F453775

General Info

Members Datasets Scaffolds Average Seq Length
489 380 352 242

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10261128|Ga0105239_102611282
Length 268
Sequence MPRVLKTARICNGLSQGTACVYLDPFVMASDQLRREHVLVVDDDPRIRQMLTRYFEGEGYAVTAASGGAEMRARLRQENFDIILLDLVLPGGEDGLDLAREIRTQSDIPIMMLTGRDDVVDRIVGIEVGADDYIAKPFHLREVHARLKAILRRRQPITKGPDNSLGEIIRFEGWQLNIGKRQLLTADGDEIELTTGEFDMLVVFVRHAGRVLGRELLMDLTRGRNLEAFDRTIDAQIARLRKKIETDPRRPQLIKSIRGVGYVFTGKV

Samples

Sample ID Description Type Environment
1 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
2 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
3 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
4 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
5 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
6 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
7 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
8 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
9 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
10 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
11 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
12 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
13 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
14 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
15 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
16 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
17 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
18 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
19 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
20 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
21 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
22 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
23 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
24 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
25 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
26 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
27 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
28 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
29 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
30 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
31 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
32 2643221607 Rhizobium sp. Root73 Isolate Unclassified
33 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
34 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
35 2643221733 Bosea sp. Root381 Isolate Unclassified
36 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
37 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
38 2718217882 Rhizobium sp. N741 Isolate Nodule
39 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
40 2718218009 Rhizobium sp. N561 Isolate Nodule
41 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
42 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
43 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
44 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
45 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
46 2718218363 Rhizobium sp. N113 Isolate Nodule
47 2718218365 Rhizobium sp. N731 Isolate Nodule
48 2718218366 Rhizobium sp. N621 Isolate Nodule
49 2721755514 Rhizobium sp. N6212 Isolate Nodule
50 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
51 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
52 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
53 2721755810 Rhizobium sp. N871 Isolate Nodule
54 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
55 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
56 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
57 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
58 2728369365 Rhizobium sp. N1341 Isolate Nodule
59 2728369397 Rhizobium sp. N1314 Isolate Nodule
60 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
61 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
62 2791355256 Rhizobium sp. M10 Isolate Nodule
63 2791355260 Rhizobium sp. L9 Isolate Nodule
64 2791355261 Rhizobium sp. J15 Isolate Nodule
65 2791355263 Rhizobium chutanense C5 Isolate Nodule
66 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
67 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
68 2802429633 Rhizobium anhuiense J3 Isolate Nodule
69 2802429634 Rhizobium anhuiense S10 Isolate Nodule
70 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
71 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
72 2802429637 Rhizobium anhuiense C15 Isolate Nodule
73 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
74 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
75 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
76 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
77 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
78 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
79 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
80 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
81 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
82 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
83 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
84 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
85 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
86 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
87 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
88 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
89 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
90 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
91 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
92 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
93 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
94 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
95 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
96 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
97 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
98 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
99 2936381700 Rhizobium chutanense C16 Isolate Unclassified
100 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
101 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
102 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
103 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
104 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
105 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
106 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
107 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
108 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
109 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
110 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
111 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
112 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
113 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
114 2996893221 Rhizobium sp. R635 Isolate Nodule
115 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
116 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
117 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
118 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
119 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
120 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
121 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
122 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
123 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
124 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
125 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
126 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
127 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
128 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
129 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
130 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
131 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
132 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
133 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
134 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
135 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
136 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
