F453565

General Info

Members Datasets Scaffolds Average Seq Length
488 263 976 156

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100923388|Ga0068867_1009233881
Length 180
Sequence MAQRKNRSAGQLAARHTRKHRISEEWTMQFRISGLPAEPFQHLFALDDEALKRHGAVRRVAENSGYPCRVSLTDAKAGDEVILVNYEHQDADTPYRSRHAVYVRKGERRYDAVGEIPEQLRKRLLSVRAFDQSGMMVDADVIEGRLLEEMIGRFFANDAVAYIHLHFARPGCYAARVDRI

Samples

Sample ID Description Type Environment
1 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
159 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
160 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
178 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
179 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
180 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
181 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
182 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
239 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
240 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
241 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
242 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
243 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
244 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
245 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
246 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
247 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
248 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
249 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
250 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
251 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
252 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
253 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
254 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
255 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
256 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
257 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
258 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
259 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
260 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
261 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
262 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
263 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.56
Nodule 0
Rhizoplane 2.87
Rhizosphere 82.38
Stem 0
Stem Tuber 0
Unclassified 10.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068867_100923388 3300005459 Bacteria 787
2 rootH1_10111852 3300003323 Bacteria 2383
3 JGI25407J50210_10067077 3300003373 Bacteria 897
4 Ga0065712_10478970 3300005290 Bacteria 662
5 Ga0070658_10567945 3300005327 Bacteria 982
6 Ga0070676_10061368 3300005328 Bacteria 2235
7 Ga0070676_10066013 3300005328 Bacteria 2161
8 Ga0070690_100055670 3300005330 Unclassified 2534
9 Ga0070690_100627083 3300005330 Bacteria 819
10 Ga0070670_100192436 3300005331 Bacteria 1772
11 Ga0070670_100420791 3300005331 Bacteria 1181
12 Ga0070670_101533938 3300005331 Bacteria 612
13 Ga0068869_100031176 3300005334 Bacteria 3750
14 Ga0068869_100629143 3300005334 Unclassified 909
15 Ga0070680_100268913 3300005336 Bacteria 1443
16 Ga0068868_100022426 3300005338 Bacteria 4764
17 Ga0068868_100033513 3300005338 Bacteria 3959
18 Ga0068868_100164170 3300005338 Bacteria 1836
19 Ga0068868_100181976 3300005338 Bacteria 1744
20 Ga0068868_100475857 3300005338 Bacteria 1090
21 Ga0070689_100211658 3300005340 Bacteria 1587
22 Ga0070692_10323208 3300005345 Bacteria 949
23 Ga0070668_100153386 3300005347 Bacteria 1865
24 Ga0070669_100119483 3300005353 Bacteria 2009
25 Ga0070669_100352644 3300005353 Bacteria 1195
26 Ga0070675_100044312 3300005354 Bacteria 3638
27 Ga0070675_100178557 3300005354 Bacteria 1835
28 Ga0070671_100350138 3300005355 Unclassified 1261
29 Ga0070674_100032152 3300005356 Bacteria 3482
30 Ga0070674_100333191 3300005356 Bacteria 1220
31 Ga0070673_100050862 3300005364 Plasmid 3242
32 Ga0070673_100051174 3300005364 Bacteria 3233
33 Ga0070673_100064291 3300005364 Bacteria 2923
34 Ga0070688_100226162 3300005365 Bacteria 1321
35 Ga0070667_100000032 3300005367 Bacteria 176783
36 Ga0070667_100073370 3300005367 Bacteria 2918
37 Ga0070667_100117126 3300005367 Unclassified 2314
38 Ga0070667_100734195 3300005367 Bacteria 915
39 Ga0070667_100742552 3300005367 Bacteria 909
40 Ga0070667_101027834 3300005367 Bacteria 769
41 Ga0070709_10600896 3300005434 Bacteria 847
42 Ga0070713_100174519 3300005436 Bacteria 1927
43 Ga0070663_100000213 3300005455 Bacteria 29048
44 Ga0070663_100401867 3300005455 Bacteria 1120
45 Ga0070678_100006653 3300005456 Bacteria 6798
46 Ga0070678_100043768 3300005456 Bacteria 3192
47 Ga0070678_100286653 3300005456 Bacteria 1394
48 Ga0070662_100317216 3300005457 Bacteria 1270
49 Ga0070662_100413490 3300005457 Bacteria 1115
50 Ga0070662_100614783 3300005457 Bacteria 915
