329495 Ga0307409_1003294952 224
193 3300032004 Ga0307414_10009170 Ga0307414_100091702 224
194 3300035088 Ga0373940_0010562 Ga0373940_0010562_789_1478 224
195 3300037418 Ga0395900_0304408 Ga0395900_0304408_567_1280 224
196 3300049521 Ga0501298_044013 Ga0501298_044013_12_701 224
197 3300049649 Ga0501198_000148 Ga0501198_000148_8929_9618 224
198 3300049663 Ga0501223_001722 Ga0501223_001722_3032_3721 224
199 3300049664 Ga0501224_008107 Ga0501224_008107_242_931 224
200 3300049665 Ga0501227_000312 Ga0501227_000312_49_738 224
201 3300049667 Ga0501230_037588 Ga0501230_037588_153_842 224
202 3300049668 Ga0501233_003470 Ga0501233_003470_1524_2213 224
203 3300049670 Ga0501236_004424 Ga0501236_004424_42_731 224
204 3300049673 Ga0501240_000603 Ga0501240_000603_92_781 224
205 3300049705 Ga0501225_0004134 Ga0501225_0004134_596_1285 224
206 3300049707 Ga0501234_004806 Ga0501234_004806_1390_2079 224
207 3300050511 nmdc:mga08y16_344408_c1 nmdc:mga08y16_344408_c1_212_901 224
208 3300050515 nmdc:mga0a205_108979_c1 nmdc:mga0a205_108979_c1_673_1362 224
209 3300050515 nmdc:mga0a205_44251_c1 nmdc:mga0a205_44251_c1_1302_1991 224
210 3300005328 Ga0070676_10027506 Ga0070676_100275061 225
211 3300005334 Ga0068869_100150233 Ga0068869_1001502331 225
212 3300005336 Ga0070680_100001485 Ga0070680_1000014858 225
213 3300005340 Ga0070689_100088187 Ga0070689_1000881874 225
214 3300005343 Ga0070687_100142339 Ga0070687_1001423391 225
215 3300005347 Ga0070668_100588264 Ga0070668_1005882641 225
216 3300005353 Ga0070669_100336569 Ga0070669_1003365691 225
217 3300005364 Ga0070673_100006763 Ga0070673_1000067632 225
218 3300005438 Ga0070701_10139947 Ga0070701_101399471 225
219 3300005440 Ga0070705_100382537 Ga0070705_1003825372 225
220 3300005441 Ga0070700_100018601 Ga0070700_1000186015 225
221 3300005458 Ga0070681_10000059 Ga0070681_1000005931 225
222 3300005468 Ga0070707_100526446 Ga0070707_1005264462 225
223 3300005530 Ga0070679_100006336 Ga0070679_10000633617 225
224 3300005536 Ga0070697_100149979 Ga0070697_1001499792 225
225 3300005536 Ga0070697_100161194 Ga0070697_1001611942 225
226 3300005539 Ga0068853_100042955 Ga0068853_1000429556 225
227 3300005545 Ga0070695_100125867 Ga0070695_1001258672 225
228 3300005546 Ga0070696_100033954 Ga0070696_1000339545 225
229 3300005546 Ga0070696_100716702 Ga0070696_1007167021 225
230 3300005547 Ga0070693_100516544 Ga0070693_1005165441 225
231 3300005547 Ga0070693_100646611 Ga0070693_1006466111 225
232 3300005549 Ga0070704_100018417 Ga0070704_1000184178 225
233 3300005614 Ga0068856_100002834 Ga0068856_1000028345 225
234 3300005617 Ga0068859_100004843 Ga0068859_10000484313 225
235 3300005618 Ga0068864_100033768 Ga0068864_1000337682 225
236 3300005840 Ga0068870_10201040 Ga0068870_102010402 225
237 3300005843 Ga0068860_100742177 Ga0068860_1007421771 225
238 3300006846 Ga0075430_100012549 Ga0075430_1000125498 225
239 3300006847 Ga0075431_100115632 Ga0075431_1001156322 225
240 3300006852 Ga0075433_10011710 Ga0075433_100117106 225
241 3300006852 Ga0075433_10118310 Ga0075433_101183102 225
242 3300006871 Ga0075434_100369813 Ga0075434_1003698132 225
243 3300006871 Ga0075434_100765181 Ga0075434_1007651811 225
244 3300006931 Ga0097620_100004843 Ga0097620_10000484313 225
