F453979

General Info

Members Datasets Scaffolds Average Seq Length
490 331 980 108

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0013275|Ga0466963_0013275_4090_4461
Length 123
Sequence VSKAAGAARETGVTEVTDEDFTEQVLRAELPVLVEFTADWCPPCRQMGPVLDALAAEEGHRLKVVQLNVDTNPATTHTYRVLSMPTFLVFRDGEPVRSMVGARPKRRLVQELADADVLRAPAG

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
81 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
121 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
122 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
123 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
128 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
129 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
130 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
140 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
146 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
154 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
155 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
156 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
157 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
158 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
159 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
160 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
163 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
164 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
165 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
166 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
167 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
168 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
169 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
170 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
171 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
172 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
173 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
174 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
175 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
176 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
177 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
178 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
179 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
180 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
207 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
240 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
288 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
294 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
295 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
296 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
297 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
298 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
299 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
302 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
303 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
304 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
305 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
306 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
307 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
308 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
309 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
310 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
311 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
312 2808606448 Streptomyces sp. 193411 Isolate Unclassified
313 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
314 2867428634 Streptomyces sp. RP5T Isolate Unclassified
315 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
316 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
317 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
318 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
319 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
320 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
321 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
322 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
323 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
324 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
325 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
326 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
327 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
328 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
329 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
330 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
331 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.8
Metatranscriptomes 4.29
Isolates 5.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.88
Nodule 0.61
Rhizoplane 1.63
Rhizosphere 85.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0013275 3300044694 Bacteria 5056
2 JGI24740J21852_10073845 3300001979 Bacteria 907
3 JGI24739J22299_10089324 3300001989 Bacteria 939
4 JGI24737J22298_10004111 3300001990 Bacteria 5083
5 JGI24735J21928_10006789 3300002067 Bacteria 3751
6 JGI24738J21930_10024366 3300002075 Bacteria 1245
7 JGI25153J46596_10040026 3300003215 Bacteria 1458
8 rootH1_10028304 3300003316 Bacteria 5734
9 rootH2_10085777 3300003320 Bacteria 1414
10 rootL2_10079641 3300003322 Bacteria 1265
11 Ga0006562J51391_1064061 3300003578 Bacteria 3060
12 Ga0006562J51391_1064064 3300003578 Bacteria 4310
13 Ga0006562J51391_1077577 3300003578 Bacteria 1740
14 Ga0006562J51391_1077578 3300003578 Bacteria 1680
15 Ga0058861_11183049 3300004800 Eukaryota 580