51 Ga0070681_10000214 3300005458 Bacteria 45234
52 Ga0070681_10558653 3300005458 Bacteria 1058
53 Ga0070681_10872058 3300005458 Bacteria 818
54 Ga0068867_100265298 3300005459 Bacteria 1401
55 Ga0068867_100916491 3300005459 Bacteria 790
56 Ga0070685_10188817 3300005466 Bacteria 1331
57 Ga0070706_100179062 3300005467 Bacteria 1979
58 Ga0070707_100189743 3300005468 Bacteria 2004
59 Ga0070679_100148632 3300005530 Bacteria 2320
60 Ga0070697_100024621 3300005536 Bacteria 4794
61 Ga0070697_100519927 3300005536 Bacteria 1042
62 Ga0068853_100004152 3300005539 Bacteria 11164
63 Ga0068853_100035155 3300005539 Bacteria 4255
64 Ga0068853_100061111 3300005539 Bacteria 3258
65 Ga0068853_100144911 3300005539 Bacteria 2134
66 Ga0068853_100932006 3300005539 Bacteria 835
67 Ga0068853_101001812 3300005539 Unclassified 804
68 Ga0070672_100167573 3300005543 Bacteria 1825
69 Ga0070672_101130080 3300005543 Unclassified 697
70 Ga0070696_100211528 3300005546 Bacteria 1452
71 Ga0070696_101439996 3300005546 Unclassified 588
72 Ga0070693_100030401 3300005547 Bacteria 2953
73 Ga0070665_100000913 3300005548 Bacteria 37936
74 Ga0070665_100051360 3300005548 Bacteria 4135
75 Ga0070665_100220954 3300005548 Bacteria 1895
76 Ga0070665_101672180 3300005548 Bacteria 644
77 Ga0068855_100481409 3300005563 Bacteria 1351
78 Ga0068855_101353435 3300005563 Bacteria 735
79 Ga0068857_100187558 3300005577 Bacteria 1883
80 Ga0068857_100558251 3300005577 Bacteria 1079
81 Ga0068856_100004710 3300005614 Bacteria 13543
82 Ga0068856_100191344 3300005614 Bacteria 2060
83 Ga0068856_100837769 3300005614 Bacteria 939
84 Ga0068856_100927978 3300005614 Bacteria 889
85 Ga0068852_100190984 3300005616 Bacteria 1932
86 Ga0068852_100257883 3300005616 Unclassified 1673
87 Ga0068852_100601319 3300005616 Bacteria 1104
88 Ga0068852_101102118 3300005616 Bacteria 814
89 Ga0068852_101208762 3300005616 Unclassified 777
90 Ga0068859_100673104 3300005617 Bacteria 1126
91 Ga0068859_101424814 3300005617 Bacteria 764
92 Ga0068864_100232732 3300005618 Bacteria 1705
93 Ga0068864_101369788 3300005618 Bacteria 709
94 Ga0068866_10101862 3300005718 Bacteria 1586
95 Ga0068866_10760177 3300005718 Bacteria 670
96 Ga0068861_100261859 3300005719 Bacteria 1481
97 Ga0068861_101036020 3300005719 Bacteria 785
98 Ga0068861_101394619 3300005719 Bacteria 684
99 Ga0068863_100027240 3300005841 Bacteria 5450
100 Ga0068863_100215936 3300005841 Bacteria 1847
101 Ga0068863_100442831 3300005841 Bacteria 1274
102 Ga0068863_100529986 3300005841 Unclassified 1162
103 Ga0068863_100789216 3300005841 Bacteria 947
104 Ga0068863_101597811 3300005841 Bacteria 661
105 Ga0068858_100247064 3300005842 Bacteria 1694
106 Ga0068860_101824258 3300005843 Unclassified 630
107 Ga0068862_100092422 3300005844 Bacteria 2637
108 Ga0068862_100191055 3300005844 Bacteria 1843
109 Ga0068862_100249684 3300005844 Bacteria 1616
110 Ga0068862_100276570 3300005844 Unclassified 1537
111 Ga0068862_100480489 3300005844 Bacteria 1176
112 Ga0081538_10022346 3300005981 Bacteria 4585
113 Ga0081539_10042844 3300005985 Bacteria 2631
114 Ga0070717_10555351 3300006028 Bacteria 1040
115 Ga0070715_10538236 3300006163 Bacteria 675
116 Ga0070716_100152784 3300006173 Bacteria 1487
117 Ga0097621_100004426 3300006237 Bacteria 9780
118 Ga0097621_100219724 3300006237 Bacteria 1655
119 Ga0097621_100933015 3300006237 Unclassified 810
120 Ga0068871_100114900 3300006358 Bacteria 2268
121 Ga0068871_100358330 3300006358 Unclassified 1291
122 Ga0068871_101614614 3300006358 Bacteria 614
123 Ga0075431_100480953 3300006847 Unclassified 1235
124 Ga0068865_100079398 3300006881 Bacteria 2350
125 Ga0097620_100673156 3300006931 Bacteria 1126
126 Ga0097620_101424456 3300006931 Bacteria 764
127 Ga0105240_10003915 3300009093 Bacteria 22992
128 Ga0105240_10138536 3300009093 Bacteria 2911
129 Ga0105240_10200940 3300009093 Bacteria 2336
130 Ga0105240_10361858 3300009093 Bacteria 1643
131 Ga0105240_11343473 3300009093 Bacteria 753
132 Ga0111539_10000919 3300009094 Bacteria 38463
133 Ga0111539_10738595 3300009094 Bacteria 1146
134 Ga0105245_10622423 3300009098 Bacteria 1108
135 Ga0105247_10307643 3300009101 Bacteria 1102
136 Ga0105247_10545532 3300009101 Bacteria 852
137 Ga0114129_10060898 3300009147 Bacteria 5276
138 Ga0105243_10053828 3300009148 Bacteria 3193
139 Ga0105243_10307810 3300009148 Bacteria 1438
140 Ga0105241_10107770 3300009174 Bacteria 2226
141 Ga0105241_10242314 3300009174 Unclassified 1525
142 Ga0105241_10681879 3300009174 Bacteria 936
143 Ga0105242_10038617 3300009176 Bacteria 3840
144 Ga0105242_10701246 3300009176 Bacteria 990
145 Ga0105242_11674521 3300009176 Bacteria 672
146 Ga0105248_10000143 3300009177 Bacteria 82037
147 Ga0105248_10001383 3300009177 Bacteria 27020
148 Ga0105248_10029753 3300009177 Bacteria 6095
149 Ga0105248_10340045 3300009177 Bacteria 1690