245 3300007076 Ga0075435_100272311 Ga0075435_1002723111 225
246 3300007076 Ga0075435_100387659 Ga0075435_1003876591 225
247 3300009147 Ga0114129_10846805 Ga0114129_108468052 225
248 3300009174 Ga0105241_10024831 Ga0105241_100248312 225
249 3300009174 Ga0105241_10542608 Ga0105241_105426081 225
250 3300010375 Ga0105239_10703514 Ga0105239_107035142 225
251 3300013308 Ga0157375_10055622 Ga0157375_100556222 225
252 3300014325 Ga0163163_10017580 Ga0163163_100175802 225
253 3300025907 Ga0207645_10241008 Ga0207645_102410082 225
254 3300025908 Ga0207643_10151149 Ga0207643_101511493 225
255 3300025908 Ga0207643_10274886 Ga0207643_102748861 225
256 3300025911 Ga0207654_10323174 Ga0207654_103231742 225
257 3300025912 Ga0207707_10000097 Ga0207707_1000009730 225
258 3300025917 Ga0207660_10024248 Ga0207660_100242488 225
259 3300025918 Ga0207662_10041400 Ga0207662_100414002 225
260 3300025921 Ga0207652_10004707 Ga0207652_100047071 225
261 3300025923 Ga0207681_10306532 Ga0207681_103065321 225
262 3300025945 Ga0207679_10954083 Ga0207679_109540831 225
263 3300025960 Ga0207651_10024983 Ga0207651_100249835 225
264 3300025961 Ga0207712_10161255 Ga0207712_101612552 225
265 3300025981 Ga0207640_10404513 Ga0207640_104045132 225
266 3300026041 Ga0207639_10018456 Ga0207639_100184566 225
267 3300026075 Ga0207708_10045118 Ga0207708_100451185 225
268 3300026088 Ga0207641_10052921 Ga0207641_100529215 225
269 3300026088 Ga0207641_10607137 Ga0207641_106071371 225
270 3300026095 Ga0207676_10005088 Ga0207676_100050883 225
271 3300026116 Ga0207674_10152136 Ga0207674_101521362 225
272 3300028380 Ga0268265_10154168 Ga0268265_101541683 225
273 3300028380 Ga0268265_10429810 Ga0268265_104298101 225
274 3300048915 Ga0496112_0239413 Ga0496112_0239413_32_724 225
275 3300050512 nmdc:mga0n895_32432_c1 nmdc:mga0n895_32432_c1_1284_1976 225
276 3300050515 nmdc:mga0a205_36481_c1 nmdc:mga0a205_36481_c1_1386_2078 225
277 3300005295 Ga0065707_10474264 Ga0065707_104742641 226
278 3300005440 Ga0070705_100238438 Ga0070705_1002384382 226
279 3300005444 Ga0070694_100060785 Ga0070694_1000607852 226
280 3300005467 Ga0070706_100002020 Ga0070706_10000202016 226
281 3300005467 Ga0070706_100055012 Ga0070706_1000550124 226
282 3300005468 Ga0070707_100036985 Ga0070707_1000369855 226
283 3300005471 Ga0070698_100007663 Ga0070698_1000076637 226
284 3300005471 Ga0070698_100022421 Ga0070698_1000224213 226
285 3300005518 Ga0070699_100001419 Ga0070699_10000141912 226
286 3300005536 Ga0070697_100023304 Ga0070697_1000233042 226
287 3300005547 Ga0070693_100066423 Ga0070693_1000664231 226
288 3300005549 Ga0070704_100090047 Ga0070704_1000900472 226
289 3300005577 Ga0068857_100029578 Ga0068857_1000295782 226
290 3300005577 Ga0068857_100658878 Ga0068857_1006588782 226
291 3300005618 Ga0068864_100068180 Ga0068864_1000681802 226
292 3300005719 Ga0068861_100004130 Ga0068861_1000041303 226
293 3300005841 Ga0068863_100577459 Ga0068863_1005774591 226
294 3300006931 Ga0097620_100083556 Ga0097620_1000835565 226
295 3300009011 Ga0105251_10061761 Ga0105251_100617612 226
296 3300009174 Ga0105241_10432270 Ga0105241_104322702 226
297 3300009177 Ga0105248_10003524 Ga0105248_1000352414 226
298 3300009177 Ga0105248_10520707 Ga0105248_105207072 226
299 3300011119 Ga0105246_10005146 Ga0105246_100051465 226