16 Ga0070658_10305905 3300005327 Bacteria 1356
17 Ga0070683_100040855 3300005329 Bacteria 4265
18 Ga0070670_100655156 3300005331 Bacteria 942
19 Ga0068868_100447867 3300005338 Bacteria 1122
20 Ga0070660_100959411 3300005339 Bacteria 722
21 Ga0070691_10203656 3300005341 Bacteria 1041
22 Ga0070661_100455307 3300005344 Bacteria 1018
23 Ga0070668_100882388 3300005347 Bacteria 799
24 Ga0070668_102012232 3300005347 Bacteria 533
25 Ga0070669_100246565 3300005353 Bacteria 1421
26 Ga0070674_100048622 3300005356 Bacteria 2911
27 Ga0070674_100105623 3300005356 Bacteria 2059
28 Ga0070674_101409271 3300005356 Bacteria 624
29 Ga0070688_101591989 3300005365 Bacteria 533
30 Ga0070659_101640070 3300005366 Bacteria 575
31 Ga0070667_101413248 3300005367 Bacteria 653
32 Ga0070701_10027633 3300005438 Bacteria 2781
33 Ga0070663_100733870 3300005455 Bacteria 842
34 Ga0070678_101018129 3300005456 Bacteria 762
35 Ga0070662_101421945 3300005457 Bacteria 598
36 Ga0068867_100147599 3300005459 Bacteria 1845
37 Ga0068867_102213927 3300005459 Bacteria 522
38 Ga0070685_10375459 3300005466 Bacteria 978
39 Ga0070679_100484499 3300005530 Bacteria 1181
40 Ga0070684_101609654 3300005535 Bacteria 613
41 Ga0068853_100141243 3300005539 Bacteria 2162
42 Ga0070686_100882861 3300005544 Bacteria 726
43 Ga0070695_100678161 3300005545 Bacteria 816
44 Ga0070696_101620901 3300005546 Bacteria 556
45 Ga0070665_100003731 3300005548 Bacteria 16131
46 Ga0070665_100730720 3300005548 Bacteria 1003
47 Ga0070665_100973381 3300005548 Bacteria 861
48 Ga0068855_100211821 3300005563 Bacteria 2177
49 Ga0070664_100366536 3300005564 Bacteria 1313
50 Ga0070664_100772278 3300005564 Bacteria 898
51 Ga0068857_100440658 3300005577 Bacteria 1217
52 Ga0068854_100195890 3300005578 Bacteria 1585
53 Ga0068854_102286082 3300005578 Bacteria 501
54 Ga0068856_100166303 3300005614 Bacteria 2217
55 Ga0070702_101050595 3300005615 Bacteria 648
56 Ga0068852_100596912 3300005616 Bacteria 1108
57 Ga0068861_100047832 3300005719 Bacteria 3231
58 Ga0068870_10390580 3300005840 Bacteria 903
59 Ga0068860_101247888 3300005843 Bacteria 764
60 Ga0068862_100263490 3300005844 Bacteria 1574
61 Ga0081455_10031588 3300005937 Bacteria 4787
62 Ga0081539_10003175 3300005985 Bacteria 20824
63 Ga0075365_10097188 3300006038 Bacteria 2013
64 Ga0075363_100023714 3300006048 Bacteria 3113
65 Ga0075363_100106816 3300006048 Bacteria 1553
66 Ga0075367_10484761 3300006178 Bacteria 784
67 Ga0075370_10074099 3300006353 Bacteria 1951
68 Ga0075370_10204581 3300006353 Bacteria 1165
69 Ga0075428_100615248 3300006844 Bacteria 1160
70 Ga0075430_100444772 3300006846 Bacteria 1070
71 Ga0075430_100840478 3300006846 Bacteria 757
72 Ga0075431_100942562 3300006847 Bacteria 832
73 Ga0068865_100178309 3300006881 Bacteria 1634
74 Ga0099826_10059752 3300006948 Bacteria 2489
75 Ga0105251_10023889 3300009011 Bacteria 3147
76 Ga0105250_10584834 3300009092 Bacteria 516
77 Ga0111539_10774312 3300009094 Bacteria 1117
78 Ga0105245_11458257 3300009098 Bacteria 735
79 Ga0105247_11750312 3300009101 Bacteria 515
80 Ga0105243_10114204 3300009148 Bacteria 2266
81 Ga0105241_12689641 3300009174 Bacteria 501
82 Ga0105242_11387513 3300009176 Bacteria 729
83 Ga0105248_10527360 3300009177 Bacteria 1332
84 Ga0105237_12036754 3300009545 Bacteria 583
85 Ga0105238_11806068 3300009551 Bacteria 643
86 Ga0105249_10994642 3300009553 Bacteria 907
87 Ga0105239_10356008 3300010375 Bacteria 1653
88 Ga0105239_10841051 3300010375 Bacteria 1052
89 Ga0105239_12973475 3300010375 Bacteria 553
90 Ga0105246_10005879 3300011119 Bacteria 7485
91 Ga0105246_10913082 3300011119 Bacteria 788
92 Ga0105246_11681374 3300011119 Bacteria 602
93 Ga0157371_10423615 3300013102 Bacteria 976
94 Ga0157374_11883945 3300013296 Bacteria 624
95 Ga0163162_10781191 3300013306 Bacteria 1073
96 Ga0163162_11093608 3300013306 Bacteria 903
97 Ga0157372_10093126 3300013307 Bacteria 3429
98 Ga0163163_10968050 3300014325 Bacteria 914
99 Ga0183367_1002 3300015688 Bacteria 1101531
100 Ga0206349_1484154 3300020075 Eukaryota 579
101 Ga0206351_10337206 3300020077 Bacteria 682
102 Ga0224712_10512589 3300022467 Eukaryota 580
103 Ga0209758_1012001 3300025297 Bacteria 4921
104 Ga0207426_1016462 3300025302 Bacteria 2654
105 Ga0207713_1041314 3300025735 Bacteria 1925
106 Ga0207642_10482825 3300025899 Bacteria 756
107 Ga0207710_10775469 3300025900 Bacteria 504
108 Ga0207647_10009774 3300025904 Bacteria 6803
109 Ga0207645_10312181 3300025907 Bacteria 1048
110 Ga0207705_10354525 3300025909 Bacteria 1131
111 Ga0207657_10770119 3300025919 Bacteria 745
112 Ga0207649_10373926 3300025920 Bacteria 1060
113 Ga0207681_10331135 3300025923 Bacteria 1214
114 Ga0207659_11541194 3300025926 Bacteria 568
115 Ga0207687_10089961 3300025927 Bacteria 2236
116 Ga0207690_10140514 3300025932 Bacteria 1779
117 Ga0207690_11381729 3300025932 Bacteria 589
118 Ga0207706_10070490 3300025933 Bacteria 3075
119 Ga0207706_11407927 3300025933 Bacteria 572
120 Ga0207706_11582027 3300025933 Bacteria 532
121 Ga0207709_10413020 3300025935 Bacteria 1035
122 Ga0207669_10099130 3300025937 Bacteria 1921
123 Ga0207704_10452266 3300025938 Bacteria 1025
124 Ga0207711_10701587 3300025941 Bacteria 944
125 Ga0207689_10082980 3300025942 Bacteria 2635
126 Ga0207661_10639382 3300025944 Bacteria 978
127 Ga0207661_11896236 3300025944 Bacteria 542
128 Ga0207679_11810654 3300025945 Bacteria 558
129 Ga0207667_10151092 3300025949 Bacteria 2390
130 Ga0207712_10790369 3300025961 Bacteria 834
131 Ga0207668_10017231 3300025972 Bacteria 4522
132 Ga0207668_10210224 3300025972 Bacteria 1556
