F453851

General Info

Members Datasets Scaffolds Average Seq Length
489 314 415 251

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0083115|Ga0496100_0083115_737_1510
Length 257
Sequence MGLVVSGHSKWATTKHQKAAKDAKRGKLFAKLIKNIEVAARTGGGDPDGNPTLYDAIQKARKNSVPIDNIDRAVKRGSGAEAGGADWQTIMYEGYGPSGVAVLIECLTDNRNRAATEVRVAMTRNGGNMADPGSVAYMFNRKGVVIVPKNGNSEDDILEVVLDAGAEEVNDLGESFEIVSEATDLIPVRTALQAAGIDYDSADSSFLPSVQVELDEEGARKVFKLIDALEDSDDVQNVFANFDVSDDVLEALEAADA

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2643221549 Agromyces sp. Root1464 Isolate Unclassified
4 2643221572 Leifsonia sp. Root60 Isolate Unclassified
5 2643221575 Microbacterium sp. Root61 Isolate Unclassified
6 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
7 2643221616 Leifsonia sp. Root227 Isolate Unclassified
8 2643221619 Agromyces sp. Root81 Isolate Unclassified
9 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
10 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
11 2643221649 Leifsonia sp. Root4 Isolate Unclassified
12 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
13 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
14 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
15 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
16 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
17 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
18 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
19 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
20 2808606372 Agromyces sp. 23-23 Isolate Unclassified
21 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
22 2808606448 Streptomyces sp. 193411 Isolate Unclassified
23 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
24 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
25 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
26 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
27 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
28 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
29 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
30 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
31 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
32 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
33 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
34 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
35 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
36 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
37 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
38 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
39 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
40 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
41 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
42 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
43 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
44 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
45 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
46 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
47 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
48 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
49 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
50 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
51 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
52 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
53 2928153084 Leifsonia sp. 563 Isolate Unclassified
54 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
55 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
56 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
57 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
58 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
59 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
60 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
61 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
62 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
63 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
64 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
65 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
66 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
67 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
68 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
69 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
70 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
71 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
72 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
73 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
74 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
75 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
76 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
77 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
78 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
79 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
80 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
81 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
82 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
83 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
117 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
127 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
161 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
179 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
180 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
181 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
182 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
183 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
184 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
185 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
186 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
187 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
188 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
189 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
211 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
220 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
224 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
284 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
285 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
286 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
287 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
290 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
291 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
292 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
293 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
294 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
295 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
296 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
297 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
298 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
303 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
304 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
305 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
306 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
307 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
308 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
309 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
310 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
311 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
312 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
313 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
314 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.23
Metatranscriptomes 1.64
Isolates 15.13