137 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
138 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
139 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
140 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
141 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
142 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
143 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
144 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
145 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
146 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
147 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
148 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
149 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
150 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
151 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
152 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
153 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
154 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
155 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
156 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
157 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
158 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
159 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
160 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
161 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
162 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
163 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
164 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
165 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
166 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
167 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
168 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
169 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
170 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
171 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
172 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
173 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
174 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
175 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
178 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
179 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
180 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
181 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
182 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
183 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
184 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
185 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
186 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
188 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
189 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
190 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
194 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
196 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
199 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
212 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
213 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
216 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
217 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
221 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
228 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
229 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
230 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
231 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
232 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
233 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
234 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
235 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
236 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
237 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
238 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
239 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
240 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
241 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
242 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
243 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
244 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
245 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
246 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
247 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
248 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
249 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
252 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
253 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
254 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
257 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
258 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
261 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
262 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
263 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
266 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
267 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
270 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
271 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
272 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
273 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
276 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
279 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
280 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
281 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
286 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
287 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
288 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
289 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
292 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
293 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
294 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
295 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
296 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
302 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
303 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
304 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
305 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
306 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
307 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
308 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
309 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
310 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
320 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
321 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
322 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
323 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
326 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
327 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
328 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
329 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
330 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
331 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
332 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
333 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
334 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
335 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
336 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
337 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
338 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
339 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
340 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
341 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
342 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
343 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
344 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