300 3300013297 Ga0157378_10312254 Ga0157378_103122541 226
301 3300013308 Ga0157375_10002366 Ga0157375_100023665 226
302 3300014325 Ga0163163_10244804 Ga0163163_102448041 226
303 3300014325 Ga0163163_10586207 Ga0163163_105862071 226
304 3300025910 Ga0207684_10014097 Ga0207684_100140977 226
305 3300025910 Ga0207684_10595883 Ga0207684_105958832 226
306 3300025922 Ga0207646_10165367 Ga0207646_101653671 226
307 3300025941 Ga0207711_10011050 Ga0207711_100110504 226
308 3300025941 Ga0207711_10394573 Ga0207711_103945732 226
309 3300025945 Ga0207679_10073685 Ga0207679_100736852 226
310 3300026095 Ga0207676_10095886 Ga0207676_100958864 226
311 3300026116 Ga0207674_10159160 Ga0207674_101591602 226
312 3300026118 Ga0207675_100007393 Ga0207675_1000073933 226
313 3300005288 Ga0065714_10064424 Ga0065714_10064424161 227
314 3300005290 Ga0065712_10000117 Ga0065712_10000117161 227
315 3300005293 Ga0065715_10003510 Ga0065715_100035103 227
316 3300005293 Ga0065715_10092012 Ga0065715_100920127 227
317 3300005337 Ga0070682_100010093 Ga0070682_1000100932 227
318 3300005339 Ga0070660_100024124 Ga0070660_1000241244 227
319 3300005353 Ga0070669_100193803 Ga0070669_1001938032 227
320 3300005354 Ga0070675_100855638 Ga0070675_1008556381 227
321 3300005366 Ga0070659_100008215 Ga0070659_1000082154 227
322 3300005438 Ga0070701_10250888 Ga0070701_102508882 227
323 3300005440 Ga0070705_100302015 Ga0070705_1003020152 227
324 3300005441 Ga0070700_100004525 Ga0070700_1000045255 227
325 3300005444 Ga0070694_100104820 Ga0070694_1001048204 227
326 3300005455 Ga0070663_100111470 Ga0070663_1001114702 227
327 3300005457 Ga0070662_100125253 Ga0070662_1001252531 227
328 3300005458 Ga0070681_10001827 Ga0070681_100018275 227
329 3300005467 Ga0070706_100000146 Ga0070706_10000014620 227
330 3300005530 Ga0070679_100029217 Ga0070679_1000292174 227
331 3300005539 Ga0068853_100002135 Ga0068853_10000213512 227
332 3300005539 Ga0068853_100071358 Ga0068853_1000713581 227
333 3300005543 Ga0070672_100087506 Ga0070672_1000875062 227
334 3300005544 Ga0070686_100082174 Ga0070686_1000821742 227
335 3300005545 Ga0070695_100111820 Ga0070695_1001118203 227
336 3300005563 Ga0068855_100083880 Ga0068855_1000838802 227
337 3300005564 Ga0070664_100009532 Ga0070664_1000095324 227
338 3300005577 Ga0068857_100021195 Ga0068857_1000211951 227
339 3300005615 Ga0070702_100063493 Ga0070702_1000634932 227
340 3300005616 Ga0068852_100559041 Ga0068852_1005590411 227
341 3300005617 Ga0068859_100059679 Ga0068859_1000596797 227
342 3300005617 Ga0068859_100568808 Ga0068859_1005688082 227
343 3300005719 Ga0068861_100588625 Ga0068861_1005886252 227
344 3300005841 Ga0068863_100157822 Ga0068863_1001578223 227
345 3300005842 Ga0068858_100495749 Ga0068858_1004957492 227
346 3300005843 Ga0068860_100072657 Ga0068860_1000726575 227
347 3300005844 Ga0068862_100023710 Ga0068862_1000237102 227
348 3300006237 Ga0097621_100001118 Ga0097621_10000111814 227
349 3300006358 Ga0068871_100019099 Ga0068871_1000190996 227
350 3300006931 Ga0097620_100059673 Ga0097620_1000596737 227
351 3300006931 Ga0097620_100568804 Ga0097620_1005688042 227
352 3300009551 Ga0105238_10115533 Ga0105238_101155333 227
353 3300009553 Ga0105249_10045998 Ga0105249_100459982 227
