F453544
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 488 | 248 | 488 | 161 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10510494|Ga0070658_105104941 |
| Length | 165 |
| Sequence | MSKVAIYAGTFDPITRGHQDLIERSLTFCDRLVVAVASNSSKAPLFSADERVALVREVVGNDPRVEVRMLKGQLLVDFARDVGATLLIRGLRAVSDFEYEFQMALMNRHLAPIETVFMVPSLDTTYISSSIVREVARYGGRVDDLLHPSVAAALRRKMDERPKPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 54 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 78 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 120 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 121 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 122 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 123 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 124 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 125 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 126 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 129 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 130 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 131 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 132 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 134 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 136 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 137 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 138 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 139 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 140 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 144 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 145 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 146 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 147 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 148 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 149 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 150 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 151 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 152 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 153 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 154 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 155 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 156 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 157 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 158 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 159 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 160 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 187 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 188 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 189 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 190 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 191 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 192 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 195 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 196 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 197 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 198 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 199 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 200 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 224 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 225 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 226 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 227 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 228 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 233 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 234 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 235 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 247 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.53 |
| Rhizosphere | 93.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10072244 | 3300005293 | Bacteria | 596 |
| 2 | Ga0065707_10585356 | 3300005295 | Bacteria | 699 |
| 3 | Ga0070658_10510494 | 3300005327 | Bacteria | 1039 |
| 4 | Ga0070683_100058762 | 3300005329 | Bacteria | 3572 |
| 5 | Ga0070683_100339704 | 3300005329 | Bacteria | 1430 |
| 6 | Ga0070670_100963913 | 3300005331 | Bacteria | 775 |
| 7 | Ga0070680_100020187 | 3300005336 | Bacteria | 5287 |
| 8 | Ga0070680_100030601 | 3300005336 | Bacteria | 4325 |
| 9 | Ga0070680_100050348 | 3300005336 | Bacteria | 3397 |
| 10 | Ga0070660_100151501 | 3300005339 | Bacteria | 1865 |
| 11 | Ga0070660_100500706 | 3300005339 | Bacteria | 1011 |
| 12 | Ga0070660_100949199 | 3300005339 | Bacteria | 726 |
| 13 | Ga0070691_10188568 | 3300005341 | Bacteria | 1077 |
| 14 | Ga0070661_100003411 | 3300005344 | Bacteria | 10978 |
| 15 | Ga0070661_100862154 | 3300005344 | Bacteria | 746 |
| 16 | Ga0070692_10013691 | 3300005345 | Bacteria | 3788 |
| 17 | Ga0070668_100148391 | 3300005347 | Bacteria | 1894 |
| 18 | Ga0070668_100594652 | 3300005347 | Bacteria | 967 |
| 19 | Ga0070668_100687019 | 3300005347 | Unclassified | 902 |
| 20 | Ga0070669_100003079 | 3300005353 | Bacteria | 12001 |
| 21 | Ga0070669_100160201 | 3300005353 | Bacteria | 1748 |
| 22 | Ga0070669_100895017 | 3300005353 | Bacteria | 758 |
| 23 | Ga0070671_100993761 | 3300005355 | Bacteria | 735 |