150 Ga0105237_10007897 3300009545 Bacteria 11593
151 Ga0105237_10413119 3300009545 Unclassified 1354
152 Ga0105237_10450735 3300009545 Bacteria 1292
153 Ga0105238_10018079 3300009551 Bacteria 7166
154 Ga0105238_10021208 3300009551 Bacteria 6622
155 Ga0105238_10079069 3300009551 Bacteria 3278
156 Ga0105249_10000211 3300009553 Bacteria 66931
157 Ga0105249_10144794 3300009553 Bacteria 2282
158 Ga0105028_112950 3300009993 Bacteria 882
159 Ga0105239_10000043 3300010375 Bacteria 196600
160 Ga0105239_10002821 3300010375 Bacteria 21733
161 Ga0105239_10069928 3300010375 Bacteria 3855
162 Ga0105239_10155405 3300010375 Bacteria 2554
163 Ga0157339_1015745 3300012505 Bacteria 749
164 Ga0157373_10099844 3300013100 Bacteria 2043
165 Ga0157373_10432082 3300013100 Bacteria 946
166 Ga0157370_10052563 3300013104 Bacteria 3889
167 Ga0157370_11871710 3300013104 Bacteria 538
168 Ga0157374_10046613 3300013296 Bacteria 4015
169 Ga0157374_10420036 3300013296 Bacteria 1336
170 Ga0157378_10000149 3300013297 Bacteria 65310
171 Ga0157378_10079338 3300013297 Bacteria 2963
172 Ga0157378_10802081 3300013297 Bacteria 967
173 Ga0163162_10012965 3300013306 Bacteria 8134
174 Ga0163162_10486535 3300013306 Bacteria 1365
175 Ga0163162_10633316 3300013306 Bacteria 1194
176 Ga0157372_10282015 3300013307 Bacteria 1931
177 Ga0157375_10012529 3300013308 Bacteria 7525
178 Ga0157375_10071610 3300013308 Bacteria 3481
179 Ga0157375_10165358 3300013308 Bacteria 2357
180 Ga0157375_11037457 3300013308 Bacteria 958
181 Ga0157375_11736195 3300013308 Unclassified 739
182 Ga0163163_10780147 3300014325 Bacteria 1019
183 Ga0163163_11287150 3300014325 Bacteria 793
184 Ga0163163_11462439 3300014325 Bacteria 745
185 Ga0157380_10116927 3300014326 Bacteria 2252
186 Ga0157380_11539064 3300014326 Bacteria 719
187 Ga0182008_10040485 3300014497 Bacteria 2327
188 Ga0157379_10074158 3300014968 Unclassified 3046
189 Ga0157379_10457431 3300014968 Unclassified 1179
190 Ga0157379_10888715 3300014968 Bacteria 845
191 Ga0157379_11400365 3300014968 Unclassified 678
192 Ga0157376_10002853 3300014969 Bacteria 11832
193 Ga0157376_10040328 3300014969 Bacteria 3815
194 Ga0157376_10241309 3300014969 Bacteria 1684
195 Ga0157376_10726941 3300014969 Bacteria 1000
196 Ga0157376_10967160 3300014969 Bacteria 872
197 Ga0157376_11603680 3300014969 Bacteria 685
198 Ga0213876_10392316 3300021384 Bacteria 738
199 Ga0209050_1022176 3300025298 Bacteria 2283
200 Ga0207697_10226487 3300025315 Unclassified 825
201 Ga0207656_10052211 3300025321 Bacteria 1770
202 Ga0207642_10082492 3300025899 Bacteria 1565
203 Ga0207680_10006870 3300025903 Bacteria 5520
204 Ga0207680_10398239 3300025903 Bacteria 973
205 Ga0207685_10231407 3300025905 Bacteria 884
206 Ga0207645_10056605 3300025907 Bacteria 2503
207 Ga0207645_10251027 3300025907 Bacteria 1170
208 Ga0207684_10759902 3300025910 Bacteria 821
209 Ga0207654_10279716 3300025911 Bacteria 1128
210 Ga0207707_10001377 3300025912 Bacteria 22554
211 Ga0207707_10660373 3300025912 Bacteria 881
212 Ga0207695_10000262 3300025913 Bacteria 133005
213 Ga0207695_10866261 3300025913 Bacteria 783
214 Ga0207695_11213055 3300025913 Bacteria 635
215 Ga0207671_10023530 3300025914 Bacteria 4645
216 Ga0207660_10919566 3300025917 Bacteria 714
217 Ga0207660_11000572 3300025917 Unclassified 682
218 Ga0207646_10951343 3300025922 Bacteria 761
219 Ga0207681_10142115 3300025923 Bacteria 1789
220 Ga0207681_10366289 3300025923 Bacteria 1157
221 Ga0207681_10899979 3300025923 Bacteria 741
222 Ga0207694_10000955 3300025924 Bacteria 25508
223 Ga0207694_10484076 3300025924 Bacteria 1035
224 Ga0207650_10161665 3300025925 Bacteria 1775
225 Ga0207650_10285986 3300025925 Bacteria 1343
226 Ga0207659_10021019 3300025926 Bacteria 4325
227 Ga0207659_10230292 3300025926 Bacteria 1494
228 Ga0207700_10439742 3300025928 Bacteria 1148
229 Ga0207644_10498692 3300025931 Bacteria 1004
230 Ga0207644_11757672 3300025931 Bacteria 519
231 Ga0207706_10318088 3300025933 Bacteria 1355
232 Ga0207706_10443312 3300025933 Bacteria 1124
233 Ga0207686_10041854 3300025934 Bacteria 2796
234 Ga0207709_10034245 3300025935 Bacteria 2992
235 Ga0207704_10019590 3300025938 Bacteria 3557
236 Ga0207704_10178311 3300025938 Bacteria 1532
237 Ga0207665_10233011 3300025939 Bacteria 1354
238 Ga0207691_10010042 3300025940 Bacteria 9083
239 Ga0207691_10041478 3300025940 Bacteria 4249
240 Ga0207711_10001415 3300025941 Bacteria 22473
241 Ga0207711_10383809 3300025941 Bacteria 1304
242 Ga0207689_10519318 3300025942 Bacteria 999
243 Ga0207667_10495110 3300025949 Bacteria 1240
244 Ga0207667_10673748 3300025949 Unclassified 1038
245 Ga0207667_11209816 3300025949 Bacteria 735
246 Ga0207651_10004018 3300025960 Bacteria 7319
247 Ga0207651_10067963 3300025960 Bacteria 2510
248 Ga0207712_10000294 3300025961 Bacteria 46986
249 Ga0207712_10178197 3300025961 Bacteria 1667
250 Ga0207712_10225945 3300025961 Bacteria 1499