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 10.22
Nodule 0.82
Rhizoplane 4.09
Rhizosphere 68.92
Stem 0
Stem Tuber 0.2
Unclassified 15.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10034139 3300001989 Bacteria 1735
2 JGI24737J22298_10036863 3300001990 Bacteria 1509
3 JGI24735J21928_10001646 3300002067 Bacteria 7916
4 JGI24735J21928_10032285 3300002067 Bacteria 1550
5 JGI24738J21930_10023097 3300002075 Bacteria 1284
6 JGI25165J46597_1000004 3300003214 Bacteria 667510
7 Ga0006562J51391_1011017 3300003578 Bacteria 8656
8 Ga0006562J51391_1011018 3300003578 Bacteria 7180
9 Ga0055539_1000008 3300003752 Bacteria 537665
10 Ga0055533_1000001 3300003756 Bacteria 1863437
11 Ga0055525_1000510 3300003759 Bacteria 19192
12 Ga0055527_1000001 3300003760 Bacteria 850044
13 Ga0055529_1000018 3300003763 Bacteria 344344
14 Ga0055541_1002952 3300003841 Bacteria 3280
15 Ga0065714_10003729 3300005288 Bacteria 11522
16 Ga0070658_10000365 3300005327 Bacteria 39392
17 Ga0070658_10121391 3300005327 Bacteria 2171
18 Ga0070660_100285270 3300005339 Bacteria 1351
19 Ga0070661_100050555 3300005344 Bacteria 3041
20 Ga0070671_100114348 3300005355 Bacteria 2268
21 Ga0070673_100136647 3300005364 Bacteria 2064
22 Ga0070659_100010846 3300005366 Bacteria 6718
23 Ga0070710_10023830 3300005437 Bacteria 3222
24 Ga0068867_100201894 3300005459 Bacteria 1592
25 Ga0068853_100125797 3300005539 Bacteria 2290
26 Ga0070672_100020326 3300005543 Bacteria 4841
27 Ga0070672_100256498 3300005543 Bacteria 1474
28 Ga0068855_100003240 3300005563 Bacteria 19919
29 Ga0068855_100026499 3300005563 Bacteria 6934
30 Ga0068855_100092996 3300005563 Bacteria 3477
31 Ga0068855_100189979 3300005563 Bacteria 2317
32 Ga0068857_100005133 3300005577 Bacteria 11130
33 Ga0068854_100042559 3300005578 Bacteria 3215
34 Ga0068856_100076146 3300005614 Bacteria 3324
35 Ga0068852_100005104 3300005616 Bacteria 9350
36 Ga0068852_100011239 3300005616 Bacteria 6730
37 Ga0068852_100121266 3300005616 Bacteria 2394
38 Ga0068851_10000003 3300005834 Bacteria 293018
39 Ga0068863_100171437 3300005841 Bacteria 2081
40 Ga0068858_100000293 3300005842 Bacteria 54164
41 Ga0075365_10001642 3300006038 Bacteria 10318
42 Ga0075363_100002664 3300006048 Bacteria 7372
43 Ga0075363_100060029 3300006048 Bacteria 2046
44 Ga0075367_10004426 3300006178 Bacteria 6864
45 Ga0099826_10128050 3300006948 Bacteria 1485
46 Ga0105240_10036243 3300009093 Bacteria 6347
47 Ga0105240_10244321 3300009093 Bacteria 2079
48 Ga0105247_10039785 3300009101 Bacteria 2873
49 Ga0105241_10001977 3300009174 Bacteria 15515
50 Ga0105248_11026507 3300009177 Bacteria 932
51 Ga0105237_10080050 3300009545 Bacteria 3257
52 Ga0105238_10308628 3300009551 Bacteria 1567
53 Ga0105239_10156168 3300010375 Bacteria 2548
54 Ga0105239_10203430 3300010375 Bacteria 2219
55 Ga0105239_10621191 3300010375 Bacteria 1233
56 Ga0157371_10002974 3300013102 Bacteria 15738
57 Ga0157370_10002771 3300013104 Bacteria 20948
58 Ga0157369_10005995 3300013105 Bacteria 14120
59 Ga0157369_10175932 3300013105 Bacteria 2253
60 Ga0157369_10216026 3300013105 Bacteria 2008
61 Ga0157369_10346434 3300013105 Bacteria 1543
62 Ga0163162_10788858 3300013306 Bacteria 1068
63 Ga0157375_11022262 3300013308 Bacteria 965
64 Ga0163163_10040277 3300014325 Bacteria 4562
65 Ga0157380_10147514 3300014326 Bacteria 2029
66 Ga0157379_10058477 3300014968 Bacteria 3447
67 Ga0182007_10000233 3300015262 Bacteria 37325
68 Ga0182005_1022071 3300015265 Bacteria 1745
69 Ga0183367_1010 3300015688 Bacteria 416164
70 Ga0206350_10987396 3300020080 Bacteria 1031
71 Ga0206354_10259657 3300020081 Bacteria 4765
72 Ga0224712_10009142 3300022467 Bacteria 2972
73 Ga0209566_100050 3300025225 Bacteria 234653
74 Ga0209674_100001 3300025226 Bacteria 4013750
75 Ga0209672_100006 3300025228 Bacteria 1004497
76 Ga0209147_100819 3300025229 Bacteria 14772
77 Ga0209563_100001 3300025230 Bacteria 4013775
78 Ga0207427_100010 3300025231 Bacteria 648610
79 Ga0209437_100485 3300025233 Bacteria 29431
80 Ga0209677_100001 3300025253 Bacteria 4013787
81 Ga0209677_100187 3300025253 Bacteria 50389
82 Ga0209148_1000015 3300025254 Bacteria 850103
83 Ga0209148_1001848 3300025254 Bacteria 8873
84 Ga0209233_1000001 3300025261 Bacteria 2992747
85 Ga0209455_1000013 3300025272 Bacteria 850103
86 Ga0207656_10000002 3300025321 Bacteria 792178
87 Ga0207688_10076652 3300025901 Bacteria 1904
88 Ga0207647_10056431 3300025904 Bacteria 2410
89 Ga0207647_10248815 3300025904 Bacteria 1020
90 Ga0207645_10247884 3300025907 Bacteria 1178
91 Ga0207705_10000006 3300025909 Bacteria 657147
92 Ga0207654_10000003 3300025911 Bacteria 1030378
93 Ga0207695_10043644 3300025913 Bacteria 4778
94 Ga0207695_10090226 3300025913 Bacteria 3081
95 Ga0207671_10000002 3300025914 Bacteria 1144816
96 Ga0207657_10016590 3300025919 Bacteria 7096
97 Ga0207657_10072276 3300025919 Bacteria 2919
98 Ga0207657_10352828 3300025919 Bacteria 1160
99 Ga0207694_10000138 3300025924 Bacteria 74645
100 Ga0207694_10245795 3300025924 Bacteria 1463
101 Ga0207659_10659474 3300025926 Bacteria 894
102 Ga0207687_10221335 3300025927 Bacteria 1491
103 Ga0207644_10102514 3300025931 Bacteria 2152
104 Ga0207690_10012271 3300025932 Bacteria 5128
105 Ga0207709_10107273 3300025935 Bacteria 1859
106 Ga0207704_10364029 3300025938 Bacteria 1130
107 Ga0207691_10101732 3300025940 Bacteria 2564
108 Ga0207691_10135478 3300025940 Bacteria 2172
109 Ga0207711_10006970 3300025941 Bacteria 9485
110 Ga0207711_10040642 3300025941 Bacteria 3956
111 Ga0207689_10395566 3300025942 Bacteria 1152
112 Ga0207667_10002554 3300025949 Bacteria 22656
113 Ga0207667_10004184 3300025949 Bacteria 17725
114 Ga0207667_10201716 3300025949 Bacteria 2040
115 Ga0207667_10423680 3300025949 Bacteria 1354
116 Ga0207668_10143454 3300025972 Bacteria 1840
117 Ga0207703_10000305 3300026035 Bacteria 53985
118 Ga0207639_10098672 3300026041 Bacteria 2355
119 Ga0207678_10107392 3300026067 Bacteria 2381
120 Ga0207702_10040926 3300026078 Bacteria 3885
121 Ga0207648_10147856 3300026089 Bacteria 2073
122 Ga0207674_10018661 3300026116 Bacteria 7534
123 Ga0207683_10007808 3300026121 Bacteria 9156
124 Ga0207698_10000343 3300026142 Bacteria 27502
125 Ga0207698_10009152 3300026142 Bacteria 6296
126 Ga0209282_1210266 3300027666 Bacteria 889
127 Ga0209813_10019930 3300027866 Bacteria 1870
128 Ga0268265_10269263 3300028380 Bacteria 1519
129 Ga0307515_10172891 3300028794 Bacteria 2144
130 Ga0307513_10149592 3300031456 Bacteria 2246
131 Ga0307514_10005180 3300031649 Bacteria 11761
132 Ga0307514_10049057 3300031649 Bacteria 3285
133 Ga0307514_10108083 3300031649 Bacteria 1979
134 Ga0307413_10443030 3300031824 Bacteria 1029
135 Ga0307413_10616033 3300031824 Bacteria 890