| 24 | Ga0070659_100017963 | 3300005366 | Bacteria | 5330 |
| 25 | Ga0070711_100001286 | 3300005439 | Bacteria | 13623 |
| 26 | Ga0070705_101171262 | 3300005440 | Bacteria | 632 |
| 27 | Ga0070694_100028827 | 3300005444 | Bacteria | 3616 |
| 28 | Ga0070694_101167799 | 3300005444 | Bacteria | 644 |
| 29 | Ga0070708_100079242 | 3300005445 | Bacteria | 2971 |
| 30 | Ga0070663_100026569 | 3300005455 | Bacteria | 3923 |
| 31 | Ga0070663_100230667 | 3300005455 | Bacteria | 1458 |
| 32 | Ga0070663_100442520 | 3300005455 | Bacteria | 1070 |
| 33 | Ga0070678_100220569 | 3300005456 | Bacteria | 1576 |
| 34 | Ga0070662_100475570 | 3300005457 | Bacteria | 1040 |
| 35 | Ga0070662_100636564 | 3300005457 | Bacteria | 899 |
| 36 | Ga0070662_101061568 | 3300005457 | Bacteria | 694 |
| 37 | Ga0070681_10008932 | 3300005458 | Bacteria | 9851 |
| 38 | Ga0070681_10010307 | 3300005458 | Bacteria | 9226 |
| 39 | Ga0070681_10077498 | 3300005458 | Bacteria | 3281 |
| 40 | Ga0070681_10306667 | 3300005458 | Bacteria | 1497 |
| 41 | Ga0068867_101010449 | 3300005459 | Bacteria | 755 |
| 42 | Ga0070685_10634249 | 3300005466 | Unclassified | 772 |
| 43 | Ga0070706_100650402 | 3300005467 | Bacteria | 979 |
| 44 | Ga0070706_100911943 | 3300005467 | Bacteria | 812 |
| 45 | Ga0070707_100171775 | 3300005468 | Bacteria | 2112 |
| 46 | Ga0070707_101121778 | 3300005468 | Bacteria | 752 |
| 47 | Ga0070699_100000824 | 3300005518 | Bacteria | 28768 |
| 48 | Ga0070699_100065250 | 3300005518 | Bacteria | 3159 |
| 49 | Ga0070699_100291279 | 3300005518 | Bacteria | 1464 |
| 50 | Ga0070679_100014954 | 3300005530 | Bacteria | 7456 |
| 51 | Ga0070679_100036230 | 3300005530 | Bacteria | 4896 |
| 52 | Ga0070679_100043081 | 3300005530 | Bacteria | 4496 |
| 53 | Ga0070679_100113171 | 3300005530 | Bacteria | 2699 |
| 54 | Ga0070684_100026677 | 3300005535 | Bacteria | 4868 |
| 55 | Ga0070684_100608741 | 3300005535 | Bacteria | 1016 |
| 56 | Ga0070697_100009789 | 3300005536 | Bacteria | 7476 |
| 57 | Ga0068853_100013646 | 3300005539 | Bacteria | 6638 |
| 58 | Ga0070672_100129750 | 3300005543 | Bacteria | 2071 |
| 59 | Ga0070672_100155226 | 3300005543 | Bacteria | 1895 |
| 60 | Ga0070672_100203555 | 3300005543 | Bacteria | 1656 |
| 61 | Ga0070672_100231388 | 3300005543 | Bacteria | 1553 |
| 62 | Ga0070686_101305091 | 3300005544 | Bacteria | 606 |
| 63 | Ga0070695_100030682 | 3300005545 | Bacteria | 3348 |
| 64 | Ga0070695_100180696 | 3300005545 | Bacteria | 1495 |
| 65 | Ga0070696_100170062 | 3300005546 | Bacteria | 1610 |
| 66 | Ga0070665_100042538 | 3300005548 | Bacteria | 4567 |
| 67 | Ga0070704_100541263 | 3300005549 | Bacteria | 1016 |
| 68 | Ga0068855_100008571 | 3300005563 | Bacteria | 12363 |
| 69 | Ga0068855_100251326 | 3300005563 | Bacteria | 1972 |
| 70 | Ga0070664_100076525 | 3300005564 | Bacteria | 2876 |
| 71 | Ga0070664_100111051 | 3300005564 | Bacteria | 2393 |
| 72 | Ga0070664_100159760 | 3300005564 | Bacteria | 1993 |
| 73 | Ga0070664_100206975 | 3300005564 | Bacteria | 1752 |
| 74 | Ga0068857_100214040 | 3300005577 | Bacteria | 1759 |
| 75 | Ga0070702_100768022 | 3300005615 | Bacteria | 742 |
| 76 | Ga0068852_100069165 | 3300005616 | Bacteria | 3093 |
| 77 | Ga0068864_100180637 | 3300005618 | Bacteria | 1929 |
| 78 | Ga0068861_100119842 | 3300005719 | Bacteria | 2121 |
| 79 | Ga0068861_100492059 | 3300005719 | Bacteria | 1107 |
| 80 | Ga0068861_100844213 | 3300005719 | Bacteria | 863 |
| 81 | Ga0068870_10002079 | 3300005840 | Bacteria | 8295 |
| 82 | Ga0068863_100696157 | 3300005841 | Bacteria | 1010 |
| 83 | Ga0068860_100139566 | 3300005843 | Bacteria | 2329 |
| 84 | Ga0068860_100910972 | 3300005843 | Bacteria | 895 |
| 85 | Ga0068860_101262832 | 3300005843 | Unclassified | 759 |
| 86 | Ga0068860_101542420 | 3300005843 | Bacteria | 686 |
| 87 | Ga0068862_100000376 | 3300005844 | Bacteria | 48418 |
| 88 | Ga0068862_100093687 | 3300005844 | Bacteria | 2619 |
| 89 | Ga0068862_100599645 | 3300005844 | Bacteria | 1057 |
| 90 | Ga0081455_10050687 | 3300005937 | Bacteria | 3566 |
| 91 | Ga0070717_11392994 | 3300006028 | Bacteria | 637 |
| 92 | Ga0070712_100105013 | 3300006175 | Bacteria | 2097 |
| 93 | Ga0075428_101147254 | 3300006844 | Bacteria | 820 |
| 94 | Ga0075428_101149041 | 3300006844 | Bacteria | 819 |
| 95 | Ga0075430_100109751 | 3300006846 | Bacteria | 2301 |
| 96 | Ga0075431_100064200 | 3300006847 | Bacteria | 3791 |
| 97 | Ga0075431_100747874 | 3300006847 | Bacteria | 953 |
| 98 | Ga0075434_100091187 | 3300006871 | Bacteria | 3049 |
| 99 | Ga0075429_100021264 | 3300006880 | Bacteria | 5624 |
| 100 | Ga0075429_100665963 | 3300006880 | Bacteria | 912 |
| 101 | Ga0068865_100020297 | 3300006881 | Bacteria | 4308 |
| 102 | Ga0075435_100241786 | 3300007076 | Bacteria | 1536 |
| 103 | Ga0105240_10074073 | 3300009093 | Bacteria | 4204 |
| 104 | Ga0114129_10274423 | 3300009147 | Bacteria | 2255 |
| 105 | Ga0114129_11177214 | 3300009147 | Bacteria | 956 |
| 106 | Ga0105243_10333503 | 3300009148 | Bacteria | 1386 |
| 107 | Ga0105243_10744155 | 3300009148 | Bacteria | 960 |
| 108 | Ga0105243_10880089 | 3300009148 | Bacteria | 889 |
| 109 | Ga0105241_10116790 | 3300009174 | Bacteria | 2143 |