345 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
346 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
347 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
348 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
349 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
350 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
351 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
352 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
353 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
354 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
355 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
356 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
357 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
358 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
359 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
360 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
361 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
362 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
363 8005258706 Rhizobium sp. R693 Isolate Nodule
364 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
365 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
366 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
367 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
368 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
369 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
370 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
371 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
372 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
373 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
374 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
375 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
376 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
377 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
378 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
379 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
380 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.98
Metatranscriptomes 0
Isolates 28.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.34
Nodule 20.25
Rhizoplane 1.23
Rhizosphere 36.2
Stem 0
Stem Tuber 0
Unclassified 18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000059 3300001979 Bacteria 35309
2 JGI25155J39150_1000026 3300002704 Bacteria 127779
3 JGI25156J39149_1000028 3300002705 Bacteria 127325
4 JGI25162J39368_1000238 3300002737 Bacteria 54861
5 JGI25162J39368_1000452 3300002737 Bacteria 32183
6 JGI25154J39366_1000046 3300002738 Bacteria 127252
7 JGI25157J39369_1000358 3300002741 Bacteria 31869
8 JGI25159J45721_1000056 3300002987 Bacteria 54880
9 JGI25151J46595_10001124 3300003187 Bacteria 19519
10 JGI25165J46597_1000116 3300003214 Bacteria 137942
11 JGI25165J46597_1000722 3300003214 Bacteria 25879
12 JGI25165J46597_1004082 3300003214 Bacteria 3278
13 JGI25153J46596_10004984 3300003215 Bacteria 7048
14 JGI25153J46596_10050541 3300003215 Bacteria 1197
15 rootH2_10105471 3300003320 Bacteria 2617
16 rootL2_10008082 3300003322 Bacteria 60006
17 rootL2_10185335 3300003322 Bacteria 2442
18 rootH1_10269008 3300003323 Bacteria 4338
19 JGI25160J50197_1000026 3300003354 Bacteria 184693
20 JGI25160J50197_1002772 3300003354 Bacteria 8027
21 JGI25161J50226_1000014 3300003374 Bacteria 191109
22 JGI25161J50226_1001565 3300003374 Bacteria 6702
23 Ga0055526_1000795 3300003771 Bacteria 23489
24 Ga0055526_1002999 3300003771 Bacteria 11031
25 Ga0055524_1001465 3300003775 Bacteria 13480
26 Ga0055536_1006281 3300003781 Bacteria 5593
27 Ga0055528_1000746 3300003790 Bacteria 22697
28 Ga0055528_1001731 3300003790 Bacteria 12619
29 Ga0055540_1002077 3300003792 Bacteria 11021
30 Ga0055540_1006183 3300003792 Bacteria 4815
31 Ga0055531_10004284 3300003794 Bacteria 8760
32 Ga0055543_1000052 3300004625 Bacteria 104887
33 Ga0055543_1000765 3300004625 Bacteria 16071
34 Ga0065165_1000073 3300005262 Bacteria 164910
35 Ga0065165_1013874 3300005262 Bacteria 3167
36 Ga0070658_10189682 3300005327 Bacteria 1732
37 Ga0070660_100009283 3300005339 Bacteria 6913
38 Ga0070692_10003220 3300005345 Bacteria 6569
39 Ga0070659_100003145 3300005366 Bacteria 11757
40 Ga0070659_100209157 3300005366 Bacteria 1608
41 Ga0070663_100016761 3300005455 Bacteria 4768
42 Ga0070679_100118919 3300005530 Bacteria 2627
43 Ga0068855_100036701 3300005563 Bacteria 5831
44 Ga0068855_100040565 3300005563 Bacteria 5525
45 Ga0068856_100020042 3300005614 Bacteria 6493
46 Ga0068852_100196129 3300005616 Bacteria 1908
47 Ga0075365_10002649 3300006038 Bacteria 8884
48 Ga0075365_10003501 3300006038 Bacteria 8111
49 Ga0075365_10010935 3300006038 Bacteria 5315
50 Ga0075368_10009381 3300006042 Bacteria 3520
51 Ga0075368_10098617 3300006042 Bacteria 1198
52 Ga0075363_100003241 3300006048 Bacteria 6883
53 Ga0075364_10004374 3300006051 Bacteria 8115
54 Ga0075362_10001375 3300006177 Bacteria 7716
55 Ga0075362_10109782 3300006177 Bacteria 1297
56 Ga0075367_10012924 3300006178 Bacteria 4473
57 Ga0075369_10002720 3300006186 Bacteria 6341
58 Ga0075366_10002825 3300006195 Bacteria 8991
59 Ga0075370_10001260 3300006353 Bacteria 10787
60 Ga0075370_10002787 3300006353 Bacteria 8192
61 Ga0075370_10014054 3300006353 Bacteria 4263
62 Ga0075433_10029023 3300006852 Bacteria 4709
63 Ga0075434_100692137 3300006871 Bacteria 1037
64 Ga0079104_1000101 3300006946 Bacteria 125456
65 Ga0079104_1025918 3300006946 Bacteria 1522
66 Ga0099826_10010074 3300006948 Bacteria 7073
67 Ga0105244_10102329 3300009036 Bacteria 1400
68 Ga0105240_10002575 3300009093 Bacteria 29071
69 Ga0105240_10062827 3300009093 Bacteria 4622
70 Ga0111539_10484160 3300009094 Bacteria 1441
71 Ga0105247_10127032 3300009101 Bacteria 1658
72 Ga0105243_10051220 3300009148 Bacteria 3265
73 Ga0105248_10309236 3300009177 Bacteria 1780
74 Ga0105237_10021145 3300009545 Bacteria 6693
75 Ga0105238_10144842 3300009551 Bacteria 2352
76 Ga0105239_10261128 3300010375 Bacteria 1946
77 Ga0105239_10735007 3300010375 Bacteria 1129
78 Ga0157370_10001604 3300013104 Bacteria 27946
79 Ga0157369_10478901 3300013105 Bacteria 1288
80 Ga0157369_10588614 3300013105 Bacteria 1149
81 Ga0163162_10878417 3300013306 Bacteria 1011
82 Ga0182007_10017063 3300015262 Bacteria 2662
83 Ga0182005_1004457 3300015265 Bacteria 4527
84 Ga0163161_10083450 3300017792 Bacteria 2355
85 Ga0163161_10298984 3300017792 Bacteria 1267
86 Ga0213872_10007397 3300021361 Bacteria 5408
87 Ga0213872_10016359 3300021361 Bacteria 3442
88 Ga0213872_10029293 3300021361 Bacteria 2524
89 Ga0213872_10063797 3300021361 Bacteria 1664
90 Ga0228711_1010171 3300022739 Bacteria 12473
91 Ga0228710_1004457 3300022740 Bacteria 22108
92 Ga0228598_1014371 3300024227 Bacteria 1566
93 Ga0209435_100017 3300025206 Bacteria 303699
94 Ga0209437_100128 3300025233 Bacteria 190300
95 Ga0209437_100283 3300025233 Bacteria 74859
96 Ga0207425_1002847 3300025245 Bacteria 5817
97 Ga0209646_1000048 3300025246 Bacteria 303808
98 Ga0209646_1004088 3300025246 Bacteria 2718
99 Ga0209026_1000035 3300025250 Bacteria 303808
100 Ga0209677_101249 3300025253 Bacteria 11475
101 Ga0209759_1000027 3300025256 Bacteria 303808
102 Ga0209129_1000272 3300025258 Bacteria 50370
103 Ga0209233_1000072 3300025261 Bacteria 363074
104 Ga0209233_1000268 3300025261 Bacteria 74859
105 Ga0209233_1000727 3300025261 Bacteria 15234
106 Ga0209673_1000255 3300025273 Bacteria 100723
107 Ga0209673_1000733 3300025273 Bacteria 45496
108 Ga0209673_1001353 3300025273 Bacteria 24419
109 Ga0209130_1000121 3300025284 Bacteria 127462
110 Ga0209130_1014322 3300025284 Bacteria 1995
111 Ga0209676_1004782 3300025292 Bacteria 7374
112 Ga0209025_1000735 3300025294 Bacteria 55469
113 Ga0209025_1005649 3300025294 Bacteria 10078
114 Ga0209564_1000215 3300025295 Bacteria 132838
115 Ga0209564_1000695 3300025295 Bacteria 49249
116 Ga0209758_1000291 3300025297 Bacteria 98850
117 Ga0209758_1000687 3300025297 Bacteria 50244
118 Ga0209758_1019111 3300025297 Bacteria 3324
119 Ga0209758_1021839 3300025297 Bacteria 2964
120 Ga0209050_1008090 3300025298 Bacteria 5708
121 Ga0209256_1000155 3300025299 Bacteria 144379
122 Ga0209256_1003723 3300025299 Bacteria 10326