251 Ga0207668_10644986 3300025972 Unclassified 926
252 Ga0207668_10889836 3300025972 Bacteria 792
253 Ga0207640_11068236 3300025981 Unclassified 713
254 Ga0207658_10000048 3300025986 Bacteria 130723
255 Ga0207658_10069826 3300025986 Bacteria 2656
256 Ga0207658_10512103 3300025986 Bacteria 1070
257 Ga0207658_10888398 3300025986 Bacteria 811
258 Ga0207677_10121194 3300026023 Bacteria 1968
259 Ga0207677_10258040 3300026023 Bacteria 1419
260 Ga0207677_10458033 3300026023 Unclassified 1094
261 Ga0207677_10918549 3300026023 Bacteria 790
262 Ga0207703_10339345 3300026035 Bacteria 1380
263 Ga0207639_10010652 3300026041 Bacteria 6367
264 Ga0207639_10020224 3300026041 Bacteria 4761
265 Ga0207639_10045353 3300026041 Bacteria 3310
266 Ga0207639_10100813 3300026041 Bacteria 2333
267 Ga0207639_10152255 3300026041 Bacteria 1938
268 Ga0207639_10498512 3300026041 Bacteria 1112
269 Ga0207639_10666076 3300026041 Bacteria 964
270 Ga0207639_11313909 3300026041 Unclassified 679
271 Ga0207678_10000877 3300026067 Bacteria 27644
272 Ga0207678_10133336 3300026067 Bacteria 2119
273 Ga0207702_10015796 3300026078 Bacteria 6251
274 Ga0207702_10071193 3300026078 Bacteria 2993
275 Ga0207702_10822128 3300026078 Bacteria 919
276 Ga0207641_10022887 3300026088 Bacteria 5147
277 Ga0207641_10088344 3300026088 Bacteria 2706
278 Ga0207641_10170880 3300026088 Bacteria 1984
279 Ga0207648_10007577 3300026089 Bacteria 10647
280 Ga0207648_10439953 3300026089 Unclassified 1186
281 Ga0207676_10085737 3300026095 Bacteria 2571
282 Ga0207676_10190683 3300026095 Bacteria 1803
283 Ga0207676_10412461 3300026095 Bacteria 1265
284 Ga0207674_10363847 3300026116 Bacteria 1398
285 Ga0207674_10591341 3300026116 Bacteria 1072
286 Ga0207674_11408059 3300026116 Bacteria 666
287 Ga0207675_100258333 3300026118 Unclassified 1687
288 Ga0207675_100321314 3300026118 Bacteria 1511
289 Ga0207675_101017952 3300026118 Bacteria 847
290 Ga0207683_10014182 3300026121 Bacteria 6790
291 Ga0207683_10063452 3300026121 Bacteria 3254
292 Ga0207698_10121272 3300026142 Bacteria 2214
293 Ga0207698_10412645 3300026142 Bacteria 1294
294 Ga0207698_10472461 3300026142 Bacteria 1215
295 Ga0207698_10548772 3300026142 Bacteria 1132
296 Ga0207698_10713225 3300026142 Bacteria 999
297 Ga0209974_10034000 3300027876 Bacteria 1693
298 Ga0207428_10000152 3300027907 Bacteria 94307
299 Ga0268266_10000346 3300028379 Bacteria 72336
300 Ga0268266_10021559 3300028379 Bacteria 5488
301 Ga0268266_10870421 3300028379 Bacteria 871
302 Ga0268265_10259797 3300028380 Bacteria 1543
303 Ga0268265_10275036 3300028380 Unclassified 1504
304 Ga0268265_10417491 3300028380 Bacteria 1245
305 Ga0307515_10024653 3300028794 Bacteria 10465
306 Ga0307515_10124395 3300028794 Bacteria 2894
307 Ga0307515_10397496 3300028794 Bacteria 1005
308 Ga0265332_10208742 3300031238 Bacteria 811
309 Ga0307513_10017695 3300031456 Bacteria 8537
310 Ga0307509_10280107 3300031507 Unclassified 1429
311 Ga0307408_100109956 3300031548 Bacteria 2115
312 Ga0307408_100267917 3300031548 Bacteria 1417
313 Ga0307408_101126487 3300031548 Unclassified 729
314 Ga0307508_10155802 3300031616 Bacteria 1888
315 Ga0307508_10381150 3300031616 Bacteria 1001
316 Ga0307514_10366282 3300031649 Unclassified 758
317 Ga0307405_10107624 3300031731 Bacteria 1882
318 Ga0307405_10248693 3300031731 Bacteria 1322
319 Ga0307413_10100473 3300031824 Bacteria 1910
320 Ga0307413_10705950 3300031824 Unclassified 838
321 Ga0307413_11078621 3300031824 Bacteria 692
322 Ga0307410_10030631 3300031852 Bacteria 3441
323 Ga0307410_10124327 3300031852 Bacteria 1886
324 Ga0307410_10337911 3300031852 Bacteria 1199
325 Ga0307406_10170286 3300031901 Bacteria 1575
326 Ga0307406_11216130 3300031901 Bacteria 655
327 Ga0307406_11745394 3300031901 Bacteria 552
328 Ga0307407_10289455 3300031903 Bacteria 1138
329 Ga0307412_10000165 3300031911 Bacteria 46841
330 Ga0307412_10074993 3300031911 Bacteria 2319
331 Ga0307409_100057963 3300031995 Bacteria 3005
332 Ga0307409_100201380 3300031995 Bacteria 1781
333 Ga0307409_100672798 3300031995 Bacteria 1031
334 Ga0307409_101377655 3300031995 Bacteria 731
335 Ga0307416_100254585 3300032002 Bacteria 1711
336 Ga0307416_100608112 3300032002 Bacteria 1174
337 Ga0307416_100710799 3300032002 Bacteria 1095
338 Ga0307416_100995376 3300032002 Bacteria 941
339 Ga0307414_10008709 3300032004 Bacteria 5780
340 Ga0307414_10021024 3300032004 Bacteria 4083
341 Ga0307414_10832228 3300032004 Unclassified 843
342 Ga0307411_10124949 3300032005 Bacteria 1869
343 Ga0307411_10319880 3300032005 Bacteria 1252
344 Ga0307415_100051728 3300032126 Bacteria 2789
345 Ga0307415_100108795 3300032126 Bacteria 2052
346 Ga0307415_100195233 3300032126 Bacteria 1601
347 Ga0307415_100213703 3300032126 Bacteria 1541
348 Ga0307415_100617403 3300032126 Bacteria 967
349 Ga0307507_10061861 3300033179 Bacteria 3483