133 Ga0207640_10435693 3300025981 Bacteria 1076
134 Ga0207677_10747420 3300026023 Bacteria 871
135 Ga0207639_10279559 3300026041 Bacteria 1467
136 Ga0207708_10017697 3300026075 Bacteria 5364
137 Ga0207702_10144810 3300026078 Bacteria 2155
138 Ga0207648_10118834 3300026089 Bacteria 2323
139 Ga0207675_100460015 3300026118 Bacteria 1262
140 Ga0207683_10148101 3300026121 Bacteria 2118
141 Ga0209371_1012398 3300027312 Bacteria 2466
142 Ga0209371_1020636 3300027312 Bacteria 1617
143 Ga0268266_10038783 3300028379 Bacteria 4055
144 Ga0268266_10354682 3300028379 Bacteria 1379
145 Ga0268266_12158297 3300028379 Bacteria 529
146 Ga0268265_10410362 3300028380 Bacteria 1255
147 Ga0265319_1000162 3300028563 Bacteria 50501
148 Ga0268256_1011317 3300030500 Bacteria 2833
149 Ga0268256_1038434 3300030500 Bacteria 1088
150 Ga0307511_10090322 3300030521 Bacteria 2081
151 Ga0307512_10004497 3300030522 Bacteria 15252
152 Ga0307512_10007977 3300030522 Bacteria 10395
153 Ga0307513_10076043 3300031456 Bacteria 3484
154 Ga0307509_10052934 3300031507 Bacteria 4332
155 Ga0307508_10015525 3300031616 Bacteria 6938
156 Ga0307508_10074272 3300031616 Bacteria 2976
157 Ga0307514_10101034 3300031649 Bacteria 2070
158 Ga0316579_10233477 3300031691 Bacteria 890
159 Ga0316576_10006795 3300031727 Bacteria 7147
160 Ga0316578_10011202 3300031728 Bacteria 4681
161 Ga0307413_10491488 3300031824 Bacteria 983
162 Ga0307518_10117920 3300031838 Bacteria 1883
163 Ga0307518_10253107 3300031838 Bacteria 1117
164 Ga0307410_10843665 3300031852 Bacteria 782
165 Ga0307410_11909635 3300031852 Bacteria 529
166 Ga0307406_10224756 3300031901 Bacteria 1398
167 Ga0307406_11937201 3300031901 Bacteria 526
168 Ga0307412_10354175 3300031911 Bacteria 1180
169 Ga0307416_100275723 3300032002 Bacteria 1655
170 Ga0307416_100523776 3300032002 Bacteria 1254
171 Ga0307416_100951432 3300032002 Bacteria 961
172 Ga0307415_100585128 3300032126 Bacteria 991
173 Ga0307415_102421691 3300032126 Bacteria 516
174 Ga0316593_10043666 3300032168 Bacteria 1498
175 Ga0316593_10367018 3300032168 Bacteria 553
176 Ga0316593_10369516 3300032168 Bacteria 551
177 Ga0307507_10692357 3300033179 Bacteria 510
178 Ga0316592_1019069 3300033524 Bacteria 1449
179 Ga0316592_1036322 3300033524 Bacteria 1082
180 Ga0316592_1047219 3300033524 Bacteria 959
181 Ga0316586_1024511 3300033527 Bacteria 1012
182 Ga0316588_1064711 3300033528 Bacteria 894
183 Ga0316588_1066547 3300033528 Bacteria 882
184 Ga0316587_1041387 3300033529 Bacteria 833
185 Ga0316596_1026620 3300033541 Bacteria 1491
186 Ga0316596_1053437 3300033541 Bacteria 1071
187 Ga0316574_0249128 3300035398 Bacteria 1135
188 Ga0316582_0017285 3300036647 Bacteria 4170
189 Ga0316582_0257233 3300036647 Bacteria 1197
190 Ga0316584_0243506 3300036712 Bacteria 1315
191 Ga0316584_0935126 3300036712 Bacteria 582
192 Ga0395899_0625286 3300037312 Bacteria 683
193 Ga0395900_0149013 3300037418 Bacteria 2391
194 Ga0395898_0041052 3300037466 Bacteria 4572
195 Ga0395898_0449399 3300037466 Bacteria 1227
196 Ga0395901_0603325 3300038443 Bacteria 1107
197 Ga0436360_0920373 3300039438 Bacteria 907
198 Ga0439436_0000311 3300041404 Bacteria 11872
199 Ga0439436_0049604 3300041404 Bacteria 1189
200 Ga0451791_1592389 3300041451 Bacteria 1108
201 Ga0451802_1822824 3300041460 Bacteria 546
202 Ga0451835_0351031 3300041492 Bacteria 522
203 Ga0451837_1169212 3300041494 Bacteria 1366
204 Ga0451849_0813037 3300041505 Bacteria 870
205 Ga0451849_1498180 3300041505 Bacteria 549
206 Ga0451843_0838438 3300041509 Bacteria 815
207 Ga0451855_1063584 3300041511 Bacteria 678
208 Ga0451853_0705918 3300041512 Bacteria 1419
209 Ga0451853_3713840 3300041512 Bacteria 669
210 Ga0439433_0000780 3300041999 Bacteria 6282
211 Ga0439433_0032475 3300041999 Bacteria 1197
212 Ga0439448_0000913 3300042005 Bacteria 7274
213 Ga0439449_0001440 3300042007 Bacteria 9301
214 Ga0439449_0026217 3300042007 Bacteria 2175
215 Ga0439449_0243119 3300042007 Bacteria 676
216 Ga0439450_086184 3300042008 Bacteria 785
217 Ga0439454_019037 3300042011 Bacteria 995
218 Ga0439454_019816 3300042011 Bacteria 981
219 Ga0439455_0000487 3300042012 Bacteria 5499
220 Ga0439457_059208 3300042014 Bacteria 866
221 Ga0439463_026799 3300042016 Bacteria 1449
222 Ga0450920_053231 3300042122 Bacteria 813
223 Ga0450894_001442 3300042131 Bacteria 3419
224 Ga0450895_013708 3300042132 Bacteria 713
225 Ga0450896_000088 3300042133 Bacteria 6402
226 Ga0450898_024964 3300042134 Bacteria 1070
227 Ga0450899_000217 3300042135 Bacteria 6013
228 Ga0450903_000271 3300042138 Bacteria 11380
229 Ga0450903_020350 3300042138 Bacteria 1027
230 Ga0450906_006055 3300042145 Bacteria 2457
231 Ga0439458_0006066 3300042157 Bacteria 2699
232 Ga0439458_0009657 3300042157 Bacteria 2149
233 Ga0439458_0039913 3300042157 Bacteria 1136
234 Ga0450908_055412 3300042184 Bacteria 692
235 Ga0450916_014720 3300042530 Bacteria 1022
236 Ga0466969_0127526 3300044656 Bacteria 1181
237 Ga0466969_0493200 3300044656 Bacteria 559
238 Ga0466972_0003087 3300044658 Bacteria 8255
239 Ga0466972_0007027 3300044658 Bacteria 5649
240 Ga0466965_0004953 3300044683 Bacteria 5960
241 Ga0466965_0045857 3300044683 Bacteria 2163
242 Ga0466965_0197599 3300044683 Bacteria 1066
243 Ga0466966_0005960 3300044684 Bacteria 8042
244 Ga0466966_0013459 3300044684 Bacteria 5414
245 Ga0466966_0873455 3300044684 Bacteria 542
246 Ga0466961_0002075 3300044693 Bacteria 12491
247 Ga0466961_0015968 3300044693 Bacteria 4820
248 Ga0466961_0290118 3300044693 Bacteria 1000
249 Ga0466963_0019150 3300044694 Bacteria 4287
250 Ga0466963_0074462 3300044694 Bacteria 2290