| 110 | Ga0105241_10397937 | 3300009174 | Bacteria | 1207 |
| 111 | Ga0105248_10087798 | 3300009177 | Bacteria | 3500 |
| 112 | Ga0105248_10099173 | 3300009177 | Bacteria | 3282 |
| 113 | Ga0105248_10454509 | 3300009177 | Bacteria | 1443 |
| 114 | Ga0105238_10073038 | 3300009551 | Bacteria | 3425 |
| 115 | Ga0105249_10000115 | 3300009553 | Bacteria | 108581 |
| 116 | Ga0105249_10000454 | 3300009553 | Bacteria | 38498 |
| 117 | Ga0105249_10020246 | 3300009553 | Bacteria | 5947 |
| 118 | Ga0105249_10262497 | 3300009553 | Bacteria | 1717 |
| 119 | Ga0105239_11716520 | 3300010375 | Bacteria | 727 |
| 120 | Ga0157323_1010152 | 3300012495 | Bacteria | 735 |
| 121 | Ga0157370_10165029 | 3300013104 | Bacteria | 2060 |
| 122 | Ga0157369_10115485 | 3300013105 | Bacteria | 2851 |
| 123 | Ga0157369_10154139 | 3300013105 | Bacteria | 2428 |
| 124 | Ga0163162_10059365 | 3300013306 | Bacteria | 3856 |
| 125 | Ga0157372_10683897 | 3300013307 | Bacteria | 1194 |
| 126 | Ga0157372_10847696 | 3300013307 | Bacteria | 1061 |
| 127 | Ga0157375_10873090 | 3300013308 | Bacteria | 1045 |
| 128 | Ga0157375_12008437 | 3300013308 | Unclassified | 687 |
| 129 | Ga0163163_10066631 | 3300014325 | Bacteria | 3577 |
| 130 | Ga0163163_10171929 | 3300014325 | Bacteria | 2213 |
| 131 | Ga0163163_10806932 | 3300014325 | Bacteria | 1002 |
| 132 | Ga0157380_10172196 | 3300014326 | Bacteria | 1893 |
| 133 | Ga0157380_10654155 | 3300014326 | Bacteria | 1049 |
| 134 | Ga0157380_11665764 | 3300014326 | Bacteria | 695 |
| 135 | Ga0157379_10265372 | 3300014968 | Bacteria | 1561 |
| 136 | Ga0157379_10829323 | 3300014968 | Bacteria | 874 |
| 137 | Ga0157379_11046607 | 3300014968 | Bacteria | 780 |
| 138 | Ga0157376_10211400 | 3300014969 | Bacteria | 1791 |
| 139 | Ga0157376_10267374 | 3300014969 | Bacteria | 1605 |
| 140 | Ga0157376_11135119 | 3300014969 | Bacteria | 808 |
| 141 | Ga0182007_10206684 | 3300015262 | Bacteria | 688 |
| 142 | Ga0207645_10067632 | 3300025907 | Bacteria | 2284 |
| 143 | Ga0207643_10001951 | 3300025908 | Bacteria | 11403 |
| 144 | Ga0207705_10089643 | 3300025909 | Bacteria | 2251 |
| 145 | Ga0207705_10379726 | 3300025909 | Bacteria | 1091 |
| 146 | Ga0207654_10079503 | 3300025911 | Bacteria | 1970 |
| 147 | Ga0207707_10007791 | 3300025912 | Bacteria | 9323 |
| 148 | Ga0207707_10023881 | 3300025912 | Bacteria | 5346 |
| 149 | Ga0207707_10041733 | 3300025912 | Bacteria | 4006 |
| 150 | Ga0207707_10412454 | 3300025912 | Bacteria | 1159 |
| 151 | Ga0207695_10081615 | 3300025913 | Bacteria | 3272 |
| 152 | Ga0207693_10330978 | 3300025915 | Bacteria | 1192 |
| 153 | Ga0207663_10001490 | 3300025916 | Bacteria | 10915 |
| 154 | Ga0207660_10095373 | 3300025917 | Bacteria | 2213 |
| 155 | Ga0207660_10238060 | 3300025917 | Bacteria | 1433 |
| 156 | Ga0207660_10441739 | 3300025917 | Bacteria | 1051 |
| 157 | Ga0207662_10134859 | 3300025918 | Bacteria | 1560 |
| 158 | Ga0207657_10005262 | 3300025919 | Bacteria | 13552 |
| 159 | Ga0207657_10738236 | 3300025919 | Bacteria | 763 |
| 160 | Ga0207649_10096437 | 3300025920 | Bacteria | 1948 |
| 161 | Ga0207652_10008367 | 3300025921 | Bacteria | 8321 |
| 162 | Ga0207652_10024204 | 3300025921 | Bacteria | 5036 |
| 163 | Ga0207652_10031148 | 3300025921 | Bacteria | 4476 |
| 164 | Ga0207652_10644804 | 3300025921 | Bacteria | 947 |
| 165 | Ga0207646_10122557 | 3300025922 | Bacteria | 2336 |
| 166 | Ga0207681_10003561 | 3300025923 | Bacteria | 9699 |
| 167 | Ga0207681_10023462 | 3300025923 | Bacteria | 3947 |
| 168 | Ga0207644_10513276 | 3300025931 | Bacteria | 990 |
| 169 | Ga0207690_10097772 | 3300025932 | Bacteria | 2089 |
| 170 | Ga0207690_10516577 | 3300025932 | Bacteria | 968 |
| 171 | Ga0207706_10076182 | 3300025933 | Bacteria | 2950 |
| 172 | Ga0207706_10361664 | 3300025933 | Bacteria | 1261 |
| 173 | Ga0207709_10193874 | 3300025935 | Bacteria | 1445 |
| 174 | Ga0207691_10052046 | 3300025940 | Bacteria | 3741 |
| 175 | Ga0207691_10164589 | 3300025940 | Bacteria | 1944 |
| 176 | Ga0207711_10055461 | 3300025941 | Bacteria | 3402 |
| 177 | Ga0207711_10152177 | 3300025941 | Bacteria | 2088 |
| 178 | Ga0207661_10222512 | 3300025944 | Bacteria | 1669 |
| 179 | Ga0207661_10244948 | 3300025944 | Bacteria | 1592 |
| 180 | Ga0207679_10026253 | 3300025945 | Bacteria | 4015 |
| 181 | Ga0207679_10070401 | 3300025945 | Bacteria | 2636 |
| 182 | Ga0207679_10141370 | 3300025945 | Bacteria | 1946 |
| 183 | Ga0207679_10210109 | 3300025945 | Bacteria | 1631 |
| 184 | Ga0207667_10081585 | 3300025949 | Bacteria | 3350 |
| 185 | Ga0207667_10310692 | 3300025949 | Bacteria | 1610 |
| 186 | Ga0207651_10042005 | 3300025960 | Unclassified | 3040 |
| 187 | Ga0207712_10000499 | 3300025961 | Bacteria | 32439 |
| 188 | Ga0207712_10001176 | 3300025961 | Bacteria | 18145 |
| 189 | Ga0207712_10081403 | 3300025961 | Bacteria | 2358 |
| 190 | Ga0207712_10797805 | 3300025961 | Bacteria | 830 |
| 191 | Ga0207668_10309425 | 3300025972 | Bacteria | 1307 |
| 192 | Ga0207668_10614131 | 3300025972 | Bacteria | 948 |
| 193 | Ga0207640_10139919 | 3300025981 | Bacteria | 1763 |
| 194 | Ga0207677_10754569 | 3300026023 | Bacteria | 868 |
| 195 | Ga0207678_10068814 | 3300026067 | Bacteria | 3036 |