350 Ga0307510_10005987 3300033180 Bacteria 14512
351 Ga0373950_0007733 3300034818 Bacteria 1674
352 Ga0373958_0032598 3300034819 Bacteria 1030
353 Ga0373959_0014526 3300034820 Bacteria 1434
354 Ga0373940_0006463 3300035088 Bacteria 2601
355 Ga0373936_0278480 3300035113 Bacteria 751
356 Ga0373939_0000130 3300035114 Bacteria 22040
357 Ga0373954_0142658 3300035118 Bacteria 1169
358 Ga0373960_0007530 3300035121 Bacteria 2583
359 Ga0373955_0095308 3300035172 Bacteria 1702
360 Ga0373924_0007294 3300035410 Bacteria 3987
361 Ga0373931_0000077 3300035691 Bacteria 45225
362 Ga0373937_0183526 3300036401 Bacteria 1965
363 Ga0373925_0213998 3300037068 Bacteria 1536
364 Ga0395899_0025329 3300037312 Bacteria 4478
365 Ga0395899_0144436 3300037312 Bacteria 1691
366 Ga0395899_0156132 3300037312 Bacteria 1614
367 Ga0395905_0980609 3300037471 Unclassified 748
368 Ga0395901_0226458 3300038443 Bacteria 1953
369 Ga0395901_1683761 3300038443 Unclassified 586
370 Ga0436365_0074457 3300039437 Bacteria 2937
371 Ga0436365_0192200 3300039437 Bacteria 7182
372 Ga0436360_0501028 3300039438 Bacteria 1562
373 Ga0436363_0831129 3300039450 Bacteria 1004
374 Ga0436362_1302790 3300039453 Bacteria 824
375 Ga0439465_0166432 3300041413 Bacteria 793
376 Ga0451789_1193788 3300041443 Unclassified 635
377 Ga0450889_007247 3300042144 Bacteria 1119
378 Ga0450906_035104 3300042145 Unclassified 885
379 Ga0439446_0002164 3300042156 Bacteria 4673
380 Ga0451577_0754989 3300042876 Bacteria 880
381 Ga0466963_0236105 3300044694 Bacteria 1282
382 Ga0466959_0928012 3300045049 Unclassified 580
383 Ga0495617_051973 3300046452 Bacteria 1362
384 Ga0495638_0171384 3300046460 Bacteria 1245
385 Ga0495580_0145749 3300046472 Bacteria 1641
386 Ga0495580_0975980 3300046472 Bacteria 541
387 Ga0495583_0009610 3300046506 Bacteria 5760
388 Ga0495668_0108362 3300046616 Bacteria 1519
389 Ga0495625_0015013 3300046660 Bacteria 6154
390 Ga0495657_0228172 3300046675 Bacteria 1127
391 Ga0495671_0032224 3300046692 Bacteria 2676
392 Ga0495671_0062691 3300046692 Bacteria 1832
393 Ga0495604_0771829 3300047317 Bacteria 607
394 Ga0495680_1033976 3300047322 Bacteria 523
395 Ga0495677_0089479 3300047445 Bacteria 1159
396 Ga0495673_0020861 3300047469 Bacteria 3251
397 Ga0495686_0008022 3300047472 Bacteria 7826
398 Ga0495686_0211812 3300047472 Bacteria 1107
399 Ga0496101_0503688 3300048904 Bacteria 957
400 Ga0496102_0147062 3300048905 Bacteria 2212
401 Ga0496103_0008009 3300048906 Bacteria 6276
402 Ga0496104_0046637 3300048907 Bacteria 4081
403 Ga0496105_0025849 3300048908 Bacteria 4782
404 Ga0496108_0065763 3300048911 Bacteria 3056
405 Ga0496108_0503069 3300048911 Bacteria 1058
406 Ga0496109_0121809 3300048912 Unclassified 2430
407 Ga0496110_0005337 3300048913 Bacteria 10064
408 Ga0496111_0002702 3300048914 Bacteria 10773
409 Ga0496113_1018448 3300048916 Unclassified 652
410 Ga0496115_0000002 3300048918 Bacteria 365286
411 Ga0496116_0026334 3300048919 Bacteria 4257
412 Ga0496117_0009592 3300048920 Bacteria 8967
413 Ga0496117_0068688 3300048920 Bacteria 2391
414 Ga0496117_0071564 3300048920 Bacteria 2323
415 Ga0496117_0084659 3300048920 Bacteria 2067
416 Ga0496117_0102679 3300048920 Bacteria 1804
417 Ga0496118_0002276 3300048921 Bacteria 26195
418 Ga0496118_0002606 3300048921 Bacteria 23966
419 Ga0496118_0017058 3300048921 Bacteria 6630
420 Ga0496118_0090694 3300048921 Bacteria 2105
421 Ga0496118_0132183 3300048921 Bacteria 1600
422 Ga0496119_0002941 3300048922 Bacteria 18125
423 Ga0496120_0000386 3300048923 Bacteria 71308
424 Ga0496120_0025835 3300048923 Bacteria 3640
425 Ga0496121_0000341 3300048924 Bacteria 97289
426 Ga0496121_0228196 3300048924 Bacteria 1306
427 Ga0496121_0349408 3300048924 Bacteria 985
428 Ga0496122_0000142 3300048925 Bacteria 168391
429 Ga0496123_0000148 3300048926 Bacteria 143265
430 Ga0496124_0002918 3300048927 Bacteria 21559
431 Ga0496126_0000052 3300048929 Bacteria 312383
432 Ga0496126_0036945 3300048929 Bacteria 4563
433 Ga0496126_0150664 3300048929 Bacteria 1994
434 Ga0501032_0002697 3300049569 Bacteria 13842
435 Ga0501034_1450686 3300049571 Unclassified 561
436 Ga0501036_1384580 3300049572 Unclassified 570
437 Ga0501038_0271943 3300049574 Bacteria 1336
438 Ga0501041_0179520 3300049577 Bacteria 1325
439 Ga0501043_0106588 3300049579 Bacteria 2201
440 Ga0501067_0001111 3300049583 Bacteria 14540
441 Ga0501068_0001818 3300049584 Bacteria 11329
442 Ga0501070_0488609 3300049586 Unclassified 990
443 Ga0501070_1068235 3300049586 Bacteria 624
444 Ga0501073_0000068 3300049589 Bacteria 63524
445 Ga0501077_0002761 3300049593 Bacteria 10524
446 Ga0501077_0076306 3300049593 Bacteria 2123
447 Ga0501080_0003510 3300049742 Bacteria 13808
448 Ga0501080_0747729 3300049742 Bacteria 860
449 Ga0501083_0172337 3300049744 Bacteria 1414
450 Ga0501044_0003871 3300049823 Bacteria 16772
451 nmdc:mga0yw44_215854_c1 3300050492 Bacteria 1270