136 Ga0307518_10126068 3300031838 Bacteria 1806
137 Ga0307406_10247083 3300031901 Bacteria 1342
138 Ga0307412_10184562 3300031911 Bacteria 1572
139 Ga0307412_10579185 3300031911 Bacteria 947
140 Ga0307409_100164866 3300031995 Bacteria 1943
141 Ga0307414_10223648 3300032004 Bacteria 1547
142 Ga0307411_10080144 3300032005 Bacteria 2244
143 Ga0307415_100133437 3300032126 Bacteria 1884
144 Ga0395899_0002537 3300037312 Bacteria 14792
145 Ga0395899_0022706 3300037312 Bacteria 4753
146 Ga0395900_0004762 3300037418 Bacteria 14300
147 Ga0395900_0281133 3300037418 Bacteria 1656
148 Ga0395900_0439519 3300037418 Bacteria 1262
149 Ga0395898_0001540 3300037466 Bacteria 31698
150 Ga0395898_0055380 3300037466 Bacteria 3868
151 Ga0395901_0356309 3300038443 Bacteria 1509
152 Ga0439465_0070442 3300041413 Bacteria 1171
153 Ga0451791_1421250 3300041451 Bacteria 1429
154 Ga0451791_1718467 3300041451 Bacteria 1136
155 Ga0439442_011733 3300042002 Bacteria 1787
156 Ga0439449_0007770 3300042007 Bacteria 4071
157 Ga0439455_0020249 3300042012 Bacteria 1575
158 Ga0439457_003329 3300042014 Bacteria 4390
159 Ga0450894_000841 3300042131 Bacteria 4934
160 Ga0450899_001503 3300042135 Bacteria 2595
161 Ga0450903_002143 3300042138 Bacteria 3534
162 Ga0450906_010158 3300042145 Bacteria 1785
163 Ga0439458_0002813 3300042157 Bacteria 4189
164 Ga0450908_007324 3300042184 Bacteria 2080
165 Ga0466972_0077472 3300044658 Bacteria 1583
166 Ga0466965_0002637 3300044683 Bacteria 7679
167 Ga0466966_0019134 3300044684 Bacteria 4507
168 Ga0466966_0139297 3300044684 Bacteria 1483
169 Ga0466961_0000546 3300044693 Bacteria 23957
170 Ga0466961_0016154 3300044693 Bacteria 4792
171 Ga0466963_0000076 3300044694 Bacteria 34056
172 Ga0466971_0001258 3300044719 Bacteria 10559
173 Ga0466971_0031466 3300044719 Bacteria 2376
174 Ga0466971_0179579 3300044719 Bacteria 995
175 Ga0466968_0030855 3300044735 Bacteria 2222
176 Ga0466968_0095460 3300044735 Bacteria 1323
177 Ga0466970_0013449 3300044765 Bacteria 4195
178 Ga0466970_0028572 3300044765 Bacteria 2931
179 Ga0466970_0029514 3300044765 Bacteria 2887
180 Ga0466970_0078107 3300044765 Bacteria 1785
181 Ga0466970_0235682 3300044765 Bacteria 1023
182 Ga0466970_0259026 3300044765 Bacteria 975
183 Ga0466957_0000061 3300044842 Bacteria 40928
184 Ga0466957_0017944 3300044842 Bacteria 4151
185 Ga0466960_0008996 3300044901 Bacteria 4105
186 Ga0466960_0029390 3300044901 Bacteria 2522
187 Ga0466960_0054847 3300044901 Bacteria 1936
188 Ga0466959_0000750 3300045049 Bacteria 19015
189 Ga0466959_0005031 3300045049 Bacteria 8978
190 Ga0466959_0216100 3300045049 Bacteria 1331
191 Ga0466958_0011536 3300045836 Bacteria 4977
192 Ga0466958_0042819 3300045836 Bacteria 2726
193 Ga0495592_0018420 3300046454 Bacteria 5310
194 Ga0495603_0006710 3300046455 Bacteria 6908
195 Ga0495590_0000112 3300046457 Bacteria 49282
196 Ga0495629_0164643 3300046459 Bacteria 1540
197 Ga0495629_0297332 3300046459 Bacteria 1106
198 Ga0495638_0104805 3300046460 Bacteria 1686
199 Ga0495641_0036959 3300046461 Bacteria 2292
200 Ga0495641_0141711 3300046461 Bacteria 1074
201 Ga0495651_0218107 3300046462 Bacteria 1322
202 Ga0495653_0172028 3300046463 Bacteria 1494
203 Ga0495653_0264365 3300046463 Bacteria 1136
204 Ga0495650_0001784 3300046471 Bacteria 19473
205 Ga0495605_0008535 3300046474 Bacteria 5789
206 Ga0495594_0053202 3300046499 Bacteria 2230
207 Ga0495607_0059306 3300046501 Bacteria 2183
208 Ga0495608_0098612 3300046511 Bacteria 1885
209 Ga0495616_0008444 3300046513 Bacteria 6100
210 Ga0495618_0138831 3300046514 Bacteria 1554
211 Ga0495631_0021008 3300046518 Bacteria 3042
212 Ga0495632_0075985 3300046519 Bacteria 1607
213 Ga0495644_0063590 3300046523 Bacteria 1387
214 Ga0495648_0062636 3300046524 Bacteria 2201
215 Ga0495652_0020616 3300046529 Bacteria 5859
216 Ga0495652_0040288 3300046529 Bacteria 4037
217 Ga0495640_0005847 3300046533 Bacteria 9766
218 Ga0495640_0065394 3300046533 Bacteria 2455
219 Ga0495622_0019126 3300046557 Bacteria 3189
220 Ga0495633_0016015 3300046558 Bacteria 3877
221 Ga0495667_0145812 3300046559 Bacteria 1525
222 Ga0495667_0242539 3300046559 Bacteria 1148
223 Ga0495634_0003650 3300046642 Bacteria 12279
224 Ga0495634_0226211 3300046642 Bacteria 1152
225 Ga0495611_0015694 3300046648 Bacteria 3236
226 Ga0495657_0038936 3300046675 Bacteria 3268
227 Ga0495657_0059645 3300046675 Bacteria 2530
228 Ga0495613_0185652 3300046689 Bacteria 1471
229 Ga0495624_0073702 3300046690 Bacteria 2122
230 Ga0495600_0034996 3300046809 Bacteria 3261
231 Ga0495604_0045320 3300047317 Bacteria 3432
232 Ga0495604_0099836 3300047317 Bacteria 2135
233 Ga0495674_0310631 3300047319 Bacteria 1286
234 Ga0495674_0388019 3300047319 Bacteria 1129
235 Ga0495672_0002870 3300047320 Bacteria 15291
236 Ga0495672_0037372 3300047320 Bacteria 2972
237 Ga0495672_0065281 3300047320 Bacteria 2081
238 Ga0495676_0037320 3300047321 Bacteria 4045
239 Ga0495676_0116791 3300047321 Bacteria 1947
240 Ga0495676_0124757 3300047321 Bacteria 1867
241 Ga0495680_0026336 3300047322 Bacteria 4796
242 Ga0495680_0147140 3300047322 Bacteria 1720
243 Ga0495686_0052602 3300047472 Bacteria 2553
244 Ga0495686_0082714 3300047472 Bacteria 1959
245 Ga0495686_0113225 3300047472 Bacteria 1625
246 Ga0495686_0127998 3300047472 Bacteria 1508
247 Ga0496100_0083115 3300048903 Bacteria 2167
248 Ga0496101_0012309 3300048904 Bacteria 5705
249 Ga0496102_0000072 3300048905 Bacteria 150284
250 Ga0496102_0135415 3300048905 Bacteria 2308
251 Ga0496103_0000158 3300048906 Bacteria 71302
252 Ga0496104_0492305 3300048907 Bacteria 1137
253 Ga0496105_0028599 3300048908 Bacteria 4558
254 Ga0496105_0036513 3300048908 Bacteria 4049
255 Ga0496108_0165640 3300048911 Bacteria 1911
256 Ga0496108_0180242 3300048911 Bacteria 1829
257 Ga0496109_0188089 3300048912 Bacteria 1940
258 Ga0496111_0407259 3300048914 Bacteria 1005
259 Ga0496114_0001292 3300048917 Bacteria 18948
260 Ga0496114_0037775 3300048917 Bacteria 3995
261 Ga0496114_0125099 3300048917 Bacteria 2215
262 Ga0496114_0236585 3300048917 Bacteria 1605
263 Ga0496115_0104089 3300048918 Bacteria 2329
264 Ga0496115_0172505 3300048918 Bacteria 1788
265 Ga0496117_0000128 3300048920 Bacteria 166039
266 Ga0496117_0001642 3300048920 Bacteria 31427
267 Ga0496117_0003865 3300048920 Bacteria 17038
268 Ga0496117_0018551 3300048920 Bacteria 5755
269 Ga0496117_0140002 3300048920 Bacteria 1451
270 Ga0496117_0189665 3300048920 Bacteria 1172
271 Ga0496118_0000605 3300048921 Bacteria 59079
272 Ga0496118_0006139 3300048921 Bacteria 13336
273 Ga0496118_0007657 3300048921 Bacteria 11371
274 Ga0496118_0013193 3300048921 Bacteria 7838
275 Ga0496118_0024760 3300048921 Bacteria 5171