| 196 | Ga0207678_10289810 | 3300026067 | Bacteria | 1406 |
| 197 | Ga0207678_10620997 | 3300026067 | Unclassified | 948 |
| 198 | Ga0207702_10057844 | 3300026078 | Bacteria | 3297 |
| 199 | Ga0207702_11059431 | 3300026078 | Bacteria | 805 |
| 200 | Ga0207648_10023923 | 3300026089 | Bacteria | 5460 |
| 201 | Ga0207676_10226214 | 3300026095 | Bacteria | 1669 |
| 202 | Ga0207676_10680541 | 3300026095 | Bacteria | 995 |
| 203 | Ga0207674_10179106 | 3300026116 | Bacteria | 2071 |
| 204 | Ga0207675_100059762 | 3300026118 | Bacteria | 3558 |
| 205 | Ga0207675_100090617 | 3300026118 | Bacteria | 2875 |
| 206 | Ga0207675_100821073 | 3300026118 | Bacteria | 944 |
| 207 | Ga0207698_10013973 | 3300026142 | Bacteria | 5318 |
| 208 | Ga0207698_10494551 | 3300026142 | Bacteria | 1189 |
| 209 | Ga0209995_1078555 | 3300027471 | Bacteria | 566 |
| 210 | Ga0207428_10129186 | 3300027907 | Bacteria | 1934 |
| 211 | Ga0268266_10935521 | 3300028379 | Bacteria | 838 |
| 212 | Ga0268265_10002121 | 3300028380 | Bacteria | 15384 |
| 213 | Ga0268265_10072005 | 3300028380 | Bacteria | 2694 |
| 214 | Ga0268265_10554481 | 3300028380 | Bacteria | 1091 |
| 215 | Ga0268264_10020367 | 3300028381 | Bacteria | 5421 |
| 216 | Ga0268264_11333172 | 3300028381 | Bacteria | 728 |
| 217 | Ga0268264_12075754 | 3300028381 | Bacteria | 577 |
| 218 | Ga0307408_100008337 | 3300031548 | Bacteria | 6844 |
| 219 | Ga0307408_100143062 | 3300031548 | Bacteria | 1879 |
| 220 | Ga0307408_100215144 | 3300031548 | Bacteria | 1564 |
| 221 | Ga0307408_100371672 | 3300031548 | Bacteria | 1219 |
| 222 | Ga0307408_100540701 | 3300031548 | Bacteria | 1026 |
| 223 | Ga0307405_10004488 | 3300031731 | Bacteria | 6603 |
| 224 | Ga0307405_10036009 | 3300031731 | Bacteria | 2962 |
| 225 | Ga0307405_10240206 | 3300031731 | Bacteria | 1341 |
| 226 | Ga0307405_10501621 | 3300031731 | Bacteria | 973 |
| 227 | Ga0307413_10010972 | 3300031824 | Bacteria | 4427 |
| 228 | Ga0307413_10019705 | 3300031824 | Bacteria | 3571 |
| 229 | Ga0307413_10036278 | 3300031824 | Bacteria | 2837 |
| 230 | Ga0307413_10165887 | 3300031824 | Bacteria | 1557 |
| 231 | Ga0307413_10262852 | 3300031824 | Bacteria | 1287 |
| 232 | Ga0307413_10390592 | 3300031824 | Bacteria | 1087 |
| 233 | Ga0307413_10446736 | 3300031824 | Bacteria | 1025 |
| 234 | Ga0307410_10002527 | 3300031852 | Bacteria | 8847 |
| 235 | Ga0307410_10010146 | 3300031852 | Bacteria | 5323 |
| 236 | Ga0307410_10274470 | 3300031852 | Bacteria | 1320 |
| 237 | Ga0307410_10535507 | 3300031852 | Bacteria | 968 |
| 238 | Ga0307410_10570322 | 3300031852 | Bacteria | 940 |
| 239 | Ga0307406_10001688 | 3300031901 | Bacteria | 12133 |
| 240 | Ga0307406_10014718 | 3300031901 | Bacteria | 4506 |
| 241 | Ga0307406_10198542 | 3300031901 | Bacteria | 1474 |
| 242 | Ga0307406_10557723 | 3300031901 | Bacteria | 938 |
| 243 | Ga0307407_10018599 | 3300031903 | Bacteria | 3518 |
| 244 | Ga0307407_10027368 | 3300031903 | Bacteria | 3033 |
| 245 | Ga0307407_10054888 | 3300031903 | Bacteria | 2300 |
| 246 | Ga0307407_10086253 | 3300031903 | Bacteria | 1912 |
| 247 | Ga0307407_10453310 | 3300031903 | Bacteria | 931 |
| 248 | Ga0307407_10617161 | 3300031903 | Bacteria | 809 |
| 249 | Ga0307412_10080294 | 3300031911 | Bacteria | 2253 |
| 250 | Ga0307412_10346886 | 3300031911 | Bacteria | 1190 |
| 251 | Ga0307412_11419397 | 3300031911 | Bacteria | 629 |
| 252 | Ga0307409_100000144 | 3300031995 | Bacteria | 26764 |
| 253 | Ga0307409_100005669 | 3300031995 | Bacteria | 7231 |
| 254 | Ga0307409_100009411 | 3300031995 | Bacteria | 6000 |
| 255 | Ga0307409_100026152 | 3300031995 | Bacteria | 4111 |
| 256 | Ga0307409_100120314 | 3300031995 | Bacteria | 2222 |
| 257 | Ga0307409_100179122 | 3300031995 | Bacteria | 1874 |
| 258 | Ga0307409_100182609 | 3300031995 | Bacteria | 1859 |
| 259 | Ga0307409_100404155 | 3300031995 | Bacteria | 1305 |
| 260 | Ga0307409_101049244 | 3300031995 | Unclassified | 835 |
| 261 | Ga0307416_100000828 | 3300032002 | Bacteria | 16247 |
| 262 | Ga0307416_100085434 | 3300032002 | Bacteria | 2686 |
| 263 | Ga0307416_100121404 | 3300032002 | Bacteria | 2330 |
| 264 | Ga0307416_100137033 | 3300032002 | Bacteria | 2216 |
| 265 | Ga0307416_100307518 | 3300032002 | Bacteria | 1579 |
| 266 | Ga0307416_100400666 | 3300032002 | Bacteria | 1409 |
| 267 | Ga0307416_100528993 | 3300032002 | Unclassified | 1249 |
| 268 | Ga0307416_100563387 | 3300032002 | Bacteria | 1214 |
| 269 | Ga0307416_101104424 | 3300032002 | Bacteria | 898 |
| 270 | Ga0307416_101873449 | 3300032002 | Bacteria | 703 |
| 271 | Ga0307414_10002383 | 3300032004 | Bacteria | 9831 |
| 272 | Ga0307414_10032844 | 3300032004 | Bacteria | 3422 |
| 273 | Ga0307414_10137897 | 3300032004 | Bacteria | 1905 |
| 274 | Ga0307414_10335255 | 3300032004 | Bacteria | 1293 |
| 275 | Ga0307414_10484407 | 3300032004 | Bacteria | 1091 |
| 276 | Ga0307411_10007270 | 3300032005 | Bacteria | 5620 |
| 277 | Ga0307411_10016984 | 3300032005 | Bacteria | 4132 |
| 278 | Ga0307411_10038481 | 3300032005 | Bacteria | 3017 |
| 279 | Ga0307411_10157364 | 3300032005 | Bacteria | 1697 |
| 280 | Ga0307411_10192544 | 3300032005 | Bacteria | 1558 |
| 281 | Ga0307411_10293419 | 3300032005 | Bacteria | 1300 |