123 Ga0209256_1005635 3300025299 Bacteria 7069
124 Ga0207426_1000075 3300025302 Bacteria 321337
125 Ga0207426_1000569 3300025302 Bacteria 49930
126 Ga0209051_1000708 3300025303 Bacteria 36541
127 Ga0209051_1000958 3300025303 Bacteria 28336
128 Ga0209257_1002285 3300025304 Bacteria 19498
129 Ga0207705_10009721 3300025909 Bacteria 6995
130 Ga0207695_10002230 3300025913 Bacteria 29083
131 Ga0207695_10002873 3300025913 Bacteria 24991
132 Ga0207671_10000448 3300025914 Bacteria 56985
133 Ga0207657_10000691 3300025919 Bacteria 35886
134 Ga0207690_10003380 3300025932 Bacteria 9536
135 Ga0207711_10231084 3300025941 Bacteria 1694
136 Ga0207667_10028261 3300025949 Bacteria 6093
137 Ga0207667_10043415 3300025949 Bacteria 4771
138 Ga0207667_10049566 3300025949 Bacteria 4434
139 Ga0207678_10059952 3300026067 Bacteria 3274
140 Ga0207702_10063758 3300026078 Bacteria 3152
141 Ga0207698_10335788 3300026142 Bacteria 1421
142 Ga0209281_1000028 3300027111 Bacteria 440027
143 Ga0209282_1000075 3300027666 Bacteria 77825
144 Ga0209813_10061622 3300027866 Bacteria 1198
145 Ga0268266_10117337 3300028379 Bacteria 2365
146 Ga0307515_10237761 3300028794 Bacteria 1599
147 Ga0307513_10139434 3300031456 Bacteria 2354
148 Ga0315914_1001307 3300031967 Bacteria 36717
149 Ga0307414_10099079 3300032004 Bacteria 2189
150 Ga0307510_10004106 3300033180 Bacteria 17088
151 Ga0307510_10120258 3300033180 Bacteria 2334
152 Ga0315913_1001596 3300033430 Bacteria 25272
153 Ga0315915_1000042 3300033464 Bacteria 80209
154 Ga0395905_0013599 3300037471 Bacteria 7796
155 Ga0436364_0590203 3300037853 Bacteria 7927
156 Ga0395901_0203317 3300038443 Bacteria 2076
157 Ga0436361_0216394 3300039447 Bacteria 2230
158 Ga0436361_0279546 3300039447 Bacteria 2068
159 Ga0436361_0318174 3300039447 Bacteria 3023
160 Ga0436361_0445149 3300039447 Bacteria 876
161 Ga0436361_0466496 3300039447 Bacteria 6023
162 Ga0436361_0716635 3300039447 Bacteria 4150
163 Ga0436363_1620207 3300039450 Bacteria 2844
164 Ga0439436_0006571 3300041404 Bacteria 3571
165 Ga0439438_033762 3300041405 Bacteria 1350
166 Ga0439465_0050962 3300041413 Bacteria 1355
167 Ga0451787_505587 3300041441 Bacteria 1487
168 Ga0451798_0984989 3300041458 Bacteria 1919
169 Ga0451833_0769068 3300041491 Bacteria 4251
170 Ga0451835_0082151 3300041492 Bacteria 2020
171 Ga0451837_0219012 3300041494 Bacteria 9993
172 Ga0451839_0746754 3300041496 Bacteria 9248
173 Ga0451841_0129660 3300041498 Bacteria 3887
174 Ga0451845_0290259 3300041501 Bacteria 4148
175 Ga0451847_0654864 3300041503 Bacteria 3129
176 Ga0451849_0244831 3300041505 Bacteria 2197
177 Ga0451851_0235632 3300041507 Bacteria 3126
178 Ga0451843_0574778 3300041509 Bacteria 2404
179 Ga0451855_1284999 3300041511 Bacteria 9762
180 Ga0451853_2617308 3300041512 Bacteria 3421
181 Ga0439449_0078124 3300042007 Bacteria 1220
182 Ga0439462_0014504 3300042015 Bacteria 2026
183 Ga0450922_005721 3300042124 Bacteria 1153
184 Ga0450918_005058 3300042531 Bacteria 2375
185 Ga0466958_0054347 3300045836 Bacteria 2428
186 Ga0495617_002663 3300046452 Bacteria 6950
187 Ga0495638_0001006 3300046460 Bacteria 28233
188 Ga0495664_0087353 3300046477 Bacteria 1873
189 Ga0495585_0005189 3300046492 Bacteria 8259
190 Ga0495607_0028936 3300046501 Bacteria 3413
191 Ga0495607_0050585 3300046501 Bacteria 2418
192 Ga0495583_0002616 3300046506 Bacteria 15049
193 Ga0495583_0012475 3300046506 Bacteria 4804
194 Ga0495583_0013197 3300046506 Bacteria 4623
195 Ga0495583_0150713 3300046506 Bacteria 964
196 Ga0495608_0200930 3300046511 Bacteria 1256
197 Ga0495610_0004908 3300046512 Bacteria 9717
198 Ga0495610_0005552 3300046512 Bacteria 8927
199 Ga0495618_0038112 3300046514 Bacteria 3020
200 Ga0495620_0000299 3300046515 Bacteria 35229
201 Ga0495620_0001326 3300046515 Bacteria 15020
202 Ga0495628_0182755 3300046516 Bacteria 1585
203 Ga0495631_0204825 3300046518 Bacteria 843
204 Ga0495632_0115850 3300046519 Bacteria 1255
205 Ga0495632_0233968 3300046519 Bacteria 828
206 Ga0495637_0119166 3300046520 Bacteria 1017
207 Ga0495643_0002758 3300046522 Bacteria 13457
208 Ga0495643_0003892 3300046522 Bacteria 10714
209 Ga0495643_0014793 3300046522 Bacteria 4633
210 Ga0495648_0001065 3300046524 Bacteria 27857
211 Ga0495648_0001954 3300046524 Bacteria 19631
212 Ga0495663_0000101 3300046525 Bacteria 35106
213 Ga0495652_0107296 3300046529 Bacteria 2253
214 Ga0495654_0000296 3300046530 Bacteria 44716
215 Ga0495640_0153396 3300046533 Bacteria 1479
216 Ga0495609_0148829 3300046538 Bacteria 996
217 Ga0495597_0205656 3300046542 Bacteria 787
218 Ga0495622_0002093 3300046557 Bacteria 9761
219 Ga0495633_0011839 3300046558 Bacteria 4676
220 Ga0495656_0217044 3300046615 Bacteria 955
221 Ga0495634_0071400 3300046642 Bacteria 2286
222 Ga0495611_0000583 3300046648 Bacteria 21088
223 Ga0495625_0001051 3300046660 Bacteria 36220
224 Ga0495625_0018483 3300046660 Bacteria 5441
225 Ga0495625_0080325 3300046660 Bacteria 2271
226 Ga0495635_0176989 3300046663 Bacteria 1450
227 Ga0495661_0003002 3300046665 Bacteria 12722
228 Ga0495588_0001206 3300046674 Bacteria 11139
229 Ga0495646_0105199 3300046680 Bacteria 1613
230 Ga0495658_0010586 3300046683 Bacteria 4615
231 Ga0495613_0000402 3300046689 Bacteria 37114
232 Ga0495624_0135518 3300046690 Bacteria 1509
233 Ga0495670_0000129 3300046691 Bacteria 32692
234 Ga0495670_0027911 3300046691 Bacteria 2798
235 Ga0495671_0000401 3300046692 Bacteria 35219
236 Ga0495649_0000882 3300046694 Bacteria 24041
237 Ga0495660_0002916 3300046810 Bacteria 10706
238 Ga0495660_0233251 3300046810 Bacteria 861
239 Ga0495674_0216522 3300047319 Bacteria 1584
240 Ga0495672_0103932 3300047320 Bacteria 1536
241 Ga0495676_0154689 3300047321 Bacteria 1628
242 Ga0495683_0100498 3300047323 Bacteria 1391
243 Ga0495687_000478 3300047443 Bacteria 48491
244 Ga0495687_000998 3300047443 Bacteria 28327
245 Ga0495687_002738 3300047443 Bacteria 13666
246 Ga0495681_0000869 3300047470 Bacteria 23274
247 Ga0495681_0014299 3300047470 Bacteria 4556
248 Ga0495686_0001164 3300047472 Bacteria 30807
249 Ga0495593_0146689 3300047673 Bacteria 1194
250 Ga0495602_0112693 3300048088 Bacteria 2207
251 Ga0496100_0088828 3300048903 Bacteria 2104
252 Ga0496111_0001362 3300048914 Bacteria 13839
253 Ga0496116_0082781 3300048919 Bacteria 1983
254 Ga0496117_0006474 3300048920 Bacteria 11830
255 Ga0496119_0003374 3300048922 Bacteria 16617
256 Ga0496119_0008838 3300048922 Bacteria 8761
257 Ga0496119_0019451 3300048922 Bacteria 5001
258 Ga0496119_0175494 3300048922 Bacteria 1128
259 Ga0496120_0003022 3300048923 Bacteria 15931
260 Ga0496120_0038163 3300048923 Bacteria 2844
261 Ga0496120_0150023 3300048923 Bacteria 1173
262 Ga0496121_0016319 3300048924 Bacteria 7675
263 Ga0496121_0016320 3300048924 Bacteria 7675
264 Ga0496121_0035625 3300048924 Bacteria 4455
265 Ga0496121_0234992 3300048924 Bacteria 1281
266 Ga0496122_0000960 3300048925 Bacteria 52000
267 Ga0496122_0003049 3300048925 Bacteria 22654
268 Ga0496122_0004420 3300048925 Bacteria 17492
269 Ga0496122_0103634 3300048925 Bacteria 1892
270 Ga0496122_0332071 3300048925 Bacteria 803
271 Ga0496123_0000764 3300048926 Bacteria 51994
272 Ga0496123_0002513 3300048926 Bacteria 22537
273 Ga0496123_0004959 3300048926 Bacteria 13640
274 Ga0496123_0037512 3300048926 Bacteria 3420
275 Ga0496124_0005589 3300048927 Bacteria 14070
276 Ga0496124_0008170 3300048927 Bacteria 10980
277 Ga0496124_0016905 3300048927 Bacteria 6913
278 Ga0496124_0060047 3300048927 Bacteria 3191
279 Ga0496125_0015172 3300048928 Bacteria 7464
280 Ga0496125_0044149 3300048928 Bacteria 3774
281 Ga0496126_0118709 3300048929 Bacteria 2296
282 Ga0496126_0122333 3300048929 Bacteria 2255
283 Ga0496126_0388971 3300048929 Bacteria 1133
284 Ga0495678_000635 3300049459 Bacteria 32497
285 Ga0495682_0000331 3300049460 Bacteria 35194
286 Ga0501036_0113588 3300049572 Bacteria 2289
287 Ga0501037_0199244 3300049573 Bacteria 1415
288 Ga0501038_0051247 3300049574 Bacteria 3564
289 Ga0501039_0361060 3300049575 Bacteria 1141
290 Ga0501040_0128698 3300049576 Bacteria 1779
291 Ga0501041_0236019 3300049577 Bacteria 1149
292 Ga0501042_0115267 3300049578 Bacteria 1935
293 Ga0501043_0232736 3300049579 Bacteria 1423