251 Ga0466963_0308996 3300044694 Bacteria 1112
252 Ga0466964_0003611 3300044706 Bacteria 5654
253 Ga0466964_0042833 3300044706 Bacteria 1835
254 Ga0466971_0003644 3300044719 Bacteria 6585
255 Ga0466971_0233236 3300044719 Bacteria 874
256 Ga0466971_0520956 3300044719 Bacteria 588
257 Ga0466970_0004664 3300044765 Bacteria 6765
258 Ga0466970_0112169 3300044765 Bacteria 1489
259 Ga0466957_0003005 3300044842 Bacteria 9155
260 Ga0466957_0028985 3300044842 Bacteria 3298
261 Ga0466960_0114827 3300044901 Bacteria 1403
262 Ga0466960_0410265 3300044901 Bacteria 782
263 Ga0466960_0560713 3300044901 Bacteria 675
264 Ga0466959_0003769 3300045049 Bacteria 10040
265 Ga0466959_0058370 3300045049 Bacteria 2811
266 Ga0466958_0008239 3300045836 Bacteria 5770
267 Ga0466967_0006543 3300045976 Bacteria 8265
268 Ga0466967_1541086 3300045976 Bacteria 662
269 Ga0495603_0012323 3300046455 Bacteria 5175
270 Ga0495603_0015885 3300046455 Bacteria 4550
271 Ga0495590_0028672 3300046457 Bacteria 1952
272 Ga0495629_0009558 3300046459 Bacteria 7087
273 Ga0495629_0530506 3300046459 Bacteria 791
274 Ga0495651_0114455 3300046462 Bacteria 1990
275 Ga0495582_0368126 3300046473 Bacteria 828
276 Ga0495639_0149603 3300046475 Bacteria 1126
277 Ga0495662_0127657 3300046476 Bacteria 1249
278 Ga0495662_0177863 3300046476 Bacteria 1048
279 Ga0495662_0594201 3300046476 Bacteria 541
280 Ga0495594_0019757 3300046499 Bacteria 3583
281 Ga0495594_0154554 3300046499 Bacteria 1302
282 Ga0495594_0207978 3300046499 Bacteria 1116
283 Ga0495596_0030717 3300046500 Bacteria 2149
284 Ga0495596_0184458 3300046500 Bacteria 811
285 Ga0495583_0038334 3300046506 Bacteria 2264
286 Ga0495606_0022096 3300046507 Bacteria 4647
287 Ga0495618_0195954 3300046514 Bacteria 1279
288 Ga0495620_0018361 3300046515 Bacteria 3464
289 Ga0495620_0226705 3300046515 Bacteria 714
290 Ga0495643_0001648 3300046522 Bacteria 19654
291 Ga0495648_0254303 3300046524 Bacteria 846
292 Ga0495666_0014229 3300046526 Bacteria 3964
293 Ga0495642_0025925 3300046528 Bacteria 2326
294 Ga0495652_0058902 3300046529 Bacteria 3251
295 Ga0495587_0217232 3300046536 Bacteria 1079
296 Ga0495597_0410125 3300046542 Bacteria 514
297 Ga0495622_0005530 3300046557 Bacteria 5858
298 Ga0495633_0013505 3300046558 Bacteria 4300
299 Ga0495667_0344781 3300046559 Bacteria 941
300 Ga0495656_0375964 3300046615 Bacteria 740
301 Ga0495668_0112860 3300046616 Bacteria 1486
302 Ga0495634_0026228 3300046642 Bacteria 4068
303 Ga0495625_0469133 3300046660 Bacteria 775
304 Ga0495588_0003032 3300046674 Bacteria 7271
305 Ga0495588_0167362 3300046674 Bacteria 1162
306 Ga0495657_0024033 3300046675 Bacteria 4345
307 Ga0495599_0038494 3300046678 Bacteria 3005
308 Ga0495623_0120236 3300046679 Bacteria 1582
309 Ga0495646_0331925 3300046680 Bacteria 799
310 Ga0495613_0014925 3300046689 Bacteria 5765
311 Ga0495613_0266741 3300046689 Bacteria 1191
312 Ga0495624_0462832 3300046690 Bacteria 759
313 Ga0495670_0296517 3300046691 Bacteria 866
314 Ga0495649_0108771 3300046694 Bacteria 1470
315 Ga0495649_0123745 3300046694 Bacteria 1366
316 Ga0495649_0310547 3300046694 Bacteria 801
317 Ga0495589_0057771 3300046794 Bacteria 1908
318 Ga0495600_0111815 3300046809 Bacteria 1778
319 Ga0495600_0142501 3300046809 Bacteria 1555
320 Ga0495660_0128879 3300046810 Bacteria 1271
321 Ga0495581_0031350 3300047315 Bacteria 3081
322 Ga0495581_0229753 3300047315 Bacteria 1085
323 Ga0495636_0000608 3300047318 Bacteria 13135
324 Ga0495676_0020475 3300047321 Bacteria 5801
325 Ga0495676_0034053 3300047321 Bacteria 4277
326 Ga0495676_0248399 3300047321 Bacteria 1215
327 Ga0495680_0089971 3300047322 Bacteria 2303
328 Ga0495687_014075 3300047443 Bacteria 4137
329 Ga0495687_074082 3300047443 Bacteria 1355
330 Ga0495675_0033603 3300047444 Bacteria 3273
331 Ga0495677_0022538 3300047445 Bacteria 2285
332 Ga0495685_025839 3300047447 Bacteria 2021
333 Ga0495685_092529 3300047447 Bacteria 1001
334 Ga0495684_0095010 3300047471 Bacteria 2257
335 Ga0495686_0064486 3300047472 Bacteria 2267
336 Ga0495686_0096559 3300047472 Bacteria 1788
337 Ga0495593_0199050 3300047673 Bacteria 1007
338 Ga0495602_0077385 3300048088 Bacteria 2815
339 Ga0495614_0586980 3300048089 Bacteria 534
340 Ga0496100_1566356 3300048903 Bacteria 521
341 Ga0496104_0969469 3300048907 Bacteria 755
342 Ga0496105_0687073 3300048908 Bacteria 787
343 Ga0496108_1309237 3300048911 Bacteria 609
344 Ga0496109_0346910 3300048912 Bacteria 1402
345 Ga0496115_1084881 3300048918 Bacteria 608
346 Ga0496121_0763597 3300048924 Bacteria 573
347 Ga0501031_0195705 3300049568 Bacteria 1319
348 Ga0501031_0698046 3300049568 Bacteria 651
349 Ga0501031_0921321 3300049568 Bacteria 559
350 Ga0501032_0014014 3300049569 Bacteria 5688
351 Ga0501032_0087557 3300049569 Bacteria 2068
352 Ga0501032_0393452 3300049569 Bacteria 891
353 Ga0501033_1134304 3300049570 Bacteria 519
354 Ga0501034_0019617 3300049571 Bacteria 6913
355 Ga0501034_0122848 3300049571 Bacteria 2582
356 Ga0501034_0124987 3300049571 Bacteria 2558
357 Ga0501034_0286574 3300049571 Bacteria 1586
358 Ga0501036_0004190 3300049572 Bacteria 11619
359 Ga0501036_0039446 3300049572 Bacteria 3996
360 Ga0501036_0603711 3300049572 Bacteria 910
361 Ga0501036_1334368 3300049572 Bacteria 582
362 Ga0501037_0023522 3300049573 Bacteria 4556
363 Ga0501037_0114200 3300049573 Bacteria 1944
364 Ga0501037_0175544 3300049573 Bacteria 1522
365 Ga0501037_0448285 3300049573 Bacteria 880
366 Ga0501038_0002037 3300049574 Bacteria 18694
367 Ga0501038_0104454 3300049574 Bacteria 2355
368 Ga0501038_0132513 3300049574 Bacteria 2044