| 282 | Ga0307411_10856079 | 3300032005 | Bacteria | 805 |
| 283 | Ga0307415_100000419 | 3300032126 | Bacteria | 18192 |
| 284 | Ga0307415_100036475 | 3300032126 | Bacteria | 3222 |
| 285 | Ga0307415_100044728 | 3300032126 | Bacteria | 2962 |
| 286 | Ga0307415_100104570 | 3300032126 | Bacteria | 2086 |
| 287 | Ga0307415_100131985 | 3300032126 | Bacteria | 1893 |
| 288 | Ga0307415_100293152 | 3300032126 | Bacteria | 1344 |
| 289 | Ga0307415_100563413 | 3300032126 | Bacteria | 1007 |
| 290 | Ga0307415_100877952 | 3300032126 | Bacteria | 825 |
| 291 | Ga0307415_101204795 | 3300032126 | Bacteria | 713 |
| 292 | Ga0373926_0004167 | 3300035083 | Bacteria | 4716 |
| 293 | Ga0373932_0044489 | 3300035112 | Bacteria | 1295 |
| 294 | Ga0373945_0027811 | 3300035116 | Bacteria | 1977 |
| 295 | Ga0373960_0232818 | 3300035121 | Bacteria | 663 |
| 296 | Ga0373943_0016857 | 3300035170 | Bacteria | 3338 |
| 297 | Ga0373962_0134193 | 3300035242 | Bacteria | 799 |
| 298 | Ga0373935_0018031 | 3300035692 | Bacteria | 4290 |
| 299 | Ga0373935_0340967 | 3300035692 | Bacteria | 1067 |
| 300 | Ga0373927_0026060 | 3300035695 | Bacteria | 3821 |
| 301 | Ga0373947_0002126 | 3300035725 | Bacteria | 12064 |
| 302 | Ga0373937_0476569 | 3300036401 | Bacteria | 1185 |
| 303 | Ga0373925_0013098 | 3300037068 | Bacteria | 6002 |
| 304 | Ga0395905_0434509 | 3300037471 | Bacteria | 1210 |
| 305 | Ga0242420_028295 | 3300038996 | Unclassified | 1031 |
| 306 | Ga0436365_0504187 | 3300039437 | Bacteria | 1133 |
| 307 | Ga0439453_0033522 | 3300041408 | Bacteria | 982 |
| 308 | Ga0451807_2555286 | 3300041486 | Bacteria | 1904 |
| 309 | Ga0451841_0074140 | 3300041498 | Bacteria | 730 |
| 310 | Ga0451849_0414375 | 3300041505 | Bacteria | 987 |
| 311 | Ga0439454_017522 | 3300042011 | Bacteria | 1024 |
| 312 | Ga0450921_001219 | 3300042123 | Bacteria | 1502 |
| 313 | Ga0450898_068549 | 3300042134 | Bacteria | 707 |
| 314 | Ga0439434_0115927 | 3300042435 | Bacteria | 870 |
| 315 | Ga0439444_0079283 | 3300042437 | Bacteria | 716 |
| 316 | Ga0451577_0003975 | 3300042876 | Bacteria | 15941 |
| 317 | Ga0451577_0061655 | 3300042876 | Bacteria | 3345 |
| 318 | Ga0466961_0592676 | 3300044693 | Bacteria | 667 |
| 319 | Ga0453684_0210433 | 3300044712 | Bacteria | 2261 |
| 320 | Ga0466959_0528410 | 3300045049 | Bacteria | 796 |
| 321 | Ga0466958_0573571 | 3300045836 | Bacteria | 733 |
| 322 | Ga0466967_1649394 | 3300045976 | Bacteria | 639 |
| 323 | Ga0495629_0025075 | 3300046459 | Bacteria | 4241 |
| 324 | Ga0495580_0095865 | 3300046472 | Bacteria | 2063 |
| 325 | Ga0495580_0147155 | 3300046472 | Bacteria | 1632 |
| 326 | Ga0495605_0259700 | 3300046474 | Bacteria | 742 |
| 327 | Ga0495639_0000549 | 3300046475 | Bacteria | 17446 |
| 328 | Ga0495639_0018403 | 3300046475 | Bacteria | 3041 |
| 329 | Ga0495662_0025907 | 3300046476 | Bacteria | 2833 |
| 330 | Ga0495664_0031638 | 3300046477 | Bacteria | 3103 |
| 331 | Ga0495594_0007257 | 3300046499 | Bacteria | 5700 |
| 332 | Ga0495618_0053276 | 3300046514 | Bacteria | 2558 |
| 333 | Ga0495630_0002236 | 3300046517 | Bacteria | 13469 |
| 334 | Ga0495630_0026160 | 3300046517 | Bacteria | 4319 |
| 335 | Ga0495666_0013463 | 3300046526 | Bacteria | 4079 |
| 336 | Ga0495665_0000358 | 3300046531 | Bacteria | 23104 |
| 337 | Ga0495586_0012895 | 3300046535 | Bacteria | 4432 |
| 338 | Ga0495635_0277029 | 3300046663 | Bacteria | 1127 |
| 339 | Ga0495635_0972483 | 3300046663 | Unclassified | 541 |
| 340 | Ga0495588_0012498 | 3300046674 | Bacteria | 4015 |
| 341 | Ga0495647_0418663 | 3300046681 | Bacteria | 617 |
| 342 | Ga0495658_0001403 | 3300046683 | Bacteria | 12652 |
| 343 | Ga0495658_0008579 | 3300046683 | Bacteria | 5070 |
| 344 | Ga0495613_0069329 | 3300046689 | Bacteria | 2571 |
| 345 | Ga0495613_0165850 | 3300046689 | Bacteria | 1569 |
| 346 | Ga0495624_0459405 | 3300046690 | Bacteria | 763 |
| 347 | Ga0495581_0000659 | 3300047315 | Bacteria | 18109 |
| 348 | Ga0495674_0131259 | 3300047319 | Bacteria | 2111 |
| 349 | Ga0495680_0066918 | 3300047322 | Bacteria | 2748 |
| 350 | Ga0495684_0070462 | 3300047471 | Bacteria | 2658 |
| 351 | Ga0495593_0000356 | 3300047673 | Bacteria | 25268 |
| 352 | Ga0495614_0000638 | 3300048089 | Bacteria | 14664 |
| 353 | Ga0496100_0065280 | 3300048903 | Bacteria | 2411 |
| 354 | Ga0496100_0905600 | 3300048903 | Bacteria | 693 |
| 355 | Ga0496101_0515952 | 3300048904 | Bacteria | 944 |
| 356 | Ga0496102_0269133 | 3300048905 | Bacteria | 1606 |
| 357 | Ga0496102_0873782 | 3300048905 | Bacteria | 821 |
| 358 | Ga0496103_0071001 | 3300048906 | Bacteria | 2179 |
| 359 | Ga0496104_0207729 | 3300048907 | Bacteria | 1870 |
| 360 | Ga0496104_0698224 | 3300048907 | Bacteria | 922 |
| 361 | Ga0496105_0250591 | 3300048908 | Bacteria | 1435 |
| 362 | Ga0496106_0053593 | 3300048909 | Bacteria | 3047 |
| 363 | Ga0496106_0366757 | 3300048909 | Bacteria | 1157 |
| 364 | Ga0496106_0671675 | 3300048909 | Bacteria | 827 |
| 365 | Ga0496106_1134556 | 3300048909 | Bacteria | 611 |
| 366 | Ga0496107_0110621 | 3300048910 | Bacteria | 2019 |
| 367 | Ga0496107_0251521 | 3300048910 | Bacteria | 1315 |
| 368 | Ga0496108_0075320 | 3300048911 | Bacteria | 2851 |