294 Ga0501072_0115407 3300049588 Bacteria 2138
295 Ga0501073_0055068 3300049589 Bacteria 2784
296 Ga0501074_0369988 3300049590 Bacteria 1017
297 Ga0501075_0026281 3300049591 Bacteria 4284
298 Ga0501238_009246 3300049671 Bacteria 1306
299 Ga0501080_0147935 3300049742 Bacteria 2172
300 Ga0501080_0487000 3300049742 Bacteria 1103
301 Ga0501081_0036975 3300049743 Bacteria 3331
302 nmdc:mga03683_16700_c1 3300050489 Bacteria 2763
303 nmdc:mga03683_38086_c1 3300050489 Bacteria 1962
304 nmdc:mga03n38_9657_c1 3300050490 Bacteria 3517
305 nmdc:mga00v17_2209_c1 3300050491 Bacteria 10006
306 nmdc:mga0yw44_555_c1 3300050492 Bacteria 13472
307 nmdc:mga0yw44_5930_c1 3300050492 Bacteria 5842
308 nmdc:mga0yw44_6532_c1 3300050492 Bacteria 5646
309 nmdc:mga0k408_4354_c1 3300050493 Bacteria 7515
310 nmdc:mga06z11_23792_c1 3300050494 Bacteria 2882
311 nmdc:mga06z11_6008_c1 3300050494 Bacteria 4908
312 nmdc:mga04h51_47931_c1 3300050495 Bacteria 1422
313 nmdc:mga04h51_73682_c1 3300050495 Bacteria 1198
314 nmdc:mga07m45_1121_c1 3300050496 Bacteria 12013
315 nmdc:mga07m45_15007_c1 3300050496 Bacteria 4136
316 nmdc:mga07m45_1743_c1 3300050496 Bacteria 10015
317 nmdc:mga08y16_356958_c1 3300050511 Bacteria 1501
318 nmdc:mga0sz30_31852_c1 3300050516 Bacteria 2184
319 Ga0495601_0172827 3300053077 Bacteria 1412
320 Ga0495655_0100339 3300053083 Bacteria 856
321 Ga0500578_0001023 3300053086 Bacteria 30718
322 Ga0500643_056314 3300053087 Bacteria 1112
323 Ga0500583_0000368 3300053092 Bacteria 14795
324 Ga0500566_0200019 3300053094 Bacteria 1010
325 Ga0500555_002310 3300053103 Bacteria 5550
326 Ga0500556_0000834 3300053104 Bacteria 17689
327 Ga0500572_049403 3300053111 Bacteria 1248
328 Ga0500572_064446 3300053111 Bacteria 1120
329 Ga0500597_011557 3300053120 Bacteria 3200
330 Ga0500608_000822 3300053122 Bacteria 11255
331 Ga0500618_000222 3300053125 Bacteria 44764
332 Ga0500618_000241 3300053125 Bacteria 43403
333 Ga0500618_000668 3300053125 Bacteria 20211
334 Ga0500618_001256 3300053125 Bacteria 11822
335 Ga0500658_0000110 3300053134 Bacteria 38421
336 Ga0500559_0005199 3300053136 Bacteria 6007
337 Ga0500559_0067786 3300053136 Bacteria 1602
338 Ga0500561_0014908 3300053137 Bacteria 1715
339 Ga0500564_000492 3300053138 Bacteria 11587
340 Ga0500574_000181 3300053141 Bacteria 7439
341 Ga0500590_000077 3300053148 Bacteria 24739
342 Ga0500616_0000232 3300053153 Bacteria 87382
343 Ga0500619_010627 3300053154 Bacteria 2336
344 Ga0500624_000211 3300053157 Bacteria 22021
345 Ga0500634_0107875 3300053161 Bacteria 1380
346 Ga0500638_000049 3300053162 Bacteria 27994
347 Ga0500636_0000596 3300053177 Bacteria 19728
348 Ga0500636_0019410 3300053177 Bacteria 4024
349 Ga0500636_0149118 3300053177 Bacteria 1286
350 Ga0500636_0169935 3300053177 Bacteria 1180
351 Ga0501084_0706013 3300054114 Bacteria 850
352 Ga0466962_0054180 3300061719 Bacteria 1917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049577 Ga0501041_0236019 Ga0501041_0236019_12_650 211
2 iso_pu_bacteria 2551306089 2551715404 214
3 iso_pu_bacteria 2802428859 2802723772 214
4 iso_pu_bacteria 2957443900 2957444594 214
5 iso_pu_bacteria 2960617483 2960618494 214
6 iso_pu_bacteria 2977523885 2977528211 214
7 3300013306 Ga0163162_10878417 Ga0163162_108784172 215
8 iso_pu_bacteria 2842521101 2842522794 215
9 iso_pu_bacteria 639633055 639645577 215
10 3300006948 Ga0099826_10010074 Ga0099826_100100748 218
11 3300022739 Ga0228711_1010171 Ga0228711_10101719 218
12 3300022740 Ga0228710_1004457 Ga0228710_100445711 218
13 3300027666 Ga0209282_1000075 Ga0209282_100007568 218
14 3300031967 Ga0315914_1001307 Ga0315914_100130721 218
15 3300033430 Ga0315913_1001596 Ga0315913_10015969 218
16 3300033464 Ga0315915_1000042 Ga0315915_100004214 218
17 3300038443 Ga0395901_0203317 Ga0395901_0203317_1389_2057 218
18 3300049742 Ga0501080_0487000 Ga0501080_0487000_31_699 218
19 3300002987 JGI25159J45721_1000056 JGI25159J45721_100005636 219
20 3300003354 JGI25160J50197_1000026 JGI25160J50197_1000026136 219
21 3300003374 JGI25161J50226_1000014 JGI25161J50226_100001455 219
22 3300004625 Ga0055543_1000052 Ga0055543_100005263 219
23 3300005262 Ga0065165_1000073 Ga0065165_100007332 219
24 3300042015 Ga0439462_0014504 Ga0439462_0014504_1135_1803 219
25 3300042531 Ga0450918_005058 Ga0450918_005058_859_1527 219
26 3300046519 Ga0495632_0233968 Ga0495632_0233968_31_693 219
27 3300046810 Ga0495660_0233251 Ga0495660_0233251_33_695 219
28 3300047470 Ga0495681_0014299 Ga0495681_0014299_3853_4512 219
29 3300053154 Ga0500619_010627 Ga0500619_010627_31_690 219
30 3300053177 Ga0500636_0169935 Ga0500636_0169935_42_701 219
31 3300045836 Ga0466958_0054347 Ga0466958_0054347_790_1518 221
32 3300049576 Ga0501040_0128698 Ga0501040_0128698_543_1211 221
33 3300049578 Ga0501042_0115267 Ga0501042_0115267_293_961 221
34 3300049588 Ga0501072_0115407 Ga0501072_0115407_381_1049 221
35 3300049591 Ga0501075_0026281 Ga0501075_0026281_1574_2242 221
36 3300049743 Ga0501081_0036975 Ga0501081_0036975_2114_2782 221
37 3300061719 Ga0466962_0054180 Ga0466962_0054180_318_1046 221
38 3300037853 Ga0436364_0590203 Ga0436364_0590203_4049_4729 223
39 3300005345 Ga0070692_10003220 Ga0070692_100032209 227
40 3300005366 Ga0070659_100003145 Ga0070659_1000031454 227
41 3300006871 Ga0075434_100692137 Ga0075434_1006921372 227
42 3300025932 Ga0207690_10003380 Ga0207690_100033807 227
43 3300046542 Ga0495597_0205656 Ga0495597_0205656_29_742 227
44 3300054114 Ga0501084_0706013 Ga0501084_0706013_149_835 227
45 3300005563 Ga0068855_100040565 Ga0068855_1000405653 229
46 3300009093 Ga0105240_10062827 Ga0105240_100628273 229
47 3300024227 Ga0228598_1014371 Ga0228598_10143712 229
48 3300025913 Ga0207695_10002873 Ga0207695_100028733 229
49 3300025949 Ga0207667_10049566 Ga0207667_100495662 229
50 3300021361 Ga0213872_10007397 Ga0213872_100073974 230
51 3300021361 Ga0213872_10063797 Ga0213872_100637971 230
52 3300039447 Ga0436361_0279546 Ga0436361_0279546_1226_1975 230
53 3300039447 Ga0436361_0318174 Ga0436361_0318174_1714_2463 230
54 3300046512 Ga0495610_0005552 Ga0495610_0005552_4446_5171 230
55 3300047443 Ga0495687_000998 Ga0495687_000998_14359_15084 230
56 iso_pu_bacteria 2643221607 2644049769 230
57 iso_pu_bacteria 2643221636 2644202719 230
58 iso_pu_bacteria 2643221686 2644482049 230
59 iso_pu_bacteria 2957415311 2957419604 230
60 iso_pu_bacteria 2960660292 2960661378 230
61 3300009094 Ga0111539_10484160 Ga0111539_104841602 231
62 3300050511 nmdc:mga08y16_356958_c1 nmdc:mga08y16_356958_c1_461_1183 231
63 iso_pu_bacteria 2979089926 2979095313 231
64 iso_pu_bacteria 2979095461 2979097566 231
65 iso_pu_bacteria 2513237088 2513600231 234
66 3300006038 Ga0075365_10003501 Ga0075365_100035013 235
67 3300006051 Ga0075364_10004374 Ga0075364_100043749 235
68 3300006177 Ga0075362_10109782 Ga0075362_101097821 235
69 3300006353 Ga0075370_10002787 Ga0075370_100027873 235
70 3300050489 nmdc:mga03683_38086_c1 nmdc:mga03683_38086_c1_517_1257 235
71 3300050491 nmdc:mga00v17_2209_c1 nmdc:mga00v17_2209_c1_6830_7570 235
72 3300050492 nmdc:mga0yw44_5930_c1 nmdc:mga0yw44_5930_c1_3995_4735 235
73 3300050496 nmdc:mga07m45_1743_c1 nmdc:mga07m45_1743_c1_6839_7579 235
74 iso_pu_bacteria 2582581294 2585204453 235
75 iso_pu_bacteria 2582581299 2585228310 235
76 iso_pu_bacteria 2582581299 2585231398 235
77 iso_pu_bacteria 2989771324 2989776604 235
78 iso_pu_bacteria 8005258706 8005258747 235
79 3300021361 Ga0213872_10016359 Ga0213872_100163593 236
80 3300021361 Ga0213872_10029293 Ga0213872_100292935 236
81 3300039447 Ga0436361_0216394 Ga0436361_0216394_43_777 236
82 3300039447 Ga0436361_0466496 Ga0436361_0466496_2307_3050 236
83 3300039447 Ga0436361_0716635 Ga0436361_0716635_944_1687 236
84 iso_pu_bacteria 2509276033 2509445109 236
85 iso_pu_bacteria 2510461076 2510897026 236
86 iso_pu_bacteria 2510917026 2511175582 236
87 iso_pu_bacteria 2513237103 2513712675 236
88 iso_pu_bacteria 2513237162 2514023563 236
89 iso_pu_bacteria 2515154114 2515644921 236
90 iso_pu_bacteria 2515154116 2515659430 236
91 iso_pu_bacteria 2516653077 2517042445 236
92 iso_pu_bacteria 2517487022 2517566773 236
93 iso_pu_bacteria 2585427528 2585542235 236
94 iso_pu_bacteria 2585427593 2585840569 236