452 nmdc:mga06r32_1181014_c1 3300050510 Unclassified 712
453 nmdc:mga08y16_238636_c1 3300050511 Bacteria 1879
454 nmdc:mga08y16_54_c1 3300050511 Bacteria 102957
455 Ga0500643_000359 3300053087 Bacteria 36206
456 Ga0500643_001023 3300053087 Bacteria 17009
457 Ga0500643_006933 3300053087 Bacteria 4655
458 Ga0500643_023074 3300053087 Bacteria 1993
459 Ga0500643_030934 3300053087 Bacteria 1636
460 Ga0500644_0000645 3300053088 Bacteria 12936
461 Ga0500647_0103819 3300053091 Bacteria 1356
462 Ga0500583_0110154 3300053092 Bacteria 1355
463 Ga0500651_0437738 3300053093 Unclassified 729
464 Ga0500566_0056632 3300053094 Bacteria 2228
465 Ga0500640_007658 3300053095 Bacteria 4221
466 Ga0500554_002894 3300053102 Bacteria 3435
467 Ga0500555_050002 3300053103 Unclassified 1145
468 Ga0500556_0063642 3300053104 Bacteria 1364
469 Ga0500572_001968 3300053111 Bacteria 5152
470 Ga0500595_003578 3300053119 Bacteria 7220
471 Ga0500595_015211 3300053119 Bacteria 2893
472 Ga0500595_016972 3300053119 Bacteria 2701
473 Ga0500597_001865 3300053120 Bacteria 5596
474 Ga0500607_249375 3300053121 Bacteria 708
475 Ga0500614_000142 3300053123 Bacteria 17834
476 Ga0500617_096199 3300053124 Bacteria 1259
477 Ga0500652_113279 3300053131 Bacteria 1134
478 Ga0500559_0128999 3300053136 Bacteria 1180
479 Ga0500564_177322 3300053138 Bacteria 891
480 Ga0500588_0013215 3300053146 Bacteria 2067
481 Ga0500588_0325964 3300053146 Bacteria 582
482 Ga0500636_0355073 3300053177 Bacteria 698
483 Ga0500645_038371 3300053730 Bacteria 1422
484 Ga0500656_005707 3300053732 Unclassified 1240
485 2585149993 2582581279 Bacteria 4980720
486 2600225803 2599185359 Bacteria 4772316
487 2819716397 2818991466 Bacteria 4748179
488 2928970351 2928968154 Bacteria 4633371
489 Ga0068867_100923388
490 rootH1_10111852
491 JGI25407J50210_10067077
492 Ga0065712_10478970
493 Ga0070658_10567945
494 Ga0070676_10061368
495 Ga0070676_10066013
496 Ga0070690_100055670
497 Ga0070690_100627083
498 Ga0070670_100192436
499 Ga0070670_100420791
500 Ga0070670_101533938
501 Ga0068869_100031176
502 Ga0068869_100629143
503 Ga0070680_100268913
504 Ga0068868_100022426
505 Ga0068868_100033513
506 Ga0068868_100164170
507 Ga0068868_100181976
508 Ga0068868_100475857
509 Ga0070689_100211658
510 Ga0070692_10323208
511 Ga0070668_100153386
512 Ga0070669_100119483
513 Ga0070669_100352644
514 Ga0070675_100044312
515 Ga0070675_100178557
516 Ga0070671_100350138
517 Ga0070674_100032152
518 Ga0070674_100333191
519 Ga0070673_100050862
520 Ga0070673_100051174
521 Ga0070673_100064291
522 Ga0070688_100226162
523 Ga0070667_100000032
524 Ga0070667_100073370
525 Ga0070667_100117126
526 Ga0070667_100734195
527 Ga0070667_100742552
528 Ga0070667_101027834
529 Ga0070709_10600896
530 Ga0070713_100174519
531 Ga0070663_100000213
532 Ga0070663_100401867
533 Ga0070678_100006653
534 Ga0070678_100043768
535 Ga0070678_100286653
536 Ga0070662_100317216
537 Ga0070662_100413490
538 Ga0070662_100614783
539 Ga0070681_10000214
540 Ga0070681_10558653
541 Ga0070681_10872058
542 Ga0068867_100265298
543 Ga0068867_100916491
544 Ga0070685_10188817
545 Ga0070706_100179062
546 Ga0070707_100189743
547 Ga0070679_100148632
548 Ga0070697_100024621
549 Ga0070697_100519927
550 Ga0068853_100004152
551 Ga0068853_100035155
552 Ga0068853_100061111
553 Ga0068853_100144911
554 Ga0068853_100932006
555 Ga0068853_101001812
556 Ga0070672_100167573
557 Ga0070672_101130080
558 Ga0070696_100211528
559 Ga0070696_101439996
560 Ga0070693_100030401
561 Ga0070665_100000913
562 Ga0070665_100051360
563 Ga0070665_100220954
564 Ga0070665_101672180
565 Ga0068855_100481409
566 Ga0068855_101353435
567 Ga0068857_100187558
568 Ga0068857_100558251
569 Ga0068856_100004710
570 Ga0068856_100191344
571 Ga0068856_100837769
572 Ga0068856_100927978
573 Ga0068852_100190984
574 Ga0068852_100257883
575 Ga0068852_100601319
576 Ga0068852_101102118
577 Ga0068852_101208762
578 Ga0068859_100673104
579 Ga0068859_101424814
580 Ga0068864_100232732
581 Ga0068864_101369788
582 Ga0068866_10101862
583 Ga0068866_10760177
584 Ga0068861_100261859
585 Ga0068861_101036020
586 Ga0068861_101394619
587 Ga0068863_100027240
588 Ga0068863_100215936
589 Ga0068863_100442831
590 Ga0068863_100529986
591 Ga0068863_100789216
592 Ga0068863_101597811
593 Ga0068858_100247064
594 Ga0068860_101824258
595 Ga0068862_100092422
596 Ga0068862_100191055
597 Ga0068862_100249684
598 Ga0068862_100276570
599 Ga0068862_100480489
600 Ga0081538_10022346
601 Ga0081539_10042844
602 Ga0070717_10555351
603 Ga0070715_10538236
604 Ga0070716_100152784
605 Ga0097621_100004426
606 Ga0097621_100219724
607 Ga0097621_100933015
608 Ga0068871_100114900
609 Ga0068871_100358330
610 Ga0068871_101614614
611 Ga0075431_100480953
612 Ga0068865_100079398
613 Ga0097620_100673156
614 Ga0097620_101424456
615 Ga0105240_10003915
616 Ga0105240_10138536
617 Ga0105240_10200940
618 Ga0105240_10361858