276 Ga0496119_0000568 3300048922 Bacteria 49842
277 Ga0496119_0002374 3300048922 Bacteria 20694
278 Ga0496119_0002900 3300048922 Bacteria 18300
279 Ga0496119_0007201 3300048922 Bacteria 10076
280 Ga0496119_0031500 3300048922 Bacteria 3555
281 Ga0496119_0129498 3300048922 Bacteria 1377
282 Ga0496120_0004564 3300048923 Bacteria 11538
283 Ga0496121_0163010 3300048924 Bacteria 1628
284 Ga0496122_0000240 3300048925 Bacteria 123001
285 Ga0496122_0003597 3300048925 Bacteria 20193
286 Ga0496122_0018805 3300048925 Bacteria 6354
287 Ga0496123_0000076 3300048926 Bacteria 194050
288 Ga0496123_0003240 3300048926 Bacteria 18522
289 Ga0496123_0008911 3300048926 Bacteria 9122
290 Ga0496123_0167656 3300048926 Bacteria 1162
291 Ga0496124_0000363 3300048927 Bacteria 82857
292 Ga0496124_0002643 3300048927 Bacteria 23026
293 Ga0496124_0040764 3300048927 Bacteria 4014
294 Ga0496125_0092662 3300048928 Bacteria 2258
295 Ga0496126_0001967 3300048929 Bacteria 29116
296 Ga0496126_0100430 3300048929 Bacteria 2532
297 Ga0496126_0129393 3300048929 Bacteria 2183
298 Ga0496126_0147583 3300048929 Bacteria 2018
299 Ga0495682_0012942 3300049460 Bacteria 3186
300 Ga0501031_0004287 3300049568 Bacteria 9226
301 Ga0501031_0186363 3300049568 Bacteria 1355
302 Ga0501033_0001204 3300049570 Bacteria 23315
303 Ga0501033_0003199 3300049570 Bacteria 13577
304 Ga0501033_0011615 3300049570 Bacteria 6736
305 Ga0501033_0038454 3300049570 Bacteria 3576
306 Ga0501033_0049682 3300049570 Bacteria 3113
307 Ga0501033_0077646 3300049570 Bacteria 2436
308 Ga0501033_0147660 3300049570 Bacteria 1697
309 Ga0501034_0007050 3300049571 Bacteria 11987
310 Ga0501034_0011108 3300049571 Bacteria 9350
311 Ga0501034_0026035 3300049571 Bacteria 5958
312 Ga0501034_0034034 3300049571 Bacteria 5166
313 Ga0501034_0060935 3300049571 Bacteria 3790
314 Ga0501034_0197441 3300049571 Bacteria 1971
315 Ga0501036_0001444 3300049572 Bacteria 18258
316 Ga0501036_0006910 3300049572 Bacteria 9225
317 Ga0501036_0027920 3300049572 Bacteria 4771
318 Ga0501036_0082330 3300049572 Bacteria 2720
319 Ga0501037_0006659 3300049573 Bacteria 8447
320 Ga0501037_0137770 3300049573 Bacteria 1748
321 Ga0501037_0264429 3300049573 Bacteria 1201
322 Ga0501038_0003780 3300049574 Bacteria 14087
323 Ga0501038_0031295 3300049574 Bacteria 4702
324 Ga0501039_0017847 3300049575 Bacteria 5444
325 Ga0501039_0033419 3300049575 Bacteria 3965
326 Ga0501039_0141789 3300049575 Bacteria 1887
327 Ga0501042_0000959 3300049578 Bacteria 16259
328 Ga0501042_0009952 3300049578 Bacteria 6355
329 Ga0501042_0068040 3300049578 Bacteria 2546
330 Ga0501043_0005470 3300049579 Bacteria 10265
331 Ga0501043_0017470 3300049579 Bacteria 5623
332 Ga0501043_0150640 3300049579 Bacteria 1820
333 Ga0501043_0161066 3300049579 Bacteria 1753
334 Ga0501043_0555246 3300049579 Bacteria 852
335 Ga0501046_0001960 3300049580 Bacteria 19559
336 Ga0501046_0011198 3300049580 Bacteria 7681
337 Ga0501046_0032770 3300049580 Bacteria 4204
338 Ga0501046_0142928 3300049580 Bacteria 1809
339 Ga0501047_0000734 3300049581 Bacteria 34151
340 Ga0501047_0024747 3300049581 Bacteria 5763
341 Ga0501047_0028523 3300049581 Bacteria 5383
342 Ga0501047_0078349 3300049581 Bacteria 3178
343 Ga0501047_0277721 3300049581 Bacteria 1520
344 Ga0501048_0004101 3300049582 Bacteria 11094
345 Ga0501048_0004779 3300049582 Bacteria 10324
346 Ga0501048_0063045 3300049582 Bacteria 2622
347 Ga0501068_0122696 3300049584 Bacteria 1621
348 Ga0501068_0231670 3300049584 Bacteria 1174
349 Ga0501069_0005906 3300049585 Bacteria 6379
350 Ga0501069_0132368 3300049585 Bacteria 1428
351 Ga0501070_0000593 3300049586 Bacteria 33023
352 Ga0501070_0000871 3300049586 Bacteria 27465
353 Ga0501070_0001065 3300049586 Bacteria 24645
354 Ga0501070_0045284 3300049586 Bacteria 3659
355 Ga0501070_0288401 3300049586 Bacteria 1338
356 Ga0501070_0555674 3300049586 Bacteria 918
357 Ga0501070_0661668 3300049586 Bacteria 828
358 Ga0501071_0000398 3300049587 Bacteria 21451
359 Ga0501073_0032050 3300049589 Bacteria 3749
360 Ga0501073_0224644 3300049589 Bacteria 1297
361 Ga0501073_0446754 3300049589 Bacteria 894
362 Ga0501074_0059669 3300049590 Bacteria 2748
363 Ga0501080_0102908 3300049742 Bacteria 2649
364 Ga0501080_0305016 3300049742 Bacteria 1443
365 Ga0501083_0000003 3300049744 Bacteria 235949
366 Ga0501083_0131647 3300049744 Bacteria 1640
367 Ga0501035_0003800 3300049822 Bacteria 14388
368 Ga0501035_0006714 3300049822 Bacteria 10755
369 Ga0501035_0021463 3300049822 Bacteria 5935
370 Ga0501035_0038301 3300049822 Bacteria 4342
371 Ga0501035_0091221 3300049822 Bacteria 2681
372 Ga0501035_0096303 3300049822 Bacteria 2600
373 Ga0501044_0003168 3300049823 Bacteria 18577
374 Ga0501044_0014228 3300049823 Bacteria 8592
375 Ga0501044_0021922 3300049823 Bacteria 6811
376 Ga0501044_0022406 3300049823 Bacteria 6731
377 Ga0501044_0082562 3300049823 Bacteria 3251
378 Ga0501044_0083878 3300049823 Bacteria 3221
379 Ga0501044_0104671 3300049823 Bacteria 2843
380 Ga0501044_0175214 3300049823 Bacteria 2114
381 Ga0501044_0308883 3300049823 Bacteria 1508
382 Ga0501044_0452627 3300049823 Bacteria 1190
383 Ga0501045_0025140 3300049824 Bacteria 4278
384 nmdc:mga03n38_10543_c1 3300050490 Bacteria 2798
385 nmdc:mga0yw44_204998_c1 3300050492 Bacteria 1303
386 nmdc:mga0yw44_75137_c1 3300050492 Bacteria 2106
387 nmdc:mga06z11_5002_c1 3300050494 Bacteria 5269
388 nmdc:mga04h51_26460_c1 3300050495 Bacteria 1794
389 Ga0500635_0000012 3300053080 Bacteria 138781
390 Ga0495595_0099872 3300053084 Bacteria 1400
391 Ga0500651_0000344 3300053093 Bacteria 26078
392 Ga0500556_0000001 3300053104 Bacteria 1135060
393 Ga0500559_0000194 3300053136 Bacteria 48792
394 Ga0500559_0092647 3300053136 Bacteria 1385
395 Ga0500559_0109405 3300053136 Bacteria 1279
396 Ga0500568_0000006 3300053139 Bacteria 522235
397 Ga0500568_0000534 3300053139 Bacteria 28043
398 Ga0500573_0000013 3300053140 Bacteria 196637
399 Ga0500573_0000998 3300053140 Bacteria 12986
400 Ga0500573_0027716 3300053140 Bacteria 3258
401 Ga0500573_0046563 3300053140 Bacteria 2499
402 Ga0500573_0081148 3300053140 Bacteria 1843
403 Ga0500573_0147366 3300053140 Bacteria 1291
404 Ga0500577_0054210 3300053142 Bacteria 1518
405 Ga0500588_0022863 3300053146 Bacteria 1707
406 Ga0500616_0000021 3300053153 Bacteria 484527
407 Ga0500616_0009117 3300053153 Bacteria 6066
408 Ga0500620_000020 3300053155 Bacteria 32727
409 Ga0500645_004016 3300053730 Bacteria 5785
410 Ga0501084_0113874 3300054114 Bacteria 2274
411 Ga0587073_0031537 3300059492 Bacteria 1098
412 Ga0587073_0082454 3300059492 Bacteria 801
413 Ga0587106_034960 3300059605 Bacteria 826
414 Ga0501082_0063276 3300060353 Bacteria 3186
415 Ga0466962_0001239 3300061719 Bacteria 11758