| 369 | Ga0496108_0888305 | 3300048911 | Bacteria | 765 |
| 370 | Ga0496109_0043903 | 3300048912 | Unclassified | 4053 |
| 371 | Ga0496109_0419606 | 3300048912 | Bacteria | 1264 |
| 372 | Ga0496110_0028810 | 3300048913 | Bacteria | 4773 |
| 373 | Ga0496110_0100205 | 3300048913 | Bacteria | 2597 |
| 374 | Ga0496112_0022223 | 3300048915 | Bacteria | 6044 |
| 375 | Ga0496112_0661130 | 3300048915 | Bacteria | 974 |
| 376 | Ga0496113_0774854 | 3300048916 | Bacteria | 763 |
| 377 | Ga0496113_1242379 | 3300048916 | Bacteria | 581 |
| 378 | Ga0496115_0476264 | 3300048918 | Unclassified | 1006 |
| 379 | Ga0501290_017104 | 3300049513 | Bacteria | 970 |
| 380 | Ga0501303_045128 | 3300049526 | Bacteria | 563 |
| 381 | Ga0501031_0037498 | 3300049568 | Bacteria | 3163 |
| 382 | Ga0501031_0239043 | 3300049568 | Bacteria | 1181 |
| 383 | Ga0501032_0230541 | 3300049569 | Bacteria | 1204 |
| 384 | Ga0501033_0144217 | 3300049570 | Bacteria | 1721 |
| 385 | Ga0501034_0004342 | 3300049571 | Bacteria | 15797 |
| 386 | Ga0501036_0041282 | 3300049572 | Bacteria | 3904 |
| 387 | Ga0501036_0055831 | 3300049572 | Bacteria | 3346 |
| 388 | Ga0501039_0383419 | 3300049575 | Bacteria | 1104 |
| 389 | Ga0501040_0050648 | 3300049576 | Bacteria | 2841 |
| 390 | Ga0501040_0153098 | 3300049576 | Bacteria | 1627 |
| 391 | Ga0501041_0071773 | 3300049577 | Bacteria | 2126 |
| 392 | Ga0501041_0114239 | 3300049577 | Bacteria | 1676 |
| 393 | Ga0501042_0056601 | 3300049578 | Bacteria | 2798 |
| 394 | Ga0501046_0249628 | 3300049580 | Bacteria | 1306 |
| 395 | Ga0501046_0286677 | 3300049580 | Bacteria | 1205 |
| 396 | Ga0501047_0053540 | 3300049581 | Bacteria | 3903 |
| 397 | Ga0501047_0187163 | 3300049581 | Bacteria | 1935 |
| 398 | Ga0501048_0328180 | 3300049582 | Bacteria | 1090 |
| 399 | Ga0501048_0695086 | 3300049582 | Bacteria | 730 |
| 400 | Ga0501067_0000353 | 3300049583 | Bacteria | 25052 |
| 401 | Ga0501067_0004616 | 3300049583 | Bacteria | 7626 |
| 402 | Ga0501067_0022949 | 3300049583 | Bacteria | 3455 |
| 403 | Ga0501067_0434366 | 3300049583 | Bacteria | 733 |
| 404 | Ga0501068_0000022 | 3300049584 | Bacteria | 58879 |
| 405 | Ga0501068_0001339 | 3300049584 | Bacteria | 13056 |
| 406 | Ga0501068_0389399 | 3300049584 | Bacteria | 898 |
| 407 | Ga0501068_0460820 | 3300049584 | Bacteria | 823 |
| 408 | Ga0501068_0561529 | 3300049584 | Bacteria | 742 |
| 409 | Ga0501069_0000105 | 3300049585 | Bacteria | 38637 |
| 410 | Ga0501069_0001800 | 3300049585 | Bacteria | 10728 |
| 411 | Ga0501069_0032461 | 3300049585 | Unclassified | 2874 |
| 412 | Ga0501069_0186503 | 3300049585 | Bacteria | 1200 |
| 413 | Ga0501069_0197156 | 3300049585 | Bacteria | 1166 |
| 414 | Ga0501070_0000192 | 3300049586 | Bacteria | 57359 |
| 415 | Ga0501070_0027750 | 3300049586 | Bacteria | 4749 |
| 416 | Ga0501070_0062415 | 3300049586 | Bacteria | 3087 |
| 417 | Ga0501071_0000678 | 3300049587 | Bacteria | 17791 |
| 418 | Ga0501071_0002547 | 3300049587 | Bacteria | 11102 |
| 419 | Ga0501071_1035916 | 3300049587 | Bacteria | 634 |
| 420 | Ga0501072_0005786 | 3300049588 | Bacteria | 9417 |
| 421 | Ga0501072_0009721 | 3300049588 | Bacteria | 7315 |
| 422 | Ga0501072_0305978 | 3300049588 | Bacteria | 1264 |
| 423 | Ga0501073_0000949 | 3300049589 | Bacteria | 20906 |
| 424 | Ga0501073_0006186 | 3300049589 | Bacteria | 8933 |
| 425 | Ga0501073_0148021 | 3300049589 | Bacteria | 1627 |
| 426 | Ga0501073_0533643 | 3300049589 | Bacteria | 811 |
| 427 | Ga0501073_0597224 | 3300049589 | Bacteria | 762 |
| 428 | Ga0501074_0000171 | 3300049590 | Bacteria | 34937 |
| 429 | Ga0501074_0000742 | 3300049590 | Bacteria | 20488 |
| 430 | Ga0501074_0171416 | 3300049590 | Bacteria | 1549 |
| 431 | Ga0501074_0207462 | 3300049590 | Bacteria | 1396 |
| 432 | Ga0501074_0238008 | 3300049590 | Bacteria | 1295 |
| 433 | Ga0501074_0267314 | 3300049590 | Bacteria | 1215 |
| 434 | Ga0501074_0478565 | 3300049590 | Bacteria | 883 |
| 435 | Ga0501075_0018150 | 3300049591 | Bacteria | 5088 |
| 436 | Ga0501075_1116760 | 3300049591 | Bacteria | 599 |
| 437 | Ga0501076_0021090 | 3300049592 | Bacteria | 4993 |
| 438 | Ga0501076_0272461 | 3300049592 | Bacteria | 1386 |
| 439 | Ga0501077_0004768 | 3300049593 | Bacteria | 8242 |
| 440 | Ga0501077_0064921 | 3300049593 | Bacteria | 2315 |
| 441 | Ga0501077_0422306 | 3300049593 | Bacteria | 853 |
| 442 | Ga0501202_013730 | 3300049652 | Bacteria | 1544 |
| 443 | Ga0501243_028915 | 3300049675 | Bacteria | 940 |
| 444 | Ga0501249_147527 | 3300049679 | Bacteria | 590 |
| 445 | Ga0501253_076377 | 3300049683 | Bacteria | 749 |
| 446 | Ga0501261_020553 | 3300049690 | Bacteria | 944 |
| 447 | Ga0501079_0065742 | 3300049741 | Bacteria | 2798 |
| 448 | Ga0501079_0076548 | 3300049741 | Bacteria | 2588 |
| 449 | Ga0501079_0076836 | 3300049741 | Bacteria | 2582 |
| 450 | Ga0501079_0127383 | 3300049741 | Bacteria | 1980 |
| 451 | Ga0501079_1239801 | 3300049741 | Bacteria | 587 |
| 452 | Ga0501080_0000060 | 3300049742 | Bacteria | 71292 |
| 453 | Ga0501080_0005735 | 3300049742 | Bacteria | 11107 |
| 454 | Ga0501080_0006023 | 3300049742 | Bacteria | 10866 |
| 455 | Ga0501080_0111578 | 3300049742 | Bacteria | 2535 |