619 Ga0105240_11343473
620 Ga0111539_10000919
621 Ga0111539_10738595
622 Ga0105245_10622423
623 Ga0105247_10307643
624 Ga0105247_10545532
625 Ga0114129_10060898
626 Ga0105243_10053828
627 Ga0105243_10307810
628 Ga0105241_10107770
629 Ga0105241_10242314
630 Ga0105241_10681879
631 Ga0105242_10038617
632 Ga0105242_10701246
633 Ga0105242_11674521
634 Ga0105248_10000143
635 Ga0105248_10001383
636 Ga0105248_10029753
637 Ga0105248_10340045
638 Ga0105237_10007897
639 Ga0105237_10413119
640 Ga0105237_10450735
641 Ga0105238_10018079
642 Ga0105238_10021208
643 Ga0105238_10079069
644 Ga0105249_10000211
645 Ga0105249_10144794
646 Ga0105028_112950
647 Ga0105239_10000043
648 Ga0105239_10002821
649 Ga0105239_10069928
650 Ga0105239_10155405
651 Ga0157339_1015745
652 Ga0157373_10099844
653 Ga0157373_10432082
654 Ga0157370_10052563
655 Ga0157370_11871710
656 Ga0157374_10046613
657 Ga0157374_10420036
658 Ga0157378_10000149
659 Ga0157378_10079338
660 Ga0157378_10802081
661 Ga0163162_10012965
662 Ga0163162_10486535
663 Ga0163162_10633316
664 Ga0157372_10282015
665 Ga0157375_10012529
666 Ga0157375_10071610
667 Ga0157375_10165358
668 Ga0157375_11037457
669 Ga0157375_11736195
670 Ga0163163_10780147
671 Ga0163163_11287150
672 Ga0163163_11462439
673 Ga0157380_10116927
674 Ga0157380_11539064
675 Ga0182008_10040485
676 Ga0157379_10074158
677 Ga0157379_10457431
678 Ga0157379_10888715
679 Ga0157379_11400365
680 Ga0157376_10002853
681 Ga0157376_10040328
682 Ga0157376_10241309
683 Ga0157376_10726941
684 Ga0157376_10967160
685 Ga0157376_11603680
686 Ga0213876_10392316
687 Ga0209050_1022176
688 Ga0207697_10226487
689 Ga0207656_10052211
690 Ga0207642_10082492
691 Ga0207680_10006870
692 Ga0207680_10398239
693 Ga0207685_10231407
694 Ga0207645_10056605
695 Ga0207645_10251027
696 Ga0207684_10759902
697 Ga0207654_10279716
698 Ga0207707_10001377
699 Ga0207707_10660373
700 Ga0207695_10000262
701 Ga0207695_10866261
702 Ga0207695_11213055
703 Ga0207671_10023530
704 Ga0207660_10919566
705 Ga0207660_11000572
706 Ga0207646_10951343
707 Ga0207681_10142115
708 Ga0207681_10366289
709 Ga0207681_10899979
710 Ga0207694_10000955
711 Ga0207694_10484076
712 Ga0207650_10161665
713 Ga0207650_10285986
714 Ga0207659_10021019
715 Ga0207659_10230292
716 Ga0207700_10439742
717 Ga0207644_10498692
718 Ga0207644_11757672
719 Ga0207706_10318088
720 Ga0207706_10443312
721 Ga0207686_10041854
722 Ga0207709_10034245
723 Ga0207704_10019590
724 Ga0207704_10178311
725 Ga0207665_10233011
726 Ga0207691_10010042
727 Ga0207691_10041478
728 Ga0207711_10001415
729 Ga0207711_10383809
730 Ga0207689_10519318
731 Ga0207667_10495110
732 Ga0207667_10673748
733 Ga0207667_11209816
734 Ga0207651_10004018
735 Ga0207651_10067963
736 Ga0207712_10000294
737 Ga0207712_10178197
738 Ga0207712_10225945
739 Ga0207668_10644986
740 Ga0207668_10889836
741 Ga0207640_11068236
742 Ga0207658_10000048
743 Ga0207658_10069826
744 Ga0207658_10512103
745 Ga0207658_10888398
746 Ga0207677_10121194
747 Ga0207677_10258040
748 Ga0207677_10458033
749 Ga0207677_10918549
750 Ga0207703_10339345
751 Ga0207639_10010652
752 Ga0207639_10020224
753 Ga0207639_10045353
754 Ga0207639_10100813
755 Ga0207639_10152255
756 Ga0207639_10498512
757 Ga0207639_10666076
758 Ga0207639_11313909
759 Ga0207678_10000877
760 Ga0207678_10133336
761 Ga0207702_10015796
762 Ga0207702_10071193
763 Ga0207702_10822128
764 Ga0207641_10022887
765 Ga0207641_10088344
766 Ga0207641_10170880
767 Ga0207648_10007577
768 Ga0207648_10439953
769 Ga0207676_10085737
770 Ga0207676_10190683
771 Ga0207676_10412461
772 Ga0207674_10363847
773 Ga0207674_10591341
774 Ga0207674_11408059
775 Ga0207675_100258333
776 Ga0207675_100321314
777 Ga0207675_101017952
778 Ga0207683_10014182
779 Ga0207683_10063452
780 Ga0207698_10121272
781 Ga0207698_10412645
782 Ga0207698_10472461
783 Ga0207698_10548772
784 Ga0207698_10713225
785 Ga0209974_10034000
786 Ga0207428_10000152
787 Ga0268266_10000346
788 Ga0268266_10021559
789 Ga0268266_10870421
790 Ga0268265_10259797
791 Ga0268265_10275036
792 Ga0268265_10417491
793 Ga0307515_10024653
794 Ga0307515_10124395
795 Ga0307515_10397496
796 Ga0265332_10208742
797 Ga0307513_10017695
798 Ga0307509_10280107
799 Ga0307408_100109956
800 Ga0307408_100267917
801 Ga0307408_101126487
802 Ga0307508_10155802
803 Ga0307508_10381150
804 Ga0307514_10366282
805 Ga0307405_10107624
806 Ga0307405_10248693
807 Ga0307413_10100473
808 Ga0307413_10705950
809 Ga0307413_11078621
810 Ga0307410_10030631
811 Ga0307410_10124327
812 Ga0307410_10337911
813 Ga0307406_10170286
814 Ga0307406_11216130
815 Ga0307406_11745394
816 Ga0307407_10289455
817 Ga0307412_10000165
818 Ga0307412_10074993
819 Ga0307409_100057963
820 Ga0307409_100201380
821 Ga0307409_100672798
822 Ga0307409_101377655
823 Ga0307416_100254585
824 Ga0307416_100608112
825 Ga0307416_100710799
826 Ga0307416_100995376
827 Ga0307414_10008709