354 3300013100 Ga0157373_10039698 Ga0157373_100396982 227
355 3300014325 Ga0163163_10453882 Ga0163163_104538821 227
356 3300014326 Ga0157380_10030653 Ga0157380_100306532 227
357 3300025904 Ga0207647_10008061 Ga0207647_100080619 227
358 3300025910 Ga0207684_10000327 Ga0207684_100003272 227
359 3300025912 Ga0207707_10008125 Ga0207707_100081254 227
360 3300025918 Ga0207662_10013940 Ga0207662_100139406 227
361 3300025919 Ga0207657_10052505 Ga0207657_100525052 227
362 3300025921 Ga0207652_10020793 Ga0207652_100207936 227
363 3300025923 Ga0207681_10134725 Ga0207681_101347252 227
364 3300025925 Ga0207650_10238799 Ga0207650_102387992 227
365 3300025932 Ga0207690_10007233 Ga0207690_100072334 227
366 3300025945 Ga0207679_10036527 Ga0207679_100365272 227
367 3300025949 Ga0207667_10265773 Ga0207667_102657732 227
368 3300026035 Ga0207703_10416827 Ga0207703_104168272 227
369 3300026041 Ga0207639_10062640 Ga0207639_100626402 227
370 3300026041 Ga0207639_10248392 Ga0207639_102483921 227
371 3300026067 Ga0207678_10137633 Ga0207678_101376332 227
372 3300026075 Ga0207708_10013997 Ga0207708_100139973 227
373 3300026095 Ga0207676_10610467 Ga0207676_106104671 227
374 3300026116 Ga0207674_10000129 Ga0207674_1000012927 227
375 3300026118 Ga0207675_100059348 Ga0207675_1000593482 227
376 3300028380 Ga0268265_10036076 Ga0268265_100360761 227
377 3300028381 Ga0268264_10048980 Ga0268264_100489803 227
378 3300028381 Ga0268264_10630430 Ga0268264_106304301 227
379 3300037466 Ga0395898_0473840 Ga0395898_0473840_116_814 227
380 3300049521 Ga0501298_005127 Ga0501298_005127_858_1559 227
381 3300049650 Ga0501199_022491 Ga0501199_022491_16_717 227
382 3300049665 Ga0501227_026006 Ga0501227_026006_465_1166 227
383 3300049668 Ga0501233_032139 Ga0501233_032139_20_721 227
384 3300049704 Ga0501221_041112 Ga0501221_041112_95_796 227
385 3300005293 Ga0065715_10014371 Ga0065715_100143712 228
386 3300005331 Ga0070670_100005052 Ga0070670_1000050521 228
387 3300005364 Ga0070673_100135901 Ga0070673_1001359011 228
388 3300005364 Ga0070673_100680506 Ga0070673_1006805061 228
389 3300005438 Ga0070701_10169461 Ga0070701_101694611 228
390 3300005545 Ga0070695_100380677 Ga0070695_1003806772 228
391 3300005545 Ga0070695_100448027 Ga0070695_1004480271 228
392 3300005549 Ga0070704_100042998 Ga0070704_1000429982 228
393 3300005615 Ga0070702_100061320 Ga0070702_1000613202 228
394 3300005719 Ga0068861_100293125 Ga0068861_1002931252 228
395 3300006852 Ga0075433_10234644 Ga0075433_102346442 228
396 3300009101 Ga0105247_10002991 Ga0105247_100029911 228
397 3300009177 Ga0105248_10905829 Ga0105248_109058291 228
398 3300009551 Ga0105238_10017969 Ga0105238_1001796910 228
399 3300010375 Ga0105239_10358724 Ga0105239_103587242 228
400 3300013102 Ga0157371_10631690 Ga0157371_106316901 228
401 3300013306 Ga0163162_10470167 Ga0163162_104701672 228
402 3300014325 Ga0163163_10000879 Ga0163163_100008793 228
403 3300014325 Ga0163163_10013358 Ga0163163_1001335814 228
404 3300014325 Ga0163163_10285715 Ga0163163_102857153 228
405 3300014969 Ga0157376_10232119 Ga0157376_102321192 228
406 3300025900 Ga0207710_10001694 Ga0207710_100016942 228
407 3300025908 Ga0207643_10000740 Ga0207643_100007405 228
408 3300025924 Ga0207694_10010187 Ga0207694_1001018710 228