369 Ga0501039_0023064 3300049575 Bacteria 4774
370 Ga0501039_0029683 3300049575 Bacteria 4212
371 Ga0501040_0056421 3300049576 Bacteria 2695
372 Ga0501040_0115406 3300049576 Bacteria 1880
373 Ga0501041_0227605 3300049577 Bacteria 1170
374 Ga0501042_0014291 3300049578 Bacteria 5418
375 Ga0501042_0040569 3300049578 Bacteria 3309
376 Ga0501042_0062232 3300049578 Bacteria 2666
377 Ga0501043_0026375 3300049579 Bacteria 4559
378 Ga0501043_0263348 3300049579 Bacteria 1325
379 Ga0501043_1072334 3300049579 Bacteria 570
380 Ga0501046_0010022 3300049580 Bacteria 8161
381 Ga0501046_0041501 3300049580 Bacteria 3671
382 Ga0501046_0173630 3300049580 Bacteria 1616
383 Ga0501046_0189513 3300049580 Bacteria 1535
384 Ga0501046_0195966 3300049580 Bacteria 1505
385 Ga0501047_0046694 3300049581 Bacteria 4185
386 Ga0501047_0392803 3300049581 Bacteria 1220
387 Ga0501047_0579184 3300049581 Bacteria 945
388 Ga0501047_0625591 3300049581 Bacteria 897
389 Ga0501048_0005634 3300049582 Bacteria 9527
390 Ga0501048_0027573 3300049582 Bacteria 4126
391 Ga0501048_0038741 3300049582 Bacteria 3421
392 Ga0501048_0156665 3300049582 Bacteria 1611
393 Ga0501067_0192102 3300049583 Bacteria 1137
394 Ga0501068_0040678 3300049584 Bacteria 2791
395 Ga0501068_0462178 3300049584 Bacteria 822
396 Ga0501068_0667561 3300049584 Bacteria 679
397 Ga0501069_0081830 3300049585 Bacteria 1819
398 Ga0501069_0646509 3300049585 Bacteria 636
399 Ga0501070_0030446 3300049586 Bacteria 4522
400 Ga0501070_0075020 3300049586 Bacteria 2800
401 Ga0501070_0198039 3300049586 Bacteria 1650
402 Ga0501071_0045936 3300049587 Bacteria 3136
403 Ga0501071_1025086 3300049587 Bacteria 637
404 Ga0501072_0012154 3300049588 Bacteria 6579
405 Ga0501072_0023905 3300049588 Bacteria 4749
406 Ga0501073_0067079 3300049589 Bacteria 2501
407 Ga0501074_0030080 3300049590 Bacteria 3935
408 Ga0501075_0026807 3300049591 Bacteria 4244
409 Ga0501075_0243214 3300049591 Bacteria 1372
410 Ga0501076_0315007 3300049592 Bacteria 1283
411 Ga0501076_0558342 3300049592 Bacteria 944
412 Ga0501076_0577077 3300049592 Bacteria 927
413 Ga0501077_0035827 3300049593 Bacteria 3159
414 Ga0501077_1125478 3300049593 Bacteria 505
415 Ga0501079_0102532 3300049741 Bacteria 2219
416 Ga0501079_0143161 3300049741 Bacteria 1862
417 Ga0501079_0159818 3300049741 Bacteria 1757
418 Ga0501080_0028612 3300049742 Bacteria 5187
419 Ga0501080_0039582 3300049742 Bacteria 4399
420 Ga0501081_0060936 3300049743 Bacteria 2615
421 Ga0501081_0148244 3300049743 Bacteria 1684
422 Ga0501083_0028348 3300049744 Bacteria 3859
423 Ga0501035_0033921 3300049822 Bacteria 4640
424 Ga0501035_0146125 3300049822 Bacteria 2053
425 Ga0501035_0196856 3300049822 Bacteria 1730
426 Ga0501035_0980404 3300049822 Bacteria 665
427 Ga0501044_0004632 3300049823 Bacteria 15397
428 Ga0501044_0016316 3300049823 Bacteria 7978
429 Ga0501044_0057602 3300049823 Bacteria 3987
430 Ga0501044_0062667 3300049823 Bacteria 3800
431 Ga0501044_0348383 3300049823 Bacteria 1401
432 Ga0501045_0171980 3300049824 Bacteria 1613
433 Ga0501045_1294160 3300049824 Bacteria 531
434 nmdc:mga03n38_137762_c1 3300050490 Bacteria 1216
435 nmdc:mga03n38_21438_c1 3300050490 Bacteria 2600
436 nmdc:mga0yw44_80626_c1 3300050492 Bacteria 2039
437 nmdc:mga06z11_234306_c1 3300050494 Bacteria 1076
438 nmdc:mga06z11_704683_c1 3300050494 Bacteria 615
439 nmdc:mga07m45_187382_c1 3300050496 Bacteria 1203
440 nmdc:mga07m45_251707_c1 3300050496 Bacteria 1028
441 nmdc:mga0qj67_1277018_c1 3300050509 Bacteria 569
442 nmdc:mga0qj67_715567_c1 3300050509 Bacteria 796
443 nmdc:mga06r32_817778_c1 3300050510 Bacteria 891
444 nmdc:mga08y16_115199_c1 3300050511 Bacteria 2798
445 nmdc:mga08y16_1312800_c1 3300050511 Bacteria 690
446 Ga0495655_0280740 3300053083 Bacteria 567
447 Ga0500578_0745136 3300053086 Bacteria 523
448 Ga0500573_0023630 3300053140 Bacteria 3531
449 Ga0500600_0365461 3300053149 Bacteria 587
450 Ga0501084_0032711 3300054114 Bacteria 4351
451 Ga0501084_0382496 3300054114 Bacteria 1189
452 Ga0501084_1187673 3300054114 Bacteria 640
453 Ga0590077_108563 3300059426 Bacteria 652
454 Ga0587073_0008695 3300059492 Bacteria 1651
455 Ga0501082_0015445 3300060353 Bacteria 6571
456 Ga0501082_0097983 3300060353 Bacteria 2535
457 Ga0466962_0001363 3300061719 Bacteria 11307
458 Ga0466962_0043506 3300061719 Bacteria 2149
459 Ga0466962_0293156 3300061719 Bacteria 804
460 Ga0530510_0058132 3300061734 Bacteria 2795
461 Ga0530510_0128982 3300061734 Bacteria 1860
462 2585309109 2582581313 Bacteria 10042643
463 2585319302 2582581314 Bacteria 11452267
464 2616697354 2616644814 Bacteria 11555299
465 2644440101 2643221678 Bacteria 9540101
466 2785341154 2784746763 Bacteria 9783172
467 2785371558 2784746768 Bacteria 10036182
468 2786672719 2786546132 Bacteria 10419719
469 2808844078 2808606359 Bacteria 9866990
470 2808913676 2808606375 Bacteria 9466072
471 2809234132 2808606448 Bacteria 8656184
472 2862392803 2862382967 Bacteria 10317375
473 2867435119 2867428634 Bacteria 9590268
474 2877679052 2877676314 Bacteria 9512378
475 2919471782 2919468124 Bacteria 9133025
476 2947226891 2947224130 Bacteria 9938529
477 2954383952 2954380949 Bacteria 10050426
478 2954679012 2954673503 Bacteria 9685905
479 2954685140 2954682443 Bacteria 9862841
480 2954714256 2954711539 Bacteria 10867210
481 2954724206 2954721474 Bacteria 10456478
482 2954737633 2954731030 Bacteria 10243860
483 2954743103 2954740390 Bacteria 10229294
484 2954756468 2954749733 Bacteria 10366972
485 2954762061 2954759201 Bacteria 9358192
486 2990060952 2990059506 Bacteria 9321252