828 Ga0307414_10021024
829 Ga0307414_10832228
830 Ga0307411_10124949
831 Ga0307411_10319880
832 Ga0307415_100051728
833 Ga0307415_100108795
834 Ga0307415_100195233
835 Ga0307415_100213703
836 Ga0307415_100617403
837 Ga0307507_10061861
838 Ga0307510_10005987
839 Ga0373950_0007733
840 Ga0373958_0032598
841 Ga0373959_0014526
842 Ga0373940_0006463
843 Ga0373936_0278480
844 Ga0373939_0000130
845 Ga0373954_0142658
846 Ga0373960_0007530
847 Ga0373955_0095308
848 Ga0373924_0007294
849 Ga0373931_0000077
850 Ga0373937_0183526
851 Ga0373925_0213998
852 Ga0395899_0025329
853 Ga0395899_0144436
854 Ga0395899_0156132
855 Ga0395905_0980609
856 Ga0395901_0226458
857 Ga0395901_1683761
858 Ga0436365_0074457
859 Ga0436365_0192200
860 Ga0436360_0501028
861 Ga0436363_0831129
862 Ga0436362_1302790
863 Ga0439465_0166432
864 Ga0451789_1193788
865 Ga0450889_007247
866 Ga0450906_035104
867 Ga0439446_0002164
868 Ga0451577_0754989
869 Ga0466963_0236105
870 Ga0466959_0928012
871 Ga0495617_051973
872 Ga0495638_0171384
873 Ga0495580_0145749
874 Ga0495580_0975980
875 Ga0495583_0009610
876 Ga0495668_0108362
877 Ga0495625_0015013
878 Ga0495657_0228172
879 Ga0495671_0032224
880 Ga0495671_0062691
881 Ga0495604_0771829
882 Ga0495680_1033976
883 Ga0495677_0089479
884 Ga0495673_0020861
885 Ga0495686_0008022
886 Ga0495686_0211812
887 Ga0496101_0503688
888 Ga0496102_0147062
889 Ga0496103_0008009
890 Ga0496104_0046637
891 Ga0496105_0025849
892 Ga0496108_0065763
893 Ga0496108_0503069
894 Ga0496109_0121809
895 Ga0496110_0005337
896 Ga0496111_0002702
897 Ga0496113_1018448
898 Ga0496115_0000002
899 Ga0496116_0026334
900 Ga0496117_0009592
901 Ga0496117_0068688
902 Ga0496117_0071564
903 Ga0496117_0084659
904 Ga0496117_0102679
905 Ga0496118_0002276
906 Ga0496118_0002606
907 Ga0496118_0017058
908 Ga0496118_0090694
909 Ga0496118_0132183
910 Ga0496119_0002941
911 Ga0496120_0000386
912 Ga0496120_0025835
913 Ga0496121_0000341
914 Ga0496121_0228196
915 Ga0496121_0349408
916 Ga0496122_0000142
917 Ga0496123_0000148
918 Ga0496124_0002918
919 Ga0496126_0000052
920 Ga0496126_0036945
921 Ga0496126_0150664
922 Ga0501032_0002697
923 Ga0501034_1450686
924 Ga0501036_1384580
925 Ga0501038_0271943
926 Ga0501041_0179520
927 Ga0501043_0106588
928 Ga0501067_0001111
929 Ga0501068_0001818
930 Ga0501070_0488609
931 Ga0501070_1068235
932 Ga0501073_0000068
933 Ga0501077_0002761
934 Ga0501077_0076306
935 Ga0501080_0003510
936 Ga0501080_0747729
937 Ga0501083_0172337
938 Ga0501044_0003871
939 nmdc:mga0yw44_215854_c1
940 nmdc:mga06r32_1181014_c1
941 nmdc:mga08y16_238636_c1
942 nmdc:mga08y16_54_c1
943 Ga0500643_000359
944 Ga0500643_001023
945 Ga0500643_006933
946 Ga0500643_023074
947 Ga0500643_030934
948 Ga0500644_0000645
949 Ga0500647_0103819
950 Ga0500583_0110154
951 Ga0500651_0437738
952 Ga0500566_0056632
953 Ga0500640_007658
954 Ga0500554_002894
955 Ga0500555_050002
956 Ga0500556_0063642
957 Ga0500572_001968
958 Ga0500595_003578
959 Ga0500595_015211
960 Ga0500595_016972
961 Ga0500597_001865
962 Ga0500607_249375
963 Ga0500614_000142
964 Ga0500617_096199
965 Ga0500652_113279
966 Ga0500559_0128999
967 Ga0500564_177322
968 Ga0500588_0013215
969 Ga0500588_0325964
970 Ga0500636_0355073
971 Ga0500645_038371
972 Ga0500656_005707
973 2585149993
974 2600225803
975 2819716397
976 2928970351

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06718

DUF1203

Protein of unknown function (DUF1203)

65

179

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h25-assembly1.cif.gz_A crystal structure of the catalytic domain of primase repb' in complex with initiator dna 0.6241 98 145
1uw0-assembly1.cif.gz_A solution structure of the zinc-finger domain from dna ligase iiia 0.6111 29 78
3h20-assembly1.cif.gz_A crystal structure of primase repb' 0.6018 98 146
7sjy-assembly2.cif.gz_B crystal structure of clostridium thermocellum rsgi9 s1c-ntf2 bi-domain 0.5687 95 154
2w97-assembly1.cif.gz_B crystal structure of eif4e bound to glycerol and eif4g1 peptide 0.4878 98 143
ID Description Score Start End Superfamily
af_Q4E4N3_21_114_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.6591 29 78 3.30.1740.10
af_Q8I4S6_53_187_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.6472 29 78 3.30.1740.10
af_O44511_12_210_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6376 95 117 1.20.140.150
af_Q54XI2_1_101_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.6369 29 78 3.30.1740.10
4iwyA02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.6228 95 154 3.30.1490.20
ID Description Score Start End GO Terms
AF-A0A4R5W2L9-F1-model_v4 DUF1203 domain-containing protein 0.9855 1 155
AF-A0A4R6FQ83-F1-model_v4 Uncharacterized protein DUF1203 0.9804 1 155
AF-A0A1H8GUM3-F1-model_v4 DUF1203 domain-containing protein 0.9801 1 155
AF-A0A5P9JX99-F1-model_v4 DUF1203 domain-containing protein 0.9797 1 155
AF-A0A1H0NH09-F1-model_v4 deleted 0.9796 1 155

Map