409 3300025925 Ga0207650_10000143 Ga0207650_1000014334 228
410 3300025936 Ga0207670_10005158 Ga0207670_100051584 228
411 3300025936 Ga0207670_10373278 Ga0207670_103732782 228
412 3300025938 Ga0207704_10477747 Ga0207704_104777471 228
413 3300025940 Ga0207691_10358101 Ga0207691_103581012 228
414 3300025940 Ga0207691_10387851 Ga0207691_103878511 228
415 3300025941 Ga0207711_10732590 Ga0207711_107325901 228
416 3300025942 Ga0207689_10058293 Ga0207689_100582935 228
417 3300025949 Ga0207667_10756799 Ga0207667_107567991 228
418 3300025960 Ga0207651_10090577 Ga0207651_100905772 228
419 3300025960 Ga0207651_10585703 Ga0207651_105857032 228
420 3300026035 Ga0207703_10384713 Ga0207703_103847132 228
421 3300026088 Ga0207641_10648890 Ga0207641_106488901 228
422 3300026095 Ga0207676_10053115 Ga0207676_100531152 228
423 3300035091 Ga0373951_0000548 Ga0373951_0000548_9633_10334 228
424 3300048915 Ga0496112_0314224 Ga0496112_0314224_164_868 228
425 3300050515 nmdc:mga0a205_436189_c1 nmdc:mga0a205_436189_c1_45_749 228
426 2162886007 SwRhRL2b_contig_2330233 SwRhRL2b_0179.00002170 229
427 3300005289 Ga0065704_10005604 Ga0065704_100056041 229
428 3300005295 Ga0065707_10000629 Ga0065707_100006291 229
429 3300005331 Ga0070670_100264510 Ga0070670_1002645102 229
430 3300005354 Ga0070675_100456897 Ga0070675_1004568971 229
431 3300005366 Ga0070659_100239242 Ga0070659_1002392422 229
432 3300005441 Ga0070700_100607294 Ga0070700_1006072941 229
433 3300005444 Ga0070694_100191357 Ga0070694_1001913572 229
434 3300005468 Ga0070707_100112686 Ga0070707_1001126862 229
435 3300005471 Ga0070698_100013866 Ga0070698_1000138664 229
436 3300005578 Ga0068854_100366401 Ga0068854_1003664012 229
437 3300005578 Ga0068854_100696385 Ga0068854_1006963851 229
438 3300005617 Ga0068859_100180550 Ga0068859_1001805502 229
439 3300005617 Ga0068859_100780528 Ga0068859_1007805282 229
440 3300005719 Ga0068861_100106003 Ga0068861_1001060032 229
441 3300005841 Ga0068863_100136756 Ga0068863_1001367562 229
442 3300005842 Ga0068858_100543499 Ga0068858_1005434992 229
443 3300005844 Ga0068862_100300142 Ga0068862_1003001422 229
444 3300005844 Ga0068862_100581385 Ga0068862_1005813851 229
445 3300006058 Ga0075432_10010578 Ga0075432_100105784 229
446 3300006237 Ga0097621_100196581 Ga0097621_1001965812 229
447 3300006931 Ga0097620_100048971 Ga0097620_1000489712 229
448 3300006931 Ga0097620_100180542 Ga0097620_1001805422 229
449 3300006931 Ga0097620_100780530 Ga0097620_1007805302 229
450 3300009094 Ga0111539_10000643 Ga0111539_1000064317 229
451 3300009098 Ga0105245_11115978 Ga0105245_111159781 229
452 3300009147 Ga0114129_10566755 Ga0114129_105667552 229
453 3300009148 Ga0105243_10010203 Ga0105243_100102031 229
454 3300009148 Ga0105243_10371009 Ga0105243_103710091 229
455 3300009174 Ga0105241_10546829 Ga0105241_105468291 229
456 3300009176 Ga0105242_10020415 Ga0105242_100204157 229
457 3300009177 Ga0105248_10329178 Ga0105248_103291782 229
458 3300009177 Ga0105248_10660569 Ga0105248_106605691 229
459 3300009553 Ga0105249_10175287 Ga0105249_101752871 229
460 3300010375 Ga0105239_10996570 Ga0105239_109965701 229
461 3300013306 Ga0163162_11149072 Ga0163162_111490721 229
462 3300025911 Ga0207654_10187833 Ga0207654_101878332 229
463 3300025911 Ga0207654_10497711 Ga0207654_104977111 229