487 8008562841 8008558824 Bacteria 10610750
488 8025536223 8025530807 Bacteria 8495698
489 8048411701 8048406513 Bacteria 8936924
490 8054161412 8054160619 Bacteria 7783213
491 Ga0466963_0013275
492 JGI24740J21852_10073845
493 JGI24739J22299_10089324
494 JGI24737J22298_10004111
495 JGI24735J21928_10006789
496 JGI24738J21930_10024366
497 JGI25153J46596_10040026
498 rootH1_10028304
499 rootH2_10085777
500 rootL2_10079641
501 Ga0006562J51391_1064061
502 Ga0006562J51391_1064064
503 Ga0006562J51391_1077577
504 Ga0006562J51391_1077578
505 Ga0058861_11183049
506 Ga0070658_10305905
507 Ga0070683_100040855
508 Ga0070670_100655156
509 Ga0068868_100447867
510 Ga0070660_100959411
511 Ga0070691_10203656
512 Ga0070661_100455307
513 Ga0070668_100882388
514 Ga0070668_102012232
515 Ga0070669_100246565
516 Ga0070674_100048622
517 Ga0070674_100105623
518 Ga0070674_101409271
519 Ga0070688_101591989
520 Ga0070659_101640070
521 Ga0070667_101413248
522 Ga0070701_10027633
523 Ga0070663_100733870
524 Ga0070678_101018129
525 Ga0070662_101421945
526 Ga0068867_100147599
527 Ga0068867_102213927
528 Ga0070685_10375459
529 Ga0070679_100484499
530 Ga0070684_101609654
531 Ga0068853_100141243
532 Ga0070686_100882861
533 Ga0070695_100678161
534 Ga0070696_101620901
535 Ga0070665_100003731
536 Ga0070665_100730720
537 Ga0070665_100973381
538 Ga0068855_100211821
539 Ga0070664_100366536
540 Ga0070664_100772278
541 Ga0068857_100440658
542 Ga0068854_100195890
543 Ga0068854_102286082
544 Ga0068856_100166303
545 Ga0070702_101050595
546 Ga0068852_100596912
547 Ga0068861_100047832
548 Ga0068870_10390580
549 Ga0068860_101247888
550 Ga0068862_100263490
551 Ga0081455_10031588
552 Ga0081539_10003175
553 Ga0075365_10097188
554 Ga0075363_100023714
555 Ga0075363_100106816
556 Ga0075367_10484761
557 Ga0075370_10074099
558 Ga0075370_10204581
559 Ga0075428_100615248
560 Ga0075430_100444772
561 Ga0075430_100840478
562 Ga0075431_100942562
563 Ga0068865_100178309
564 Ga0099826_10059752
565 Ga0105251_10023889
566 Ga0105250_10584834
567 Ga0111539_10774312
568 Ga0105245_11458257
569 Ga0105247_11750312
570 Ga0105243_10114204
571 Ga0105241_12689641
572 Ga0105242_11387513
573 Ga0105248_10527360
574 Ga0105237_12036754
575 Ga0105238_11806068
576 Ga0105249_10994642
577 Ga0105239_10356008
578 Ga0105239_10841051
579 Ga0105239_12973475
580 Ga0105246_10005879
581 Ga0105246_10913082
582 Ga0105246_11681374
583 Ga0157371_10423615
584 Ga0157374_11883945
585 Ga0163162_10781191
586 Ga0163162_11093608
587 Ga0157372_10093126
588 Ga0163163_10968050
589 Ga0183367_1002
590 Ga0206349_1484154
591 Ga0206351_10337206
592 Ga0224712_10512589
593 Ga0209758_1012001
594 Ga0207426_1016462
595 Ga0207713_1041314
596 Ga0207642_10482825
597 Ga0207710_10775469
598 Ga0207647_10009774
599 Ga0207645_10312181
600 Ga0207705_10354525
601 Ga0207657_10770119
602 Ga0207649_10373926
603 Ga0207681_10331135
604 Ga0207659_11541194
605 Ga0207687_10089961
606 Ga0207690_10140514
607 Ga0207690_11381729
608 Ga0207706_10070490
609 Ga0207706_11407927
610 Ga0207706_11582027
611 Ga0207709_10413020
612 Ga0207669_10099130
613 Ga0207704_10452266
614 Ga0207711_10701587
615 Ga0207689_10082980
616 Ga0207661_10639382
617 Ga0207661_11896236
618 Ga0207679_11810654
619 Ga0207667_10151092
620 Ga0207712_10790369
621 Ga0207668_10017231
622 Ga0207668_10210224
623 Ga0207640_10435693
624 Ga0207677_10747420
625 Ga0207639_10279559
626 Ga0207708_10017697
627 Ga0207702_10144810
628 Ga0207648_10118834
629 Ga0207675_100460015
630 Ga0207683_10148101
631 Ga0209371_1012398
632 Ga0209371_1020636
633 Ga0268266_10038783
634 Ga0268266_10354682
635 Ga0268266_12158297
636 Ga0268265_10410362
637 Ga0265319_1000162
638 Ga0268256_1011317
639 Ga0268256_1038434
640 Ga0307511_10090322
641 Ga0307512_10004497
642 Ga0307512_10007977
643 Ga0307513_10076043
644 Ga0307509_10052934
645 Ga0307508_10015525
646 Ga0307508_10074272
647 Ga0307514_10101034
648 Ga0316579_10233477
649 Ga0316576_10006795
650 Ga0316578_10011202
651 Ga0307413_10491488
652 Ga0307518_10117920
653 Ga0307518_10253107
654 Ga0307410_10843665
655 Ga0307410_11909635
656 Ga0307406_10224756
657 Ga0307406_11937201
658 Ga0307412_10354175
659 Ga0307416_100275723
660 Ga0307416_100523776
661 Ga0307416_100951432
662 Ga0307415_100585128
663 Ga0307415_102421691
664 Ga0316593_10043666
665 Ga0316593_10367018
666 Ga0316593_10369516
667 Ga0307507_10692357
668 Ga0316592_1019069
669 Ga0316592_1036322
670 Ga0316592_1047219
671 Ga0316586_1024511
672 Ga0316588_1064711
673 Ga0316588_1066547
674 Ga0316587_1041387
675 Ga0316596_1026620
676 Ga0316596_1053437
677 Ga0316574_0249128
678 Ga0316582_0017285
679 Ga0316582_0257233
680 Ga0316584_0243506
681 Ga0316584_0935126
682 Ga0395899_0625286
683 Ga0395900_0149013
684 Ga0395898_0041052
685 Ga0395898_0449399
686 Ga0395901_0603325
687 Ga0436360_0920373
688 Ga0439436_0000311
689 Ga0439436_0049604
690 Ga0451791_1592389
691 Ga0451802_1822824
692 Ga0451835_0351031
693 Ga0451837_1169212
694 Ga0451849_0813037
695 Ga0451849_1498180
696 Ga0451843_0838438
697 Ga0451855_1063584
698 Ga0451853_0705918
699 Ga0451853_3713840
700 Ga0439433_0000780
701 Ga0439433_0032475
702 Ga0439448_0000913
703 Ga0439449_0001440
704 Ga0439449_0026217
705 Ga0439449_0243119
706 Ga0439450_086184
707 Ga0439454_019037
708 Ga0439454_019816
709 Ga0439455_0000487
710 Ga0439457_059208
711 Ga0439463_026799
712 Ga0450920_053231
713 Ga0450894_001442
714 Ga0450895_013708
715 Ga0450896_000088
716 Ga0450898_024964
717 Ga0450899_000217
718 Ga0450903_000271
719 Ga0450903_020350
720 Ga0450906_006055
721 Ga0439458_0006066
722 Ga0439458_0009657
723 Ga0439458_0039913