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042014 Ga0439457_003329 Ga0439457_003329_16_723 235
2 3300049568 Ga0501031_0186363 Ga0501031_0186363_618_1325 235
3 3300049822 Ga0501035_0096303 Ga0501035_0096303_1861_2568 235
4 3300048925 Ga0496122_0018805 Ga0496122_0018805_270_1037 236
5 3300048926 Ga0496123_0003240 Ga0496123_0003240_8142_8909 236
6 3300047320 Ga0495672_0037372 Ga0495672_0037372_936_1694 237
7 3300048929 Ga0496126_0129393 Ga0496126_0129393_141_908 237
8 3300041451 Ga0451791_1421250 Ga0451791_1421250_268_1029 239
9 3300053093 Ga0500651_0000344 Ga0500651_0000344_17355_18116 243
10 3300053155 Ga0500620_000020 Ga0500620_000020_9345_10106 243
11 3300048920 Ga0496117_0140002 Ga0496117_0140002_455_1219 244
12 3300048921 Ga0496118_0024760 Ga0496118_0024760_730_1494 244
13 3300048922 Ga0496119_0000568 Ga0496119_0000568_10619_11383 244
14 3300048923 Ga0496120_0004564 Ga0496120_0004564_7705_8469 244
15 iso_pu_bacteria 2547132111 2547406548 246
16 iso_pu_bacteria 2554235005 2554259531 246
17 iso_pu_bacteria 2643221587 2643946538 246
18 iso_pu_bacteria 2643221677 2644434342 246
19 iso_pu_bacteria 2784132148 2784586761 246
20 iso_pu_bacteria 2784746763 2785345724 246
21 iso_pu_bacteria 2784746768 2785367167 246
22 iso_pu_bacteria 2802429296 2804843747 246
23 iso_pu_bacteria 2808606375 2808918408 246
24 iso_pu_bacteria 2808606448 2809230328 246
25 iso_pu_bacteria 2811994879 2812360302 246
26 iso_pu_bacteria 2818991463 2819696381 246
27 iso_pu_bacteria 2852635781 2852637726 246
28 iso_pu_bacteria 2862281513 2862289646 246
29 iso_pu_bacteria 2862382967 2862390320 246
30 iso_pu_bacteria 2862507626 2862510429 246
31 iso_pu_bacteria 2863404153 2863406960 246
32 iso_pu_bacteria 2875391855 2875392705 246
33 iso_pu_bacteria 2877676314 2877683379 246
34 iso_pu_bacteria 2912723979 2912726094 246
35 iso_pu_bacteria 2918501144 2918502533 246
36 iso_pu_bacteria 2919468124 2919472183 246
37 iso_pu_bacteria 2946064051 2946065587 246
38 iso_pu_bacteria 3006393351 3006395373 246
39 iso_pu_bacteria 8008485437 8008486552 246
40 iso_pu_bacteria 8008558824 8008561323 246
41 iso_pu_bacteria 8023623736 8023625039 246
42 iso_pu_bacteria 8025413630 8025414799 246
43 iso_pu_bacteria 8025524527 8025525621 246
44 iso_pu_bacteria 8033684223 8033690492 246
45 iso_pu_bacteria 8048406513 8048408178 246
46 iso_pu_bacteria 8056447290 8056447972 246
47 iso_pu_bacteria 8056667051 8056668577 246
48 iso_pu_bacteria 2643221575 2643885526 247
49 iso_pu_bacteria 2643221549 2643767848 248
50 iso_pu_bacteria 2643221619 2644111228 248
51 iso_pu_bacteria 2643221649 2644280589 248
52 iso_pu_bacteria 2808606372 2808901929 248
53 iso_pu_bacteria 2852643534 2852645524 248
54 iso_pu_bacteria 2857733635 2857735732 248
55 iso_pu_bacteria 2939657138 2939658050 248
56 iso_pu_bacteria 2964326757 2964329797 248
57 iso_pu_bacteria 8057345674 8057348788 248
58 3300037312 Ga0395899_0022706 Ga0395899_0022706_57_806 249
59 3300048914 Ga0496111_0407259 Ga0496111_0407259_56_805 249
60 3300059492 Ga0587073_0031537 Ga0587073_0031537_32_781 249
61 iso_pu_bacteria 2643221616 2644096216 249
62 iso_pu_bacteria 2721755702 2723641956 249
63 iso_pu_bacteria 2857737099 2857737898 249
64 iso_pu_bacteria 2862993130 2862996365 249
65 iso_pu_bacteria 2870622029 2870623612 249
66 iso_pu_bacteria 2884763398 2884765591 249
67 iso_pu_bacteria 2895660088 2895661198 249
68 iso_pu_bacteria 2935409751 2935411307 249
69 iso_pu_bacteria 2939660829 2939661129 249
70 iso_pu_bacteria 2966921586 2966923276 249
71 iso_pu_bacteria 2966924647 2966924901 249
72 3300002067 JGI24735J21928_10032285 JGI24735J21928_100322853 250
73 3300002075 JGI24738J21930_10023097 JGI24738J21930_100230972 250
74 3300006048 Ga0075363_100060029 Ga0075363_1000600292 250
75 3300006948 Ga0099826_10128050 Ga0099826_101280502 250
76 3300009177 Ga0105248_11026507 Ga0105248_110265072 250
77 3300013105 Ga0157369_10216026 Ga0157369_102160263 250
78 3300014968 Ga0157379_10058477 Ga0157379_100584772 250
79 3300015262 Ga0182007_10000233 Ga0182007_100002333 250
80 3300015265 Ga0182005_1022071 Ga0182005_10220712 250
81 3300015688 Ga0183367_1010 Ga0183367_1010363 250
82 3300022467 Ga0224712_10009142 Ga0224712_100091422 250
83 3300025924 Ga0207694_10245795 Ga0207694_102457952 250
84 3300025941 Ga0207711_10040642 Ga0207711_100406421 250
85 3300027666 Ga0209282_1210266 Ga0209282_12102661 250
86 3300027866 Ga0209813_10019930 Ga0209813_100199302 250
87 3300028794 Ga0307515_10172891 Ga0307515_101728913 250
88 3300031456 Ga0307513_10149592 Ga0307513_101495922 250
89 3300031649 Ga0307514_10108083 Ga0307514_101080832 250
90 3300031824 Ga0307413_10616033 Ga0307413_106160331 250
91 3300037466 Ga0395898_0055380 Ga0395898_0055380_322_1074 250
92 3300042002 Ga0439442_011733 Ga0439442_011733_945_1697 250
93 3300042007 Ga0439449_0007770 Ga0439449_0007770_1021_1773 250
94 3300042012 Ga0439455_0020249 Ga0439455_0020249_793_1545 250
95 3300042131 Ga0450894_000841 Ga0450894_000841_4023_4775 250
96 3300042135 Ga0450899_001503 Ga0450899_001503_59_811 250
97 3300042138 Ga0450903_002143 Ga0450903_002143_2483_3235 250
98 3300042145 Ga0450906_010158 Ga0450906_010158_605_1357 250
99 3300042157 Ga0439458_0002813 Ga0439458_0002813_2476_3228 250
100 3300042184 Ga0450908_007324 Ga0450908_007324_33_785 250
101 3300044684 Ga0466966_0019134 Ga0466966_0019134_1941_2693 250
102 3300044693 Ga0466961_0000546 Ga0466961_0000546_21856_22608 250
103 3300044694 Ga0466963_0000076 Ga0466963_0000076_9041_9793 250
104 3300044719 Ga0466971_0001258 Ga0466971_0001258_7077_7829 250
105 3300044842 Ga0466957_0000061 Ga0466957_0000061_27121_27873 250
106 3300045049 Ga0466959_0000750 Ga0466959_0000750_16449_17201 250
107 3300045836 Ga0466958_0011536 Ga0466958_0011536_1306_2058 250
108 3300046454 Ga0495592_0018420 Ga0495592_0018420_1891_2643 250
109 3300046455 Ga0495603_0006710 Ga0495603_0006710_955_1707 250
110 3300046459 Ga0495629_0164643 Ga0495629_0164643_736_1488 250
111 3300046460 Ga0495638_0104805 Ga0495638_0104805_427_1179 250
112 3300046462 Ga0495651_0218107 Ga0495651_0218107_76_828 250
113 3300046474 Ga0495605_0008535 Ga0495605_0008535_3812_4564 250
114 3300046499 Ga0495594_0053202 Ga0495594_0053202_1378_2130 250
115 3300046501 Ga0495607_0059306 Ga0495607_0059306_633_1385 250
116 3300046511 Ga0495608_0098612 Ga0495608_0098612_141_893 250
117 3300046513 Ga0495616_0008444 Ga0495616_0008444_3145_3897 250
118 3300046514 Ga0495618_0138831 Ga0495618_0138831_364_1116 250
119 3300046518 Ga0495631_0021008 Ga0495631_0021008_230_982 250
120 3300046519 Ga0495632_0075985 Ga0495632_0075985_365_1117 250
121 3300046523 Ga0495644_0063590 Ga0495644_0063590_231_983 250
122 3300046524 Ga0495648_0062636 Ga0495648_0062636_1035_1787 250
123 3300046529 Ga0495652_0020616 Ga0495652_0020616_3990_4742 250
124 3300046529 Ga0495652_0040288 Ga0495652_0040288_2659_3411 250
125 3300046533 Ga0495640_0005847 Ga0495640_0005847_4820_5572 250
126 3300046533 Ga0495640_0065394 Ga0495640_0065394_248_1000 250
127 3300046557 Ga0495622_0019126 Ga0495622_0019126_101_853 250
128 3300046558 Ga0495633_0016015 Ga0495633_0016015_1547_2299 250
129 3300046559 Ga0495667_0145812 Ga0495667_0145812_196_948 250
130 3300046642 Ga0495634_0003650 Ga0495634_0003650_5685_6437 250
131 3300046642 Ga0495634_0226211 Ga0495634_0226211_253_1005 250
132 3300046648 Ga0495611_0015694 Ga0495611_0015694_603_1355 250
133 3300046675 Ga0495657_0038936 Ga0495657_0038936_701_1453 250
134 3300046675 Ga0495657_0059645 Ga0495657_0059645_332_1084 250
135 3300046690 Ga0495624_0073702 Ga0495624_0073702_1165_1917 250
136 3300046809 Ga0495600_0034996 Ga0495600_0034996_1899_2651 250
137 3300047317 Ga0495604_0045320 Ga0495604_0045320_2472_3224 250
138 3300047317 Ga0495604_0099836 Ga0495604_0099836_831_1583 250