| 456 | Ga0501080_0297281 | 3300049742 | Bacteria | 1465 |
| 457 | Ga0501080_0484844 | 3300049742 | Bacteria | 1106 |
| 458 | Ga0501081_0050168 | 3300049743 | Bacteria | 2875 |
| 459 | Ga0501081_0718839 | 3300049743 | Bacteria | 750 |
| 460 | Ga0501083_0008037 | 3300049744 | Bacteria | 7464 |
| 461 | Ga0501083_0393052 | 3300049744 | Bacteria | 902 |
| 462 | Ga0501268_039996 | 3300049765 | Bacteria | 879 |
| 463 | Ga0501270_059470 | 3300049767 | Bacteria | 713 |
| 464 | Ga0501283_049060 | 3300049779 | Bacteria | 745 |
| 465 | Ga0501035_0315717 | 3300049822 | Bacteria | 1314 |
| 466 | Ga0501045_0009723 | 3300049824 | Bacteria | 6728 |
| 467 | Ga0501045_0014038 | 3300049824 | Bacteria | 5670 |
| 468 | nmdc:mga05p37_186756_c1 | 3300050507 | Bacteria | 2519 |
| 469 | nmdc:mga09592_91131_c1 | 3300050508 | Bacteria | 2605 |
| 470 | nmdc:mga0qj67_3022_c1 | 3300050509 | Bacteria | 12093 |
| 471 | nmdc:mga06r32_77166_c1 | 3300050510 | Bacteria | 3236 |
| 472 | nmdc:mga06r32_882482_c1 | 3300050510 | Unclassified | 851 |
| 473 | nmdc:mga08y16_9037_c1 | 3300050511 | Bacteria | 10459 |
| 474 | nmdc:mga0n895_108355_c1 | 3300050512 | Bacteria | 2792 |
| 475 | nmdc:mga0rr50_559504_c1 | 3300050513 | Bacteria | 974 |
| 476 | nmdc:mga0a205_7709_c1 | 3300050515 | Bacteria | 9767 |
| 477 | Ga0501084_0001187 | 3300054114 | Bacteria | 20381 |
| 478 | Ga0501084_0002953 | 3300054114 | Bacteria | 13773 |
| 479 | Ga0501084_0170156 | 3300054114 | Bacteria | 1839 |
| 480 | Ga0501084_0202134 | 3300054114 | Bacteria | 1676 |
| 481 | Ga0501084_0246566 | 3300054114 | Bacteria | 1508 |
| 482 | Ga0590071_015280 | 3300059421 | Bacteria | 1801 |
| 483 | Ga0501082_0006728 | 3300060353 | Bacteria | 9941 |
| 484 | Ga0501082_0139082 | 3300060353 | Bacteria | 2107 |
| 485 | Ga0501082_0399315 | 3300060353 | Bacteria | 1200 |
| 486 | Ga0501082_0767316 | 3300060353 | Bacteria | 844 |
| 487 | Ga0501082_1125055 | 3300060353 | Bacteria | 686 |
| 488 | Ga0530510_0092799 | 3300061734 | Bacteria | 2204 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006880 | Ga0075429_100021264 | Ga0075429_1000212642 | 145 |
| 2 | 3300025912 | Ga0207707_10412454 | Ga0207707_104124542 | 145 |
| 3 | 3300050508 | nmdc:mga09592_91131_c1 | nmdc:mga09592_91131_c1_1879_2370 | 145 |
| 4 | 3300050509 | nmdc:mga0qj67_3022_c1 | nmdc:mga0qj67_3022_c1_2749_3240 | 145 |
| 5 | 3300050513 | nmdc:mga0rr50_559504_c1 | nmdc:mga0rr50_559504_c1_301_840 | 146 |
| 6 | 3300005295 | Ga0065707_10585356 | Ga0065707_105853561 | 151 |
| 7 | 3300005353 | Ga0070669_100003079 | Ga0070669_1000030794 | 151 |
| 8 | 3300005444 | Ga0070694_101167799 | Ga0070694_1011677991 | 151 |
| 9 | 3300005457 | Ga0070662_100475570 | Ga0070662_1004755702 | 151 |
| 10 | 3300005459 | Ga0068867_101010449 | Ga0068867_1010104491 | 151 |
| 11 | 3300005543 | Ga0070672_100231388 | Ga0070672_1002313882 | 151 |
| 12 | 3300005548 | Ga0070665_100042538 | Ga0070665_1000425385 | 151 |
| 13 | 3300005577 | Ga0068857_100214040 | Ga0068857_1002140403 | 151 |
| 14 | 3300005719 | Ga0068861_100844213 | Ga0068861_1008442132 | 151 |
| 15 | 3300005840 | Ga0068870_10002079 | Ga0068870_100020796 | 151 |
| 16 | 3300005844 | Ga0068862_100000376 | Ga0068862_1000003769 | 151 |
| 17 | 3300006844 | Ga0075428_101147254 | Ga0075428_1011472542 | 151 |
| 18 | 3300006881 | Ga0068865_100020297 | Ga0068865_1000202972 | 151 |
| 19 | 3300009148 | Ga0105243_10744155 | Ga0105243_107441552 | 151 |
| 20 | 3300009553 | Ga0105249_10000454 | Ga0105249_1000045431 | 151 |
| 21 | 3300013306 | Ga0163162_10059365 | Ga0163162_100593654 | 151 |
| 22 | 3300025907 | Ga0207645_10067632 | Ga0207645_100676322 | 151 |
| 23 | 3300025908 | Ga0207643_10001951 | Ga0207643_100019514 | 151 |
| 24 | 3300025923 | Ga0207681_10003561 | Ga0207681_100035611 | 151 |
| 25 | 3300025933 | Ga0207706_10076182 | Ga0207706_100761823 | 151 |
| 26 | 3300025935 | Ga0207709_10193874 | Ga0207709_101938741 | 151 |
| 27 | 3300025940 | Ga0207691_10052046 | Ga0207691_100520464 | 151 |
| 28 | 3300025961 | Ga0207712_10001176 | Ga0207712_1000117613 | 151 |
| 29 | 3300025972 | Ga0207668_10614131 | Ga0207668_106141311 | 151 |
| 30 | 3300026089 | Ga0207648_10023923 | Ga0207648_100239237 | 151 |
| 31 | 3300026116 | Ga0207674_10179106 | Ga0207674_101791063 | 151 |
| 32 | 3300026118 | Ga0207675_100059762 | Ga0207675_1000597622 | 151 |
| 33 | 3300028379 | Ga0268266_10935521 | Ga0268266_109355211 | 151 |
| 34 | 3300028380 | Ga0268265_10002121 | Ga0268265_100021219 | 151 |
| 35 | 3300028381 | Ga0268264_12075754 | Ga0268264_120757541 | 151 |
| 36 | 3300049581 | Ga0501047_0053540 | Ga0501047_0053540_3167_3667 | 151 |
| 37 | 3300050511 | nmdc:mga08y16_9037_c1 | nmdc:mga08y16_9037_c1_5173_5652 | 151 |
| 38 | 3300005456 | Ga0070678_100220569 | Ga0070678_1002205692 | 152 |
| 39 | 3300005564 | Ga0070664_100206975 | Ga0070664_1002069753 | 152 |
| 40 | 3300006880 | Ga0075429_100665963 | Ga0075429_1006659632 | 152 |
| 41 | 3300026095 | Ga0207676_10680541 | Ga0207676_106805411 | 152 |
| 42 | 3300031824 | Ga0307413_10390592 | Ga0307413_103905922 | 152 |
| 43 | 3300048908 | Ga0496105_0250591 | Ga0496105_0250591_118_585 | 154 |
| 44 | 3300049679 | Ga0501249_147527 | Ga0501249_147527_14_481 | 154 |