95 iso_pu_bacteria 2585427633 2585998190 236
96 iso_pu_bacteria 2585427634 2586002767 236
97 iso_pu_bacteria 2617270742 2617384509 236
98 iso_pu_bacteria 2657244999 2657685035 236
99 iso_pu_bacteria 2718217882 2719184131 236
100 iso_pu_bacteria 2718217997 2719669469 236
101 iso_pu_bacteria 2718218009 2719729704 236
102 iso_pu_bacteria 2718218199 2720494485 236
103 iso_pu_bacteria 2718218232 2720610822 236
104 iso_pu_bacteria 2718218233 2720616700 236
105 iso_pu_bacteria 2718218235 2720628057 236
106 iso_pu_bacteria 2718218269 2720771637 236
107 iso_pu_bacteria 2718218363 2721143954 236
108 iso_pu_bacteria 2718218365 2721156642 236
109 iso_pu_bacteria 2718218366 2721161329 236
110 iso_pu_bacteria 2721755514 2722837282 236
111 iso_pu_bacteria 2721755556 2723030900 236
112 iso_pu_bacteria 2721755684 2723563400 236
113 iso_pu_bacteria 2721755685 2723571391 236
114 iso_pu_bacteria 2721755810 2724040858 236
115 iso_pu_bacteria 2721755819 2724087186 236
116 iso_pu_bacteria 2721755822 2724100897 236
117 iso_pu_bacteria 2721755823 2724108138 236
118 iso_pu_bacteria 2728369352 2730105366 236
119 iso_pu_bacteria 2728369365 2730162271 236
120 iso_pu_bacteria 2728369397 2730295403 236
121 iso_pu_bacteria 2738541333 2739037470 236
122 iso_pu_bacteria 2775507266 2778178907 236
123 iso_pu_bacteria 2791355256 2793295788 236
124 iso_pu_bacteria 2791355260 2793321952 236
125 iso_pu_bacteria 2791355261 2793329450 236
126 iso_pu_bacteria 2791355263 2793340804 236
127 iso_pu_bacteria 2802429268 2804754870 236
128 iso_pu_bacteria 2802429633 2806047197 236
129 iso_pu_bacteria 2802429634 2806054804 236
130 iso_pu_bacteria 2802429635 2806061968 236
131 iso_pu_bacteria 2802429636 2806069509 236
132 iso_pu_bacteria 2802429637 2806076120 236
133 iso_pu_bacteria 2838042994 2838047604 236
134 iso_pu_bacteria 2838068647 2838072403 236
135 iso_pu_bacteria 2842217011 2842223520 236
136 iso_pu_bacteria 2842357229 2842361664 236
137 iso_pu_bacteria 2842395702 2842396868 236
138 iso_pu_bacteria 2842422224 2842426150 236
139 iso_pu_bacteria 2842447887 2842452569 236
140 iso_pu_bacteria 2916000859 2916001719 236
141 iso_pu_bacteria 2919171160 2919172722 236
142 iso_pu_bacteria 2921250672 2921255646 236
143 iso_pu_bacteria 2924179722 2924180611 236
144 iso_pu_bacteria 2936381700 2936382401 236
145 iso_pu_bacteria 2937078374 2937080522 236
146 iso_pu_bacteria 2957437181 2957442382 236
147 iso_pu_bacteria 2960591022 2960591656 236
148 iso_pu_bacteria 2970026789 2970029483 236
149 iso_pu_bacteria 2970095765 2970096936 236
150 iso_pu_bacteria 2977530762 2977533737 236
151 iso_pu_bacteria 2996893221 2996894571 236
152 iso_pu_bacteria 3005416602 3005419087 236
153 iso_pu_bacteria 3005452660 3005455223 236
154 iso_pu_bacteria 8005282627 8005287229 236
155 iso_pu_bacteria 8005289223 8005292138 236
156 iso_pu_bacteria 8005301065 8005307321 236
157 iso_pu_bacteria 8005430974 8005435625 236
158 iso_pu_bacteria 8005497431 8005503368 236
159 iso_pu_bacteria 8005570704 8005570949 236
160 iso_pu_bacteria 8005626139 8005631928 236
161 iso_pu_bacteria 8005668836 8005675246 236
162 iso_pu_bacteria 8005688590 8005688609 236
163 iso_pu_bacteria 8005695170 8005701035 236
164 iso_pu_bacteria 8049293176 8049297987 236
165 iso_pu_bacteria 8057874678 8057878912 236
166 iso_pu_bacteria 8057874678 8057880012 236
167 3300046506 Ga0495583_0002616 Ga0495583_0002616_6728_7471 237
168 3300046515 Ga0495620_0001326 Ga0495620_0001326_8827_9570 237
169 iso_pu_bacteria 2513237159 2513996966 237
170 iso_pu_bacteria 2582581307 2585275215 237
171 iso_pu_bacteria 2582581308 2585283749 237
172 iso_pu_bacteria 2582581315 2585329229 237
173 iso_pu_bacteria 2582581316 2585336671 237
174 iso_pu_bacteria 2585427527 2585537071 237
175 iso_pu_bacteria 2585427530 2585556496 237
176 iso_pu_bacteria 2585427531 2585561070 237
177 iso_pu_bacteria 2585427608 2585900859 237
178 iso_pu_bacteria 2585427609 2585908339 237
179 iso_pu_bacteria 2585428125 2587983626 237
180 iso_pu_bacteria 2599185236 2599720218 237
181 iso_pu_bacteria 2615840626 2616310071 237
182 iso_pu_bacteria 2643221733 2644731260 237
183 iso_pu_bacteria 2667528174 2671116234 237
184 iso_pu_bacteria 2818991453 2819642481 237
185 iso_pu_bacteria 2818991461 2819682780 237
186 iso_pu_bacteria 2821123053 2821128612 237
187 iso_pu_bacteria 2838736955 2838741629 237
188 iso_pu_bacteria 2841840854 2841845537 237
189 iso_pu_bacteria 2842140634 2842145240 237
190 iso_pu_bacteria 2842482326 2842487067 237
191 iso_pu_bacteria 2842509118 2842513829 237
192 iso_pu_bacteria 2852387548 2852395303 237
193 iso_pu_bacteria 2854896431 2854902161 237
194 iso_pu_bacteria 2854916844 2854917240 237
195 iso_pu_bacteria 2857531043 2857534235 237
196 iso_pu_bacteria 2917699015 2917700018 237
197 iso_pu_bacteria 2919408235 2919413920 237
198 iso_pu_bacteria 8005645114 8005645499 237
199 iso_pu_bacteria 8005682033 8005688317 237
200 iso_pu_bacteria 8024486573 8024491194 237
201 iso_pu_bacteria 8046767195 8046774339 237
202 3300006038 Ga0075365_10002649 Ga0075365_100026493 238
203 3300025297 Ga0209758_1021839 Ga0209758_10218393 238
204 3300048929 Ga0496126_0118709 Ga0496126_0118709_1036_1758 238
205 3300050492 nmdc:mga0yw44_555_c1 nmdc:mga0yw44_555_c1_11185_11907 238
206 3300006042 Ga0075368_10098617 Ga0075368_100986171 239
207 3300006852 Ga0075433_10029023 Ga0075433_100290233 239
208 3300025294 Ga0209025_1005649 Ga0209025_10056494 239
209 3300025297 Ga0209758_1019111 Ga0209758_10191115 239
210 3300027866 Ga0209813_10061622 Ga0209813_100616221 239
211 3300028794 Ga0307515_10237761 Ga0307515_102377612 239
212 3300031456 Ga0307513_10139434 Ga0307513_101394342 239
213 3300037471 Ga0395905_0013599 Ga0395905_0013599_5967_6698 239
214 3300046506 Ga0495583_0013197 Ga0495583_0013197_3253_4002 239
215 3300046522 Ga0495643_0003892 Ga0495643_0003892_5324_6073 239
216 3300046660 Ga0495625_0018483 Ga0495625_0018483_685_1434 239
217 3300047443 Ga0495687_002738 Ga0495687_002738_8731_9480 239
218 3300048927 Ga0496124_0008170 Ga0496124_0008170_5866_6618 239
219 3300050494 nmdc:mga06z11_23792_c1 nmdc:mga06z11_23792_c1_1293_2042 239
220 3300050495 nmdc:mga04h51_73682_c1 nmdc:mga04h51_73682_c1_340_1089 239
221 3300053104 Ga0500556_0000834 Ga0500556_0000834_16626_17351 239
222 3300053136 Ga0500559_0005199 Ga0500559_0005199_2684_3415 239
223 3300002704 JGI25155J39150_1000026 JGI25155J39150_10000266 240
224 3300002705 JGI25156J39149_1000028 JGI25156J39149_10000286 240
225 3300002737 JGI25162J39368_1000452 JGI25162J39368_100045223 240
226 3300002738 JGI25154J39366_1000046 JGI25154J39366_10000465 240
227 3300002741 JGI25157J39369_1000358 JGI25157J39369_100035827 240
228 3300003187 JGI25151J46595_10001124 JGI25151J46595_1000112416 240
229 3300003214 JGI25165J46597_1000116 JGI25165J46597_100011628 240
230 3300003215 JGI25153J46596_10004984 JGI25153J46596_100049847 240
231 3300003215 JGI25153J46596_10050541 JGI25153J46596_100505411 240
232 3300003323 rootH1_10269008 rootH1_102690083 240
233 3300003354 JGI25160J50197_1002772 JGI25160J50197_10027726 240
234 3300003374 JGI25161J50226_1001565 JGI25161J50226_10015654 240
235 3300003771 Ga0055526_1000795 Ga0055526_100079516 240
236 3300003771 Ga0055526_1002999 Ga0055526_10029993 240
237 3300003775 Ga0055524_1001465 Ga0055524_10014658 240
238 3300003781 Ga0055536_1006281 Ga0055536_10062813 240
239 3300003790 Ga0055528_1000746 Ga0055528_100074610 240
240 3300003790 Ga0055528_1001731 Ga0055528_10017317 240
241 3300003792 Ga0055540_1002077 Ga0055540_10020775 240
242 3300003792 Ga0055540_1006183 Ga0055540_10061835 240
243 3300003794 Ga0055531_10004284 Ga0055531_100042842 240
244 3300004625 Ga0055543_1000765 Ga0055543_100076510 240
245 3300005262 Ga0065165_1013874 Ga0065165_10138744 240
246 3300006038 Ga0075365_10010935 Ga0075365_100109354 240
247 3300006042 Ga0075368_10009381 Ga0075368_100093814 240
248 3300006048 Ga0075363_100003241 Ga0075363_1000032416 240
249 3300006177 Ga0075362_10001375 Ga0075362_100013758 240
250 3300006178 Ga0075367_10012924 Ga0075367_100129245 240
251 3300006186 Ga0075369_10002720 Ga0075369_100027204 240
252 3300006195 Ga0075366_10002825 Ga0075366_100028254 240
253 3300006353 Ga0075370_10014054 Ga0075370_100140543 240