464 3300025922 Ga0207646_10137028 Ga0207646_101370283 229
465 3300025925 Ga0207650_10188394 Ga0207650_101883942 229
466 3300025932 Ga0207690_10165185 Ga0207690_101651852 229
467 3300025934 Ga0207686_10106708 Ga0207686_101067082 229
468 3300025934 Ga0207686_10682298 Ga0207686_106822981 229
469 3300025935 Ga0207709_10004361 Ga0207709_100043614 229
470 3300025942 Ga0207689_10529615 Ga0207689_105296151 229
471 3300025945 Ga0207679_10198632 Ga0207679_101986322 229
472 3300025961 Ga0207712_10018505 Ga0207712_100185052 229
473 3300025981 Ga0207640_10128568 Ga0207640_101285681 229
474 3300026035 Ga0207703_10704646 Ga0207703_107046461 229
475 3300026075 Ga0207708_10049293 Ga0207708_100492931 229
476 3300026089 Ga0207648_10341536 Ga0207648_103415362 229
477 3300026116 Ga0207674_10418865 Ga0207674_104188651 229
478 3300026118 Ga0207675_100189679 Ga0207675_1001896792 229
479 3300026118 Ga0207675_100597407 Ga0207675_1005974072 229
480 3300026142 Ga0207698_10869622 Ga0207698_108696222 229
481 3300027907 Ga0207428_10001094 Ga0207428_1000109418 229
482 3300028380 Ga0268265_10365809 Ga0268265_103658091 229
483 3300028381 Ga0268264_10118489 Ga0268264_101184892 229
484 3300028381 Ga0268264_10903307 Ga0268264_109033071 229
485 3300032126 Ga0307415_100044970 Ga0307415_1000449702 229
486 3300048909 Ga0496106_0066239 Ga0496106_0066239_239_946 229
487 3300048910 Ga0496107_0647263 Ga0496107_0647263_16_723 229
488 3300048911 Ga0496108_0085849 Ga0496108_0085849_1701_2408 229
489 3300050511 nmdc:mga08y16_1563_c1 nmdc:mga08y16_1563_c1_6043_6747 229
490 3300050513 nmdc:mga0rr50_43191_c1 nmdc:mga0rr50_43191_c1_1923_2657 229
491 3300050515 nmdc:mga0a205_38709_c1 nmdc:mga0a205_38709_c1_2285_2989 229

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lyu-assembly2.cif.gz_B reelin repeat 8 0.6305 63 194
6a48-assembly1.cif.gz_A crystal structure of reelin n-terminal region 0.6273 60 192
7lyu-assembly1.cif.gz_A reelin repeat 8 0.6262 57 190
5b4x-assembly1.cif.gz_A crystal structure of the apoer2 ectodomain in complex with the reelin r56 fragment 0.6202 63 193
6v1v-assembly1.cif.gz_D vip3b (vip3b_2160) adapted for crystallization 0.6013 57 190
ID Description Score Start End Superfamily
af_A0A2R8RQP7_117_249_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.6839 97 196 2.60.120.260
af_P78509_1066_1226_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.6378 60 192 2.60.120.260
af_F1R440_449_586_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.62 98 192 2.60.120.260
af_P78509_710_863_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.6136 60 190 2.60.120.260
af_Q2FX75_1_131_2.60.120.380 Mainly Beta;Sandwich;Jelly Rolls; 0.6089 98 191 2.60.120.380
ID Description Score Start End GO Terms
AF-A0A356X2X6-F1-model_v4 DUF4397 domain-containing protein 0.8362 85 198
AF-A0A5Q4E4R0-F1-model_v4 T9SS C-terminal target domain-containing protein 0.8139 82 194
AF-A0A7W1HUP3-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.7637 53 194 GO:0004180
GO:0030246
AF-A0A350QIW8-F1-model_v4 Nuclease 0.7631 47 194
AF-A0A651H4W3-F1-model_v4 Bacterial repeat domain-containing protein 0.7545 50 198

Feature Viewer

pLDDT pTM Quality
59.85 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map