139 3300047319 Ga0495674_0310631 Ga0495674_0310631_109_861 250
140 3300047321 Ga0495676_0037320 Ga0495676_0037320_2150_2902 250
141 3300047321 Ga0495676_0116791 Ga0495676_0116791_1052_1804 250
142 3300047321 Ga0495676_0124757 Ga0495676_0124757_12_764 250
143 3300047322 Ga0495680_0026336 Ga0495680_0026336_1000_1752 250
144 3300049460 Ga0495682_0012942 Ga0495682_0012942_1304_2056 250
145 3300049570 Ga0501033_0001204 Ga0501033_0001204_19653_20405 250
146 3300049570 Ga0501033_0147660 Ga0501033_0147660_879_1631 250
147 3300049571 Ga0501034_0034034 Ga0501034_0034034_3751_4503 250
148 3300049571 Ga0501034_0060935 Ga0501034_0060935_2010_2762 250
149 3300049571 Ga0501034_0197441 Ga0501034_0197441_184_936 250
150 3300049572 Ga0501036_0001444 Ga0501036_0001444_882_1634 250
151 3300049572 Ga0501036_0006910 Ga0501036_0006910_881_1633 250
152 3300049572 Ga0501036_0082330 Ga0501036_0082330_374_1126 250
153 3300049574 Ga0501038_0003780 Ga0501038_0003780_8276_9028 250
154 3300049575 Ga0501039_0033419 Ga0501039_0033419_914_1666 250
155 3300049575 Ga0501039_0141789 Ga0501039_0141789_518_1270 250
156 3300049578 Ga0501042_0068040 Ga0501042_0068040_1498_2250 250
157 3300049579 Ga0501043_0005470 Ga0501043_0005470_5878_6630 250
158 3300049579 Ga0501043_0150640 Ga0501043_0150640_997_1749 250
159 3300049580 Ga0501046_0142928 Ga0501046_0142928_104_856 250
160 3300049581 Ga0501047_0000734 Ga0501047_0000734_15428_16180 250
161 3300049582 Ga0501048_0063045 Ga0501048_0063045_1624_2376 250
162 3300049586 Ga0501070_0001065 Ga0501070_0001065_5505_6257 250
163 3300049586 Ga0501070_0661668 Ga0501070_0661668_60_812 250
164 3300049589 Ga0501073_0446754 Ga0501073_0446754_14_766 250
165 3300049822 Ga0501035_0006714 Ga0501035_0006714_7162_7914 250
166 3300049822 Ga0501035_0021463 Ga0501035_0021463_3636_4388 250
167 3300049823 Ga0501044_0003168 Ga0501044_0003168_16763_17515 250
168 3300049823 Ga0501044_0082562 Ga0501044_0082562_637_1389 250
169 3300049823 Ga0501044_0083878 Ga0501044_0083878_642_1394 250
170 3300049823 Ga0501044_0104671 Ga0501044_0104671_2068_2820 250
171 3300049823 Ga0501044_0308883 Ga0501044_0308883_192_944 250
172 3300049823 Ga0501044_0452627 Ga0501044_0452627_39_791 250
173 3300050490 nmdc:mga03n38_10543_c1 nmdc:mga03n38_10543_c1_1212_1964 250
174 3300050492 nmdc:mga0yw44_75137_c1 nmdc:mga0yw44_75137_c1_946_1698 250
175 3300050494 nmdc:mga06z11_5002_c1 nmdc:mga06z11_5002_c1_2314_3066 250
176 3300050495 nmdc:mga04h51_26460_c1 nmdc:mga04h51_26460_c1_595_1347 250
177 3300059492 Ga0587073_0082454 Ga0587073_0082454_39_791 250
178 3300059605 Ga0587106_034960 Ga0587106_034960_59_811 250
179 3300061719 Ga0466962_0001239 Ga0466962_0001239_1360_2112 250
180 iso_pu_bacteria 2643221632 2644183443 250
181 iso_pu_bacteria 2643221635 2644199225 250
182 iso_pu_bacteria 2751185788 2753302048 250
183 iso_pu_bacteria 2844841374 2844842624 250
184 iso_pu_bacteria 2844852863 2844855557 250
185 iso_pu_bacteria 2904430863 2904433712 250
186 iso_pu_bacteria 2904501621 2904503013 250
187 iso_pu_bacteria 2908674828 2908675810 250
188 iso_pu_bacteria 2909074476 2909074856 250
189 iso_pu_bacteria 2919039151 2919041251 250
190 iso_pu_bacteria 2919042368 2919045753 250
191 iso_pu_bacteria 2919055335 2919058308 250
192 iso_pu_bacteria 2919523602 2919524681 250
193 iso_pu_bacteria 2928104781 2928106849 250
194 iso_pu_bacteria 2928153084 2928156390 250
195 iso_pu_bacteria 2928500415 2928502351 250
196 iso_pu_bacteria 2984551494 2984554188 250
197 iso_pu_bacteria 8056037122 8056037450 250
198 3300046463 Ga0495653_0264365 Ga0495653_0264365_86_841 251
199 3300005327 Ga0070658_10121391 Ga0070658_101213913 252
200 3300006038 Ga0075365_10001642 Ga0075365_100016423 252
201 3300006048 Ga0075363_100002664 Ga0075363_1000026642 252
202 3300006178 Ga0075367_10004426 Ga0075367_100044264 252
203 3300013105 Ga0157369_10346434 Ga0157369_103464341 252
204 3300025935 Ga0207709_10107273 Ga0207709_101072733 252
205 3300031824 Ga0307413_10443030 Ga0307413_104430301 252
206 3300031901 Ga0307406_10247083 Ga0307406_102470832 252
207 3300031911 Ga0307412_10184562 Ga0307412_101845622 252
208 3300031911 Ga0307412_10579185 Ga0307412_105791852 252
209 3300031995 Ga0307409_100164866 Ga0307409_1001648662 252
210 3300032004 Ga0307414_10223648 Ga0307414_102236482 252
211 3300032005 Ga0307411_10080144 Ga0307411_100801441 252
212 3300032126 Ga0307415_100133437 Ga0307415_1001334372 252
213 3300037418 Ga0395900_0281133 Ga0395900_0281133_102_863 252
214 3300038443 Ga0395901_0356309 Ga0395901_0356309_326_1087 252
215 3300041413 Ga0439465_0070442 Ga0439465_0070442_49_807 252
216 3300041451 Ga0451791_1718467 Ga0451791_1718467_189_947 252
217 3300044719 Ga0466971_0179579 Ga0466971_0179579_168_929 252
218 3300046689 Ga0495613_0185652 Ga0495613_0185652_570_1328 252
219 3300047320 Ga0495672_0002870 Ga0495672_0002870_8341_9099 252
220 3300047472 Ga0495686_0052602 Ga0495686_0052602_142_900 252
221 3300047472 Ga0495686_0082714 Ga0495686_0082714_563_1321 252
222 3300047472 Ga0495686_0127998 Ga0495686_0127998_718_1476 252
223 3300048907 Ga0496104_0492305 Ga0496104_0492305_120_878 252
224 3300048908 Ga0496105_0036513 Ga0496105_0036513_3223_3981 252
225 3300048917 Ga0496114_0001292 Ga0496114_0001292_14299_15057 252
226 3300048917 Ga0496114_0125099 Ga0496114_0125099_800_1558 252
227 3300048917 Ga0496114_0236585 Ga0496114_0236585_67_825 252
228 3300048918 Ga0496115_0104089 Ga0496115_0104089_626_1384 252
229 3300048918 Ga0496115_0172505 Ga0496115_0172505_561_1319 252
230 3300048920 Ga0496117_0000128 Ga0496117_0000128_71937_72695 252
231 3300048920 Ga0496117_0001642 Ga0496117_0001642_28109_28867 252
232 3300048921 Ga0496118_0007657 Ga0496118_0007657_3525_4283 252
233 3300048922 Ga0496119_0002900 Ga0496119_0002900_8299_9057 252
234 3300048922 Ga0496119_0129498 Ga0496119_0129498_431_1189 252
235 3300048925 Ga0496122_0000240 Ga0496122_0000240_86679_87437 252
236 3300048925 Ga0496122_0003597 Ga0496122_0003597_5575_6333 252
237 3300048926 Ga0496123_0000076 Ga0496123_0000076_24129_24887 252
238 3300048926 Ga0496123_0167656 Ga0496123_0167656_97_855 252
239 3300048927 Ga0496124_0002643 Ga0496124_0002643_11096_11854 252
240 3300048928 Ga0496125_0092662 Ga0496125_0092662_1061_1819 252
241 3300048929 Ga0496126_0001967 Ga0496126_0001967_6152_6910 252
242 3300048929 Ga0496126_0100430 Ga0496126_0100430_1107_1865 252
243 3300049570 Ga0501033_0003199 Ga0501033_0003199_11153_11911 252
244 3300049570 Ga0501033_0038454 Ga0501033_0038454_2748_3506 252
245 3300049570 Ga0501033_0077646 Ga0501033_0077646_52_810 252
246 3300049571 Ga0501034_0011108 Ga0501034_0011108_4308_5066 252
247 3300049572 Ga0501036_0027920 Ga0501036_0027920_2878_3636 252
248 3300049573 Ga0501037_0137770 Ga0501037_0137770_31_789 252
249 3300049573 Ga0501037_0264429 Ga0501037_0264429_145_903 252
250 3300049578 Ga0501042_0009952 Ga0501042_0009952_2494_3252 252
251 3300049579 Ga0501043_0161066 Ga0501043_0161066_901_1659 252
252 3300049579 Ga0501043_0555246 Ga0501043_0555246_52_810 252
253 3300049580 Ga0501046_0011198 Ga0501046_0011198_5917_6675 252
254 3300049580 Ga0501046_0032770 Ga0501046_0032770_2602_3360 252
255 3300049581 Ga0501047_0024747 Ga0501047_0024747_4547_5305 252
256 3300049581 Ga0501047_0028523 Ga0501047_0028523_3999_4757 252
257 3300049581 Ga0501047_0078349 Ga0501047_0078349_821_1579 252
258 3300049581 Ga0501047_0277721 Ga0501047_0277721_714_1472 252
259 3300049582 Ga0501048_0004779 Ga0501048_0004779_5337_6095 252
260 3300049584 Ga0501068_0122696 Ga0501068_0122696_449_1207 252
261 3300049585 Ga0501069_0132368 Ga0501069_0132368_336_1094 252
262 3300049586 Ga0501070_0288401 Ga0501070_0288401_483_1241 252
263 3300049586 Ga0501070_0555674 Ga0501070_0555674_100_858 252
264 3300049590 Ga0501074_0059669 Ga0501074_0059669_335_1093 252