254 3300006946 Ga0079104_1025918 Ga0079104_10259182 240
255 3300017792 Ga0163161_10298984 Ga0163161_102989842 240
256 3300025206 Ga0209435_100017 Ga0209435_100017191 240
257 3300025233 Ga0209437_100128 Ga0209437_100128110 240
258 3300025245 Ga0207425_1002847 Ga0207425_10028476 240
259 3300025246 Ga0209646_1000048 Ga0209646_1000048130 240
260 3300025250 Ga0209026_1000035 Ga0209026_1000035130 240
261 3300025256 Ga0209759_1000027 Ga0209759_1000027191 240
262 3300025258 Ga0209129_1000272 Ga0209129_100027228 240
263 3300025261 Ga0209233_1000072 Ga0209233_1000072245 240
264 3300025273 Ga0209673_1000255 Ga0209673_100025589 240
265 3300025273 Ga0209673_1000733 Ga0209673_100073341 240
266 3300025273 Ga0209673_1001353 Ga0209673_10013538 240
267 3300025284 Ga0209130_1014322 Ga0209130_10143221 240
268 3300025292 Ga0209676_1004782 Ga0209676_10047822 240
269 3300025294 Ga0209025_1000735 Ga0209025_100073520 240
270 3300025295 Ga0209564_1000215 Ga0209564_1000215109 240
271 3300025295 Ga0209564_1000695 Ga0209564_100069541 240
272 3300025297 Ga0209758_1000291 Ga0209758_100029149 240
273 3300025297 Ga0209758_1000687 Ga0209758_100068736 240
274 3300025298 Ga0209050_1008090 Ga0209050_10080904 240
275 3300025299 Ga0209256_1000155 Ga0209256_10001556 240
276 3300025299 Ga0209256_1003723 Ga0209256_10037234 240
277 3300025299 Ga0209256_1005635 Ga0209256_10056358 240
278 3300025302 Ga0207426_1000569 Ga0207426_100056935 240
279 3300025303 Ga0209051_1000708 Ga0209051_100070814 240
280 3300025303 Ga0209051_1000958 Ga0209051_100095821 240
281 3300025304 Ga0209257_1002285 Ga0209257_10022857 240
282 3300032004 Ga0307414_10099079 Ga0307414_100990792 240
283 3300039447 Ga0436361_0445149 Ga0436361_0445149_79_816 240
284 3300039450 Ga0436363_1620207 Ga0436363_1620207_1973_2710 240
285 3300041441 Ga0451787_505587 Ga0451787_505587_591_1316 240
286 3300041458 Ga0451798_0984989 Ga0451798_0984989_251_976 240
287 3300041491 Ga0451833_0769068 Ga0451833_0769068_2076_2801 240
288 3300041492 Ga0451835_0082151 Ga0451835_0082151_363_1088 240
289 3300041494 Ga0451837_0219012 Ga0451837_0219012_1484_2209 240
290 3300041496 Ga0451839_0746754 Ga0451839_0746754_7591_8316 240
291 3300041498 Ga0451841_0129660 Ga0451841_0129660_938_1663 240
292 3300041501 Ga0451845_0290259 Ga0451845_0290259_2480_3205 240
293 3300041503 Ga0451847_0654864 Ga0451847_0654864_955_1680 240
294 3300041505 Ga0451849_0244831 Ga0451849_0244831_1039_1764 240
295 3300041507 Ga0451851_0235632 Ga0451851_0235632_953_1678 240
296 3300041509 Ga0451843_0574778 Ga0451843_0574778_1428_2153 240
297 3300041511 Ga0451855_1284999 Ga0451855_1284999_7605_8330 240
298 3300041512 Ga0451853_2617308 Ga0451853_2617308_1693_2418 240
299 3300046506 Ga0495583_0150713 Ga0495583_0150713_133_858 240
300 3300046518 Ga0495631_0204825 Ga0495631_0204825_44_769 240
301 3300046524 Ga0495648_0001954 Ga0495648_0001954_11413_12138 240
302 3300046538 Ga0495609_0148829 Ga0495609_0148829_250_975 240
303 3300046558 Ga0495633_0011839 Ga0495633_0011839_1457_2182 240
304 3300046615 Ga0495656_0217044 Ga0495656_0217044_145_870 240
305 3300046660 Ga0495625_0080325 Ga0495625_0080325_1211_1936 240
306 3300046691 Ga0495670_0027911 Ga0495670_0027911_567_1292 240
307 3300048914 Ga0496111_0001362 Ga0496111_0001362_4452_5177 240
308 3300048922 Ga0496119_0175494 Ga0496119_0175494_145_870 240
309 3300048923 Ga0496120_0150023 Ga0496120_0150023_47_772 240
310 3300048925 Ga0496122_0332071 Ga0496122_0332071_39_764 240
311 3300048926 Ga0496123_0037512 Ga0496123_0037512_882_1607 240
312 3300050489 nmdc:mga03683_16700_c1 nmdc:mga03683_16700_c1_504_1229 240
313 3300050490 nmdc:mga03n38_9657_c1 nmdc:mga03n38_9657_c1_712_1437 240
314 3300050492 nmdc:mga0yw44_6532_c1 nmdc:mga0yw44_6532_c1_2638_3363 240
315 3300050493 nmdc:mga0k408_4354_c1 nmdc:mga0k408_4354_c1_3366_4091 240
316 3300050494 nmdc:mga06z11_6008_c1 nmdc:mga06z11_6008_c1_3775_4500 240
317 3300050495 nmdc:mga04h51_47931_c1 nmdc:mga04h51_47931_c1_655_1380 240
318 3300050496 nmdc:mga07m45_15007_c1 nmdc:mga07m45_15007_c1_2398_3123 240
319 3300050516 nmdc:mga0sz30_31852_c1 nmdc:mga0sz30_31852_c1_148_873 240
320 3300053087 Ga0500643_056314 Ga0500643_056314_324_1049 240
321 3300053125 Ga0500618_000241 Ga0500618_000241_25363_26100 240
322 3300053134 Ga0500658_0000110 Ga0500658_0000110_17997_18722 240
323 3300053153 Ga0500616_0000232 Ga0500616_0000232_26884_27609 240
324 3300001979 JGI24740J21852_10000059 JGI24740J21852_1000005932 241
325 3300002737 JGI25162J39368_1000238 JGI25162J39368_100023814 241
326 3300003214 JGI25165J46597_1000722 JGI25165J46597_10007229 241
327 3300003214 JGI25165J46597_1004082 JGI25165J46597_10040824 241
328 3300003320 rootH2_10105471 rootH2_101054713 241
329 3300003322 rootL2_10008082 rootL2_1000808259 241
330 3300003322 rootL2_10185335 rootL2_101853352 241
331 3300005327 Ga0070658_10189682 Ga0070658_101896822 241
332 3300005339 Ga0070660_100009283 Ga0070660_1000092833 241
333 3300005366 Ga0070659_100209157 Ga0070659_1002091572 241
334 3300005455 Ga0070663_100016761 Ga0070663_1000167612 241
335 3300005530 Ga0070679_100118919 Ga0070679_1001189192 241
336 3300005563 Ga0068855_100036701 Ga0068855_1000367014 241
337 3300005614 Ga0068856_100020042 Ga0068856_1000200424 241
338 3300005616 Ga0068852_100196129 Ga0068852_1001961291 241
339 3300006353 Ga0075370_10001260 Ga0075370_100012603 241
340 3300006946 Ga0079104_1000101 Ga0079104_100010183 241
341 3300009036 Ga0105244_10102329 Ga0105244_101023292 241
342 3300009093 Ga0105240_10002575 Ga0105240_1000257536 241
343 3300009101 Ga0105247_10127032 Ga0105247_101270322 241
344 3300009148 Ga0105243_10051220 Ga0105243_100512202 241
345 3300009177 Ga0105248_10309236 Ga0105248_103092362 241
346 3300009545 Ga0105237_10021145 Ga0105237_100211454 241
347 3300009551 Ga0105238_10144842 Ga0105238_101448422 241
348 3300010375 Ga0105239_10261128 Ga0105239_102611282 241
349 3300010375 Ga0105239_10735007 Ga0105239_107350071 241
350 3300013104 Ga0157370_10001604 Ga0157370_100016044 241
351 3300013105 Ga0157369_10478901 Ga0157369_104789011 241
352 3300013105 Ga0157369_10588614 Ga0157369_105886141 241
353 3300015262 Ga0182007_10017063 Ga0182007_100170633 241
354 3300015265 Ga0182005_1004457 Ga0182005_10044573 241
355 3300017792 Ga0163161_10083450 Ga0163161_100834503 241
356 3300025233 Ga0209437_100283 Ga0209437_10028360 241
357 3300025246 Ga0209646_1004088 Ga0209646_10040883 241
358 3300025253 Ga0209677_101249 Ga0209677_10124912 241
359 3300025261 Ga0209233_1000268 Ga0209233_100026860 241
360 3300025261 Ga0209233_1000727 Ga0209233_10007276 241
361 3300025284 Ga0209130_1000121 Ga0209130_100012171 241
362 3300025302 Ga0207426_1000075 Ga0207426_100007571 241
363 3300025909 Ga0207705_10009721 Ga0207705_100097215 241
364 3300025913 Ga0207695_10002230 Ga0207695_1000223035 241
365 3300025914 Ga0207671_10000448 Ga0207671_100004486 241
366 3300025919 Ga0207657_10000691 Ga0207657_1000069124 241
367 3300025941 Ga0207711_10231084 Ga0207711_102310842 241
368 3300025949 Ga0207667_10028261 Ga0207667_100282612 241
369 3300025949 Ga0207667_10043415 Ga0207667_100434154 241
370 3300026067 Ga0207678_10059952 Ga0207678_100599522 241
371 3300026078 Ga0207702_10063758 Ga0207702_100637584 241
372 3300026142 Ga0207698_10335788 Ga0207698_103357882 241
373 3300027111 Ga0209281_1000028 Ga0209281_1000028139 241
374 3300028379 Ga0268266_10117337 Ga0268266_101173372 241
375 3300033180 Ga0307510_10004106 Ga0307510_100041069 241
376 3300033180 Ga0307510_10120258 Ga0307510_101202582 241
377 3300041404 Ga0439436_0006571 Ga0439436_0006571_844_1578 241
378 3300041405 Ga0439438_033762 Ga0439438_033762_450_1184 241
379 3300041413 Ga0439465_0050962 Ga0439465_0050962_42_776 241
380 3300042007 Ga0439449_0078124 Ga0439449_0078124_288_1022 241
381 3300042124 Ga0450922_005721 Ga0450922_005721_30_764 241
382 3300046452 Ga0495617_002663 Ga0495617_002663_787_1593 241
383 3300046460 Ga0495638_0001006 Ga0495638_0001006_11534_12340 241
384 3300046477 Ga0495664_0087353 Ga0495664_0087353_128_871 241
385 3300046492 Ga0495585_0005189 Ga0495585_0005189_4421_5227 241
386 3300046501 Ga0495607_0028936 Ga0495607_0028936_2255_2983 241
387 3300046501 Ga0495607_0050585 Ga0495607_0050585_877_1683 241