724 Ga0450908_055412
725 Ga0450916_014720
726 Ga0466969_0127526
727 Ga0466969_0493200
728 Ga0466972_0003087
729 Ga0466972_0007027
730 Ga0466965_0004953
731 Ga0466965_0045857
732 Ga0466965_0197599
733 Ga0466966_0005960
734 Ga0466966_0013459
735 Ga0466966_0873455
736 Ga0466961_0002075
737 Ga0466961_0015968
738 Ga0466961_0290118
739 Ga0466963_0019150
740 Ga0466963_0074462
741 Ga0466963_0308996
742 Ga0466964_0003611
743 Ga0466964_0042833
744 Ga0466971_0003644
745 Ga0466971_0233236
746 Ga0466971_0520956
747 Ga0466970_0004664
748 Ga0466970_0112169
749 Ga0466957_0003005
750 Ga0466957_0028985
751 Ga0466960_0114827
752 Ga0466960_0410265
753 Ga0466960_0560713
754 Ga0466959_0003769
755 Ga0466959_0058370
756 Ga0466958_0008239
757 Ga0466967_0006543
758 Ga0466967_1541086
759 Ga0495603_0012323
760 Ga0495603_0015885
761 Ga0495590_0028672
762 Ga0495629_0009558
763 Ga0495629_0530506
764 Ga0495651_0114455
765 Ga0495582_0368126
766 Ga0495639_0149603
767 Ga0495662_0127657
768 Ga0495662_0177863
769 Ga0495662_0594201
770 Ga0495594_0019757
771 Ga0495594_0154554
772 Ga0495594_0207978
773 Ga0495596_0030717
774 Ga0495596_0184458
775 Ga0495583_0038334
776 Ga0495606_0022096
777 Ga0495618_0195954
778 Ga0495620_0018361
779 Ga0495620_0226705
780 Ga0495643_0001648
781 Ga0495648_0254303
782 Ga0495666_0014229
783 Ga0495642_0025925
784 Ga0495652_0058902
785 Ga0495587_0217232
786 Ga0495597_0410125
787 Ga0495622_0005530
788 Ga0495633_0013505
789 Ga0495667_0344781
790 Ga0495656_0375964
791 Ga0495668_0112860
792 Ga0495634_0026228
793 Ga0495625_0469133
794 Ga0495588_0003032
795 Ga0495588_0167362
796 Ga0495657_0024033
797 Ga0495599_0038494
798 Ga0495623_0120236
799 Ga0495646_0331925
800 Ga0495613_0014925
801 Ga0495613_0266741
802 Ga0495624_0462832
803 Ga0495670_0296517
804 Ga0495649_0108771
805 Ga0495649_0123745
806 Ga0495649_0310547
807 Ga0495589_0057771
808 Ga0495600_0111815
809 Ga0495600_0142501
810 Ga0495660_0128879
811 Ga0495581_0031350
812 Ga0495581_0229753
813 Ga0495636_0000608
814 Ga0495676_0020475
815 Ga0495676_0034053
816 Ga0495676_0248399
817 Ga0495680_0089971
818 Ga0495687_014075
819 Ga0495687_074082
820 Ga0495675_0033603
821 Ga0495677_0022538
822 Ga0495685_025839
823 Ga0495685_092529
824 Ga0495684_0095010
825 Ga0495686_0064486
826 Ga0495686_0096559
827 Ga0495593_0199050
828 Ga0495602_0077385
829 Ga0495614_0586980
830 Ga0496100_1566356
831 Ga0496104_0969469
832 Ga0496105_0687073
833 Ga0496108_1309237
834 Ga0496109_0346910
835 Ga0496115_1084881
836 Ga0496121_0763597
837 Ga0501031_0195705
838 Ga0501031_0698046
839 Ga0501031_0921321
840 Ga0501032_0014014
841 Ga0501032_0087557
842 Ga0501032_0393452
843 Ga0501033_1134304
844 Ga0501034_0019617
845 Ga0501034_0122848
846 Ga0501034_0124987
847 Ga0501034_0286574
848 Ga0501036_0004190
849 Ga0501036_0039446
850 Ga0501036_0603711
851 Ga0501036_1334368
852 Ga0501037_0023522
853 Ga0501037_0114200
854 Ga0501037_0175544
855 Ga0501037_0448285
856 Ga0501038_0002037
857 Ga0501038_0104454
858 Ga0501038_0132513
859 Ga0501039_0023064
860 Ga0501039_0029683
861 Ga0501040_0056421
862 Ga0501040_0115406
863 Ga0501041_0227605
864 Ga0501042_0014291
865 Ga0501042_0040569
866 Ga0501042_0062232
867 Ga0501043_0026375
868 Ga0501043_0263348
869 Ga0501043_1072334
870 Ga0501046_0010022
871 Ga0501046_0041501
872 Ga0501046_0173630
873 Ga0501046_0189513
874 Ga0501046_0195966
875 Ga0501047_0046694
876 Ga0501047_0392803
877 Ga0501047_0579184
878 Ga0501047_0625591
879 Ga0501048_0005634
880 Ga0501048_0027573
881 Ga0501048_0038741
882 Ga0501048_0156665
883 Ga0501067_0192102
884 Ga0501068_0040678
885 Ga0501068_0462178
886 Ga0501068_0667561
887 Ga0501069_0081830
888 Ga0501069_0646509
889 Ga0501070_0030446
890 Ga0501070_0075020
891 Ga0501070_0198039
892 Ga0501071_0045936
893 Ga0501071_1025086
894 Ga0501072_0012154
895 Ga0501072_0023905
896 Ga0501073_0067079
897 Ga0501074_0030080
898 Ga0501075_0026807
899 Ga0501075_0243214
900 Ga0501076_0315007
901 Ga0501076_0558342
902 Ga0501076_0577077
903 Ga0501077_0035827
904 Ga0501077_1125478
905 Ga0501079_0102532
906 Ga0501079_0143161
907 Ga0501079_0159818
908 Ga0501080_0028612
909 Ga0501080_0039582
910 Ga0501081_0060936
911 Ga0501081_0148244
912 Ga0501083_0028348
913 Ga0501035_0033921
914 Ga0501035_0146125
915 Ga0501035_0196856
916 Ga0501035_0980404
917 Ga0501044_0004632
918 Ga0501044_0016316
919 Ga0501044_0057602
920 Ga0501044_0062667
921 Ga0501044_0348383
922 Ga0501045_0171980
923 Ga0501045_1294160
924 nmdc:mga03n38_137762_c1
925 nmdc:mga03n38_21438_c1
926 nmdc:mga0yw44_80626_c1
927 nmdc:mga06z11_234306_c1
928 nmdc:mga06z11_704683_c1
929 nmdc:mga07m45_187382_c1
930 nmdc:mga07m45_251707_c1
931 nmdc:mga0qj67_1277018_c1
932 nmdc:mga0qj67_715567_c1
933 nmdc:mga06r32_817778_c1
934 nmdc:mga08y16_115199_c1
935 nmdc:mga08y16_1312800_c1
936 Ga0495655_0280740
937 Ga0500578_0745136
938 Ga0500573_0023630
939 Ga0500600_0365461
940 Ga0501084_0032711
941 Ga0501084_0382496
942 Ga0501084_1187673
943 Ga0590077_108563
944 Ga0587073_0008695
945 Ga0501082_0015445
946 Ga0501082_0097983
947 Ga0466962_0001363
948 Ga0466962_0043506
949 Ga0466962_0293156
950 Ga0530510_0058132
951 Ga0530510_0128982
952 2585309109
953 2585319302
954 2616697354
955 2644440101
956 2785341154
957 2785371558
958 2786672719
959 2808844078
960 2808913676
961 2809234132
962 2862392803
963 2867435119
964 2877679052
965 2919471782
966 2947226891
967 2954383952
968 2954679012
969 2954685140
970 2954714256
971 2954724206
972 2954737633
973 2954743103
974 2954756468
975 2954762061
976 2990060952
977 8008562841
978 8025536223
979 8048411701
980 8054161412