265 3300049742 Ga0501080_0305016 Ga0501080_0305016_364_1122 252
266 3300049822 Ga0501035_0003800 Ga0501035_0003800_10432_11190 252
267 3300049822 Ga0501035_0038301 Ga0501035_0038301_437_1195 252
268 3300049823 Ga0501044_0021922 Ga0501044_0021922_5198_5956 252
269 3300049823 Ga0501044_0022406 Ga0501044_0022406_1291_2049 252
270 3300053080 Ga0500635_0000012 Ga0500635_0000012_124830_125588 252
271 3300053104 Ga0500556_0000001 Ga0500556_0000001_327937_328695 252
272 3300053139 Ga0500568_0000006 Ga0500568_0000006_406159_406926 252
273 3300053142 Ga0500577_0054210 Ga0500577_0054210_235_993 252
274 3300053153 Ga0500616_0000021 Ga0500616_0000021_380672_381430 252
275 3300053153 Ga0500616_0009117 Ga0500616_0009117_4893_5651 252
276 3300054114 Ga0501084_0113874 Ga0501084_0113874_1245_2003 252
277 3300003214 JGI25165J46597_1000004 JGI25165J46597_1000004545 253
278 3300003752 Ga0055539_1000008 Ga0055539_1000008112 253
279 3300003756 Ga0055533_1000001 Ga0055533_1000001959 253
280 3300003759 Ga0055525_1000510 Ga0055525_100051013 253
281 3300003760 Ga0055527_1000001 Ga0055527_1000001427 253
282 3300003763 Ga0055529_1000018 Ga0055529_100001869 253
283 3300003841 Ga0055541_1002952 Ga0055541_10029522 253
284 3300005288 Ga0065714_10003729 Ga0065714_1000372915 253
285 3300005327 Ga0070658_10000365 Ga0070658_1000036523 253
286 3300005364 Ga0070673_100136647 Ga0070673_1001366473 253
287 3300005437 Ga0070710_10023830 Ga0070710_100238304 253
288 3300005459 Ga0068867_100201894 Ga0068867_1002018942 253
289 3300005539 Ga0068853_100125797 Ga0068853_1001257972 253
290 3300005543 Ga0070672_100256498 Ga0070672_1002564982 253
291 3300005563 Ga0068855_100003240 Ga0068855_1000032405 253
292 3300005563 Ga0068855_100026499 Ga0068855_1000264993 253
293 3300005563 Ga0068855_100092996 Ga0068855_1000929964 253
294 3300005563 Ga0068855_100189979 Ga0068855_1001899793 253
295 3300005578 Ga0068854_100042559 Ga0068854_1000425592 253
296 3300005841 Ga0068863_100171437 Ga0068863_1001714372 253
297 3300009093 Ga0105240_10036243 Ga0105240_100362436 253
298 3300009174 Ga0105241_10001977 Ga0105241_100019778 253
299 3300009551 Ga0105238_10308628 Ga0105238_103086282 253
300 3300010375 Ga0105239_10203430 Ga0105239_102034302 253
301 3300010375 Ga0105239_10621191 Ga0105239_106211912 253
302 3300013102 Ga0157371_10002974 Ga0157371_100029749 253
303 3300013104 Ga0157370_10002771 Ga0157370_100027715 253
304 3300013105 Ga0157369_10175932 Ga0157369_101759322 253
305 3300014326 Ga0157380_10147514 Ga0157380_101475142 253
306 3300025225 Ga0209566_100050 Ga0209566_10005029 253
307 3300025226 Ga0209674_100001 Ga0209674_100001959 253
308 3300025228 Ga0209672_100006 Ga0209672_100006549 253
309 3300025229 Ga0209147_100819 Ga0209147_1008199 253
310 3300025230 Ga0209563_100001 Ga0209563_100001959 253
311 3300025231 Ga0207427_100010 Ga0207427_10001037 253
312 3300025233 Ga0209437_100485 Ga0209437_10048517 253
313 3300025253 Ga0209677_100001 Ga0209677_100001959 253
314 3300025254 Ga0209148_1000015 Ga0209148_1000015393 253
315 3300025254 Ga0209148_1001848 Ga0209148_100184811 253
316 3300025261 Ga0209233_1000001 Ga0209233_10000011913 253
317 3300025272 Ga0209455_1000013 Ga0209455_1000013393 253
318 3300025901 Ga0207688_10076652 Ga0207688_100766523 253
319 3300025904 Ga0207647_10056431 Ga0207647_100564313 253
320 3300025904 Ga0207647_10248815 Ga0207647_102488152 253
321 3300025907 Ga0207645_10247884 Ga0207645_102478842 253
322 3300025909 Ga0207705_10000006 Ga0207705_10000006335 253
323 3300025911 Ga0207654_10000003 Ga0207654_1000000318 253
324 3300025913 Ga0207695_10043644 Ga0207695_100436442 253
325 3300025913 Ga0207695_10090226 Ga0207695_100902265 253
326 3300025919 Ga0207657_10072276 Ga0207657_100722763 253
327 3300025919 Ga0207657_10352828 Ga0207657_103528282 253
328 3300025926 Ga0207659_10659474 Ga0207659_106594742 253
329 3300025927 Ga0207687_10221335 Ga0207687_102213352 253
330 3300025938 Ga0207704_10364029 Ga0207704_103640292 253
331 3300025940 Ga0207691_10135478 Ga0207691_101354782 253
332 3300025941 Ga0207711_10006970 Ga0207711_100069704 253
333 3300025942 Ga0207689_10395566 Ga0207689_103955662 253
334 3300025949 Ga0207667_10002554 Ga0207667_100025543 253
335 3300025949 Ga0207667_10004184 Ga0207667_100041849 253
336 3300025949 Ga0207667_10201716 Ga0207667_102017163 253
337 3300025972 Ga0207668_10143454 Ga0207668_101434542 253
338 3300026041 Ga0207639_10098672 Ga0207639_100986722 253
339 3300026067 Ga0207678_10107392 Ga0207678_101073923 253
340 3300026078 Ga0207702_10040926 Ga0207702_100409264 253
341 3300026089 Ga0207648_10147856 Ga0207648_101478563 253
342 3300026121 Ga0207683_10007808 Ga0207683_100078083 253
343 3300028380 Ga0268265_10269263 Ga0268265_102692632 253
344 3300031649 Ga0307514_10005180 Ga0307514_1000518012 253
345 3300031649 Ga0307514_10049057 Ga0307514_100490573 253
346 3300031838 Ga0307518_10126068 Ga0307518_101260681 253
347 3300037418 Ga0395900_0004762 Ga0395900_0004762_5634_6395 253
348 3300037466 Ga0395898_0001540 Ga0395898_0001540_23371_24132 253
349 3300044735 Ga0466968_0095460 Ga0466968_0095460_527_1288 253
350 3300044765 Ga0466970_0029514 Ga0466970_0029514_1056_1817 253
351 3300044765 Ga0466970_0078107 Ga0466970_0078107_44_805 253
352 3300044901 Ga0466960_0029390 Ga0466960_0029390_823_1587 253
353 3300045049 Ga0466959_0005031 Ga0466959_0005031_5333_6094 253
354 3300046457 Ga0495590_0000112 Ga0495590_0000112_35251_36012 253
355 3300046461 Ga0495641_0036959 Ga0495641_0036959_889_1650 253
356 3300046471 Ga0495650_0001784 Ga0495650_0001784_14214_14975 253
357 3300047320 Ga0495672_0065281 Ga0495672_0065281_485_1246 253
358 3300048903 Ga0496100_0083115 Ga0496100_0083115_737_1510 253
359 3300048904 Ga0496101_0012309 Ga0496101_0012309_454_1215 253
360 3300048905 Ga0496102_0000072 Ga0496102_0000072_36174_36947 253
361 3300048906 Ga0496103_0000158 Ga0496103_0000158_43508_44281 253
362 3300048908 Ga0496105_0028599 Ga0496105_0028599_2489_3250 253
363 3300048911 Ga0496108_0165640 Ga0496108_0165640_435_1196 253
364 3300048912 Ga0496109_0188089 Ga0496109_0188089_17_778 253
365 3300048917 Ga0496114_0037775 Ga0496114_0037775_3187_3948 253
366 3300048920 Ga0496117_0189665 Ga0496117_0189665_75_848 253
367 3300048921 Ga0496118_0013193 Ga0496118_0013193_5237_6010 253
368 3300048922 Ga0496119_0031500 Ga0496119_0031500_2596_3369 253
369 3300048924 Ga0496121_0163010 Ga0496121_0163010_395_1156 253
370 3300048929 Ga0496126_0147583 Ga0496126_0147583_811_1572 253
371 3300049570 Ga0501033_0011615 Ga0501033_0011615_4769_5530 253
372 3300049578 Ga0501042_0000959 Ga0501042_0000959_4796_5557 253
373 3300049586 Ga0501070_0000593 Ga0501070_0000593_12953_13714 253
374 3300049744 Ga0501083_0000003 Ga0501083_0000003_152037_152798 253
375 3300049823 Ga0501044_0175214 Ga0501044_0175214_1343_2104 253
376 3300050492 nmdc:mga0yw44_204998_c1 nmdc:mga0yw44_204998_c1_258_1019 253
377 3300053136 Ga0500559_0000194 Ga0500559_0000194_37919_38680 253
378 3300053139 Ga0500568_0000534 Ga0500568_0000534_1458_2219 253
379 3300053140 Ga0500573_0000013 Ga0500573_0000013_182445_183206 253
380 3300053140 Ga0500573_0000998 Ga0500573_0000998_4368_5129 253
381 3300053140 Ga0500573_0046563 Ga0500573_0046563_264_1025 253
382 3300053140 Ga0500573_0081148 Ga0500573_0081148_209_970 253
383 3300053140 Ga0500573_0147366 Ga0500573_0147366_94_855 253
384 3300053730 Ga0500645_004016 Ga0500645_004016_704_1465 253
385 iso_pu_bacteria 2643221572 2643875071 253
386 iso_pu_bacteria 2643221669 2644382127 253
387 3300001989 JGI24739J22299_10034139 JGI24739J22299_100341392 254
388 3300001990 JGI24737J22298_10036863 JGI24737J22298_100368632 254
389 3300002067 JGI24735J21928_10001646 JGI24735J21928_100016464 254
390 3300003578 Ga0006562J51391_1011017 Ga0006562J51391_10110175 254