388 3300046506 Ga0495583_0012475 Ga0495583_0012475_3663_4469 241
389 3300046511 Ga0495608_0200930 Ga0495608_0200930_320_1063 241
390 3300046512 Ga0495610_0004908 Ga0495610_0004908_4778_5584 241
391 3300046514 Ga0495618_0038112 Ga0495618_0038112_666_1409 241
392 3300046515 Ga0495620_0000299 Ga0495620_0000299_18493_19299 241
393 3300046516 Ga0495628_0182755 Ga0495628_0182755_76_819 241
394 3300046519 Ga0495632_0115850 Ga0495632_0115850_376_1182 241
395 3300046520 Ga0495637_0119166 Ga0495637_0119166_261_989 241
396 3300046522 Ga0495643_0002758 Ga0495643_0002758_1627_2433 241
397 3300046522 Ga0495643_0014793 Ga0495643_0014793_222_947 241
398 3300046524 Ga0495648_0001065 Ga0495648_0001065_18449_19255 241
399 3300046525 Ga0495663_0000101 Ga0495663_0000101_18459_19265 241
400 3300046529 Ga0495652_0107296 Ga0495652_0107296_1115_1858 241
401 3300046530 Ga0495654_0000296 Ga0495654_0000296_4563_5291 241
402 3300046533 Ga0495640_0153396 Ga0495640_0153396_693_1436 241
403 3300046557 Ga0495622_0002093 Ga0495622_0002093_1860_2666 241
404 3300046642 Ga0495634_0071400 Ga0495634_0071400_1131_1874 241
405 3300046648 Ga0495611_0000583 Ga0495611_0000583_4374_5180 241
406 3300046660 Ga0495625_0001051 Ga0495625_0001051_18493_19299 241
407 3300046663 Ga0495635_0176989 Ga0495635_0176989_511_1254 241
408 3300046665 Ga0495661_0003002 Ga0495661_0003002_4206_5012 241
409 3300046674 Ga0495588_0001206 Ga0495588_0001206_3212_4018 241
410 3300046680 Ga0495646_0105199 Ga0495646_0105199_345_1088 241
411 3300046683 Ga0495658_0010586 Ga0495658_0010586_3149_3892 241
412 3300046689 Ga0495613_0000402 Ga0495613_0000402_20393_21199 241
413 3300046690 Ga0495624_0135518 Ga0495624_0135518_731_1474 241
414 3300046691 Ga0495670_0000129 Ga0495670_0000129_13585_14391 241
415 3300046692 Ga0495671_0000401 Ga0495671_0000401_15921_16727 241
416 3300046694 Ga0495649_0000882 Ga0495649_0000882_18490_19296 241
417 3300046810 Ga0495660_0002916 Ga0495660_0002916_2890_3696 241
418 3300047319 Ga0495674_0216522 Ga0495674_0216522_216_959 241
419 3300047320 Ga0495672_0103932 Ga0495672_0103932_444_1169 241
420 3300047321 Ga0495676_0154689 Ga0495676_0154689_306_1049 241
421 3300047323 Ga0495683_0100498 Ga0495683_0100498_390_1133 241
422 3300047443 Ga0495687_000478 Ga0495687_000478_29188_29994 241
423 3300047470 Ga0495681_0000869 Ga0495681_0000869_18487_19293 241
424 3300047472 Ga0495686_0001164 Ga0495686_0001164_11534_12340 241
425 3300047673 Ga0495593_0146689 Ga0495593_0146689_274_1017 241
426 3300048088 Ga0495602_0112693 Ga0495602_0112693_38_781 241
427 3300048903 Ga0496100_0088828 Ga0496100_0088828_1243_1968 241
428 3300048919 Ga0496116_0082781 Ga0496116_0082781_25_750 241
429 3300048920 Ga0496117_0006474 Ga0496117_0006474_5948_6673 241
430 3300048922 Ga0496119_0003374 Ga0496119_0003374_11717_12442 241
431 3300048922 Ga0496119_0008838 Ga0496119_0008838_7177_7908 241
432 3300048922 Ga0496119_0019451 Ga0496119_0019451_2407_3213 241
433 3300048923 Ga0496120_0003022 Ga0496120_0003022_12814_13539 241
434 3300048923 Ga0496120_0038163 Ga0496120_0038163_1565_2371 241
435 3300048924 Ga0496121_0016319 Ga0496121_0016319_5939_6664 241
436 3300048924 Ga0496121_0016320 Ga0496121_0016320_1012_1737 241
437 3300048924 Ga0496121_0035625 Ga0496121_0035625_513_1319 241
438 3300048924 Ga0496121_0234992 Ga0496121_0234992_498_1226 241
439 3300048925 Ga0496122_0000960 Ga0496122_0000960_46089_46832 241
440 3300048925 Ga0496122_0003049 Ga0496122_0003049_16453_17184 241
441 3300048925 Ga0496122_0004420 Ga0496122_0004420_11294_12019 241
442 3300048925 Ga0496122_0103634 Ga0496122_0103634_740_1465 241
443 3300048926 Ga0496123_0000764 Ga0496123_0000764_5169_5912 241
444 3300048926 Ga0496123_0002513 Ga0496123_0002513_16483_17214 241
445 3300048926 Ga0496123_0004959 Ga0496123_0004959_5803_6528 241
446 3300048927 Ga0496124_0005589 Ga0496124_0005589_763_1488 241
447 3300048927 Ga0496124_0016905 Ga0496124_0016905_1794_2522 241
448 3300048927 Ga0496124_0060047 Ga0496124_0060047_1669_2394 241
449 3300048928 Ga0496125_0015172 Ga0496125_0015172_4190_4915 241
450 3300048928 Ga0496125_0044149 Ga0496125_0044149_2489_3295 241
451 3300048929 Ga0496126_0122333 Ga0496126_0122333_15_740 241
452 3300048929 Ga0496126_0388971 Ga0496126_0388971_301_1026 241
453 3300049459 Ga0495678_000635 Ga0495678_000635_15877_16683 241
454 3300049460 Ga0495682_0000331 Ga0495682_0000331_18466_19272 241
455 3300049572 Ga0501036_0113588 Ga0501036_0113588_1221_1952 241
456 3300049573 Ga0501037_0199244 Ga0501037_0199244_448_1179 241
457 3300049574 Ga0501038_0051247 Ga0501038_0051247_536_1267 241
458 3300049575 Ga0501039_0361060 Ga0501039_0361060_113_844 241
459 3300049579 Ga0501043_0232736 Ga0501043_0232736_133_864 241
460 3300049589 Ga0501073_0055068 Ga0501073_0055068_235_966 241
461 3300049590 Ga0501074_0369988 Ga0501074_0369988_188_919 241
462 3300049671 Ga0501238_009246 Ga0501238_009246_394_1122 241
463 3300049742 Ga0501080_0147935 Ga0501080_0147935_211_942 241
464 3300050496 nmdc:mga07m45_1121_c1 nmdc:mga07m45_1121_c1_6639_7445 241
465 3300053077 Ga0495601_0172827 Ga0495601_0172827_467_1210 241
466 3300053083 Ga0495655_0100339 Ga0495655_0100339_31_756 241
467 3300053086 Ga0500578_0001023 Ga0500578_0001023_18407_19213 241
468 3300053092 Ga0500583_0000368 Ga0500583_0000368_8682_9488 241
469 3300053094 Ga0500566_0200019 Ga0500566_0200019_132_860 241
470 3300053103 Ga0500555_002310 Ga0500555_002310_4374_5180 241
471 3300053111 Ga0500572_049403 Ga0500572_049403_447_1175 241
472 3300053111 Ga0500572_064446 Ga0500572_064446_266_991 241
473 3300053120 Ga0500597_011557 Ga0500597_011557_1438_2244 241
474 3300053122 Ga0500608_000822 Ga0500608_000822_7765_8571 241
475 3300053125 Ga0500618_000222 Ga0500618_000222_39635_40363 241
476 3300053125 Ga0500618_000668 Ga0500618_000668_4307_5113 241
477 3300053125 Ga0500618_001256 Ga0500618_001256_10749_11474 241
478 3300053136 Ga0500559_0067786 Ga0500559_0067786_159_965 241
479 3300053137 Ga0500561_0014908 Ga0500561_0014908_196_1002 241
480 3300053138 Ga0500564_000492 Ga0500564_000492_2720_3526 241
481 3300053141 Ga0500574_000181 Ga0500574_000181_1627_2433 241
482 3300053148 Ga0500590_000077 Ga0500590_000077_99_842 241
483 3300053157 Ga0500624_000211 Ga0500624_000211_5315_6121 241
484 3300053161 Ga0500634_0107875 Ga0500634_0107875_317_1123 241
485 3300053162 Ga0500638_000049 Ga0500638_000049_13924_14730 241
486 3300053177 Ga0500636_0000596 Ga0500636_0000596_10304_11110 241
487 3300053177 Ga0500636_0019410 Ga0500636_0019410_1665_2405 241
488 3300053177 Ga0500636_0149118 Ga0500636_0149118_532_1275 241
489 iso_pu_bacteria 8057575449 8057576551 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

38

148

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

188

264

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9834 9 126
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9784 9 126
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9782 9 126
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.976 9 126
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9752 9 126
ID Description Score Start End Superfamily
af_P38684_4_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.976 10 91 3.40.50.2300
af_P0AA16_3_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9752 8 88 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9712 10 85 3.40.50.2300
af_P0A9Q1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9701 10 91 3.40.50.2300
2qzjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9666 8 126 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A523CLE6-F1-model_v4 deleted 0.973 9 122
AF-A0A4R3JG41-F1-model_v4 Response regulator receiver domain-containing protein 0.9721 8 126 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A559TKX8-F1-model_v4 Two-component system phosphate regulon response regulator OmpR 0.9715 9 240 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A0P6YAV3-F1-model_v4 Fis family transcriptional regulator 0.9707 8 125 GO:0000160
GO:0005524
GO:0006355
GO:0043565
AF-G2H3C4-F1-model_v4 deleted 0.9701 9 122

Feature Viewer

pLDDT pTM Quality
84.26 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map