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

12

114

0.97

PF13098

Thioredoxin_2

Thioredoxin-like domain

25

112

0.81

PF14595

Thioredoxin_9

Thioredoxin

4

116

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6esx-assembly1.cif.gz_A caulobacter crescentus trx1 0.9912 1 102
3nof-assembly1.cif.gz_A mycobacterium tuberculosis thioredoxin c c40s mutant 0.9873 1 104
4ulx-assembly1.cif.gz_A crystal structure of ancestral thioredoxin, relative to the last common ancestor of the cyanobacterial, deinococcus and thermus groups, lpbca-l89k mutant. 0.9867 1 104
2yn1-assembly2.cif.gz_B crystal structure of ancestral thioredoxin relative to last gamma- proteobacteria common ancestor (lgpca) from the precambrian period 0.9848 2 104
1t00-assembly1.cif.gz_A the structure of thioredoxin from s. coelicolor 0.9833 2 103
ID Description Score Start End Superfamily
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9867 1 104 3.40.30.10
5hr1G00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.978 26 100 3.40.30.10
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9774 1 104 3.40.30.10
af_Q8LD49_56_177_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9741 1 103 3.40.30.10
3dieB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9725 29 104 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3N1DS40-F1-model_v4 deleted 1.004 1 104
AF-A0A7H8LQB1-F1-model_v4 deleted 1.003 1 104
AF-A0A7G1P3F4-F1-model_v4 Thioredoxin 1.002 1 104 GO:0005829
GO:0015035
GO:0045454
AF-A0A542W936-F1-model_v4 deleted 1.002 1 104
AF-A0A1X4IDY4-F1-model_v4 Thioredoxin 1.002 1 103 GO:0005829
GO:0015035
GO:0045454

Map