391 3300003578 Ga0006562J51391_1011018 Ga0006562J51391_10110184 254
392 3300005339 Ga0070660_100285270 Ga0070660_1002852702 254
393 3300005344 Ga0070661_100050555 Ga0070661_1000505554 254
394 3300005355 Ga0070671_100114348 Ga0070671_1001143483 254
395 3300005366 Ga0070659_100010846 Ga0070659_1000108467 254
396 3300005543 Ga0070672_100020326 Ga0070672_1000203266 254
397 3300005577 Ga0068857_100005133 Ga0068857_1000051331 254
398 3300005614 Ga0068856_100076146 Ga0068856_1000761464 254
399 3300005616 Ga0068852_100005104 Ga0068852_1000051044 254
400 3300005616 Ga0068852_100011239 Ga0068852_1000112395 254
401 3300005616 Ga0068852_100121266 Ga0068852_1001212663 254
402 3300005834 Ga0068851_10000003 Ga0068851_10000003218 254
403 3300005842 Ga0068858_100000293 Ga0068858_10000029327 254
404 3300009093 Ga0105240_10244321 Ga0105240_102443213 254
405 3300009101 Ga0105247_10039785 Ga0105247_100397852 254
406 3300009545 Ga0105237_10080050 Ga0105237_100800503 254
407 3300010375 Ga0105239_10156168 Ga0105239_101561682 254
408 3300013105 Ga0157369_10005995 Ga0157369_100059958 254
409 3300013306 Ga0163162_10788858 Ga0163162_107888581 254
410 3300013308 Ga0157375_11022262 Ga0157375_110222622 254
411 3300014325 Ga0163163_10040277 Ga0163163_100402775 254
412 3300020080 Ga0206350_10987396 Ga0206350_109873961 254
413 3300020081 Ga0206354_10259657 Ga0206354_102596576 254
414 3300025253 Ga0209677_100187 Ga0209677_10018725 254
415 3300025321 Ga0207656_10000002 Ga0207656_1000000219 254
416 3300025914 Ga0207671_10000002 Ga0207671_10000002313 254
417 3300025919 Ga0207657_10016590 Ga0207657_100165907 254
418 3300025924 Ga0207694_10000138 Ga0207694_1000013853 254
419 3300025931 Ga0207644_10102514 Ga0207644_101025143 254
420 3300025932 Ga0207690_10012271 Ga0207690_100122713 254
421 3300025940 Ga0207691_10101732 Ga0207691_101017323 254
422 3300025949 Ga0207667_10423680 Ga0207667_104236802 254
423 3300026035 Ga0207703_10000305 Ga0207703_1000030527 254
424 3300026116 Ga0207674_10018661 Ga0207674_100186618 254
425 3300026142 Ga0207698_10000343 Ga0207698_1000034316 254
426 3300026142 Ga0207698_10009152 Ga0207698_100091525 254
427 3300037312 Ga0395899_0002537 Ga0395899_0002537_758_1522 254
428 3300037418 Ga0395900_0439519 Ga0395900_0439519_201_965 254
429 3300044658 Ga0466972_0077472 Ga0466972_0077472_269_1033 254
430 3300044683 Ga0466965_0002637 Ga0466965_0002637_2076_2840 254
431 3300044684 Ga0466966_0139297 Ga0466966_0139297_373_1137 254
432 3300044693 Ga0466961_0016154 Ga0466961_0016154_1520_2284 254
433 3300044719 Ga0466971_0031466 Ga0466971_0031466_380_1144 254
434 3300044735 Ga0466968_0030855 Ga0466968_0030855_358_1122 254
435 3300044765 Ga0466970_0013449 Ga0466970_0013449_3246_4010 254
436 3300044765 Ga0466970_0028572 Ga0466970_0028572_558_1322 254
437 3300044765 Ga0466970_0235682 Ga0466970_0235682_199_963 254
438 3300044765 Ga0466970_0259026 Ga0466970_0259026_103_867 254
439 3300044842 Ga0466957_0017944 Ga0466957_0017944_2373_3137 254
440 3300044901 Ga0466960_0008996 Ga0466960_0008996_3189_3953 254
441 3300044901 Ga0466960_0054847 Ga0466960_0054847_237_1001 254
442 3300045049 Ga0466959_0216100 Ga0466959_0216100_93_857 254
443 3300045836 Ga0466958_0042819 Ga0466958_0042819_1583_2347 254
444 3300046459 Ga0495629_0297332 Ga0495629_0297332_10_774 254
445 3300046461 Ga0495641_0141711 Ga0495641_0141711_147_911 254
446 3300046463 Ga0495653_0172028 Ga0495653_0172028_226_990 254
447 3300046559 Ga0495667_0242539 Ga0495667_0242539_312_1076 254
448 3300047319 Ga0495674_0388019 Ga0495674_0388019_112_876 254
449 3300047322 Ga0495680_0147140 Ga0495680_0147140_889_1653 254
450 3300047472 Ga0495686_0113225 Ga0495686_0113225_846_1610 254
451 3300048905 Ga0496102_0135415 Ga0496102_0135415_1440_2204 254
452 3300048911 Ga0496108_0180242 Ga0496108_0180242_885_1649 254
453 3300048920 Ga0496117_0003865 Ga0496117_0003865_5624_6388 254
454 3300048920 Ga0496117_0018551 Ga0496117_0018551_1162_1926 254
455 3300048921 Ga0496118_0000605 Ga0496118_0000605_34255_35019 254
456 3300048921 Ga0496118_0006139 Ga0496118_0006139_10222_10986 254
457 3300048922 Ga0496119_0002374 Ga0496119_0002374_13531_14295 254
458 3300048922 Ga0496119_0007201 Ga0496119_0007201_4487_5251 254
459 3300048926 Ga0496123_0008911 Ga0496123_0008911_7036_7800 254
460 3300048927 Ga0496124_0000363 Ga0496124_0000363_57540_58304 254
461 3300048927 Ga0496124_0040764 Ga0496124_0040764_540_1304 254
462 3300049568 Ga0501031_0004287 Ga0501031_0004287_2520_3284 254
463 3300049570 Ga0501033_0049682 Ga0501033_0049682_2109_2873 254
464 3300049571 Ga0501034_0007050 Ga0501034_0007050_2391_3155 254
465 3300049571 Ga0501034_0026035 Ga0501034_0026035_5157_5921 254
466 3300049573 Ga0501037_0006659 Ga0501037_0006659_7629_8393 254
467 3300049574 Ga0501038_0031295 Ga0501038_0031295_1830_2594 254
468 3300049575 Ga0501039_0017847 Ga0501039_0017847_2294_3058 254
469 3300049579 Ga0501043_0017470 Ga0501043_0017470_1054_1818 254
470 3300049580 Ga0501046_0001960 Ga0501046_0001960_16462_17226 254
471 3300049582 Ga0501048_0004101 Ga0501048_0004101_8135_8899 254
472 3300049584 Ga0501068_0231670 Ga0501068_0231670_195_959 254
473 3300049585 Ga0501069_0005906 Ga0501069_0005906_1030_1794 254
474 3300049586 Ga0501070_0000871 Ga0501070_0000871_11047_11811 254
475 3300049586 Ga0501070_0045284 Ga0501070_0045284_2701_3465 254
476 3300049587 Ga0501071_0000398 Ga0501071_0000398_11312_12076 254
477 3300049589 Ga0501073_0032050 Ga0501073_0032050_2136_2900 254
478 3300049589 Ga0501073_0224644 Ga0501073_0224644_63_827 254
479 3300049742 Ga0501080_0102908 Ga0501080_0102908_1091_1855 254
480 3300049744 Ga0501083_0131647 Ga0501083_0131647_694_1458 254
481 3300049822 Ga0501035_0091221 Ga0501035_0091221_1722_2486 254
482 3300049823 Ga0501044_0014228 Ga0501044_0014228_7266_8030 254
483 3300049824 Ga0501045_0025140 Ga0501045_0025140_1686_2450 254
484 3300053084 Ga0495595_0099872 Ga0495595_0099872_39_803 254
485 3300053136 Ga0500559_0092647 Ga0500559_0092647_167_1045 254
486 3300053136 Ga0500559_0109405 Ga0500559_0109405_296_1060 254
487 3300053140 Ga0500573_0027716 Ga0500573_0027716_16_783 254
488 3300053146 Ga0500588_0022863 Ga0500588_0022863_264_1058 254
489 3300060353 Ga0501082_0063276 Ga0501082_0063276_1053_1817 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

9

80

0.98

PF01709

Transcrip_reg

TACO1/YebC second and third domain

87

242

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.8832 25 240
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.8646 25 240
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8349 5 245
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8222 5 245
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8101 3 249
ID Description Score Start End Superfamily
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9804 27 74 1.10.10.200
af_Q6F2Z2_64_139_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.924 8 74 1.10.10.200
1mw7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.923 84 240 3.30.70.980
af_I1K9D8_53_128_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9207 5 74 1.10.10.200
1mw7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9131 84 240 3.30.70.980
ID Description Score Start End GO Terms
AF-A0A7S0BUC7-F1-model_v4 TACO1/YebC-like second and third domain-containing protein 0.956 104 240
AF-A0A6I2X7Y1-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9536 86 249 GO:0003677
GO:0005829
AF-A0A849FSB2-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9493 149 249 GO:0003677
GO:0005829
AF-A0A4Q3WIT4-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9482 15 249 GO:0003677
GO:0005829
AF-A0A6I2X7Y1-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.948 86 249 GO:0003677
GO:0005829

Feature Viewer

pLDDT pTM Quality
87.7 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map