| 45 | 3300005327 | Ga0070658_10510494 | Ga0070658_105104941 | 158 |
| 46 | 3300005336 | Ga0070680_100030601 | Ga0070680_1000306015 | 158 |
| 47 | 3300005336 | Ga0070680_100050348 | Ga0070680_1000503483 | 158 |
| 48 | 3300005339 | Ga0070660_100151501 | Ga0070660_1001515011 | 158 |
| 49 | 3300005344 | Ga0070661_100003411 | Ga0070661_10000341110 | 158 |
| 50 | 3300005366 | Ga0070659_100017963 | Ga0070659_1000179635 | 158 |
| 51 | 3300005455 | Ga0070663_100026569 | Ga0070663_1000265694 | 158 |
| 52 | 3300005458 | Ga0070681_10008932 | Ga0070681_100089329 | 158 |
| 53 | 3300005458 | Ga0070681_10010307 | Ga0070681_100103076 | 158 |
| 54 | 3300005458 | Ga0070681_10077498 | Ga0070681_100774981 | 158 |
| 55 | 3300005530 | Ga0070679_100014954 | Ga0070679_1000149546 | 158 |
| 56 | 3300005530 | Ga0070679_100036230 | Ga0070679_1000362303 | 158 |
| 57 | 3300005530 | Ga0070679_100043081 | Ga0070679_1000430812 | 158 |
| 58 | 3300005539 | Ga0068853_100013646 | Ga0068853_1000136464 | 158 |
| 59 | 3300005563 | Ga0068855_100008571 | Ga0068855_1000085718 | 158 |
| 60 | 3300005616 | Ga0068852_100069165 | Ga0068852_1000691653 | 158 |
| 61 | 3300005844 | Ga0068862_100599645 | Ga0068862_1005996451 | 158 |
| 62 | 3300006028 | Ga0070717_11392994 | Ga0070717_113929941 | 158 |
| 63 | 3300009093 | Ga0105240_10074073 | Ga0105240_100740733 | 158 |
| 64 | 3300009174 | Ga0105241_10116790 | Ga0105241_101167902 | 158 |
| 65 | 3300009551 | Ga0105238_10073038 | Ga0105238_100730384 | 158 |
| 66 | 3300009553 | Ga0105249_10000115 | Ga0105249_1000011510 | 158 |
| 67 | 3300009553 | Ga0105249_10262497 | Ga0105249_102624972 | 158 |
| 68 | 3300013104 | Ga0157370_10165029 | Ga0157370_101650292 | 158 |
| 69 | 3300013105 | Ga0157369_10115485 | Ga0157369_101154853 | 158 |
| 70 | 3300013105 | Ga0157369_10154139 | Ga0157369_101541393 | 158 |
| 71 | 3300013307 | Ga0157372_10683897 | Ga0157372_106838971 | 158 |
| 72 | 3300013307 | Ga0157372_10847696 | Ga0157372_108476962 | 158 |
| 73 | 3300014325 | Ga0163163_10806932 | Ga0163163_108069322 | 158 |
| 74 | 3300014969 | Ga0157376_10211400 | Ga0157376_102114002 | 158 |
| 75 | 3300025909 | Ga0207705_10089643 | Ga0207705_100896433 | 158 |
| 76 | 3300025909 | Ga0207705_10379726 | Ga0207705_103797261 | 158 |
| 77 | 3300025912 | Ga0207707_10007791 | Ga0207707_100077916 | 158 |
| 78 | 3300025912 | Ga0207707_10041733 | Ga0207707_100417334 | 158 |
| 79 | 3300025913 | Ga0207695_10081615 | Ga0207695_100816153 | 158 |
| 80 | 3300025917 | Ga0207660_10095373 | Ga0207660_100953733 | 158 |
| 81 | 3300025917 | Ga0207660_10441739 | Ga0207660_104417392 | 158 |
| 82 | 3300025919 | Ga0207657_10005262 | Ga0207657_1000526212 | 158 |
| 83 | 3300025920 | Ga0207649_10096437 | Ga0207649_100964372 | 158 |
| 84 | 3300025921 | Ga0207652_10008367 | Ga0207652_100083673 | 158 |
| 85 | 3300025921 | Ga0207652_10024204 | Ga0207652_100242045 | 158 |
| 86 | 3300025921 | Ga0207652_10031148 | Ga0207652_100311485 | 158 |
| 87 | 3300025949 | Ga0207667_10081585 | Ga0207667_100815853 | 158 |
| 88 | 3300025961 | Ga0207712_10000499 | Ga0207712_1000049926 | 158 |
| 89 | 3300025961 | Ga0207712_10797805 | Ga0207712_107978052 | 158 |
| 90 | 3300026067 | Ga0207678_10620997 | Ga0207678_106209971 | 158 |
| 91 | 3300026078 | Ga0207702_10057844 | Ga0207702_100578444 | 158 |
| 92 | 3300026142 | Ga0207698_10013973 | Ga0207698_100139737 | 158 |
| 93 | 3300028380 | Ga0268265_10554481 | Ga0268265_105544811 | 158 |
| 94 | 3300031548 | Ga0307408_100540701 | Ga0307408_1005407012 | 158 |
| 95 | 3300031824 | Ga0307413_10165887 | Ga0307413_101658873 | 158 |
| 96 | 3300031824 | Ga0307413_10446736 | Ga0307413_104467362 | 158 |
| 97 | 3300031903 | Ga0307407_10018599 | Ga0307407_100185994 | 158 |
| 98 | 3300032002 | Ga0307416_100085434 | Ga0307416_1000854343 | 158 |
| 99 | 3300032002 | Ga0307416_100137033 | Ga0307416_1001370334 | 158 |
| 100 | 3300032004 | Ga0307414_10484407 | Ga0307414_104844072 | 158 |
| 101 | 3300032005 | Ga0307411_10016984 | Ga0307411_100169843 | 158 |
| 102 | 3300032126 | Ga0307415_100563413 | Ga0307415_1005634132 | 158 |
| 103 | 3300035083 | Ga0373926_0004167 | Ga0373926_0004167_3697_4191 | 158 |
| 104 | 3300035116 | Ga0373945_0027811 | Ga0373945_0027811_1342_1836 | 158 |
| 105 | 3300035170 | Ga0373943_0016857 | Ga0373943_0016857_2685_3179 | 158 |
| 106 | 3300035692 | Ga0373935_0018031 | Ga0373935_0018031_76_570 | 158 |
| 107 | 3300035692 | Ga0373935_0340967 | Ga0373935_0340967_332_826 | 158 |
| 108 | 3300035695 | Ga0373927_0026060 | Ga0373927_0026060_14_508 | 158 |
| 109 | 3300035725 | Ga0373947_0002126 | Ga0373947_0002126_3201_3695 | 158 |
| 110 | 3300037068 | Ga0373925_0013098 | Ga0373925_0013098_4236_4730 | 158 |
| 111 | 3300042011 | Ga0439454_017522 | Ga0439454_017522_407_886 | 158 |
| 112 | 3300042123 | Ga0450921_001219 | Ga0450921_001219_75_554 | 158 |
| 113 | 3300042134 | Ga0450898_068549 | Ga0450898_068549_216_695 | 158 |
| 114 | 3300042435 | Ga0439434_0115927 | Ga0439434_0115927_180_659 | 158 |
| 115 | 3300042876 | Ga0451577_0003975 | Ga0451577_0003975_3229_3708 | 158 |
| 116 | 3300044693 | Ga0466961_0592676 | Ga0466961_0592676_126_608 | 158 |
| 117 | 3300045049 | Ga0466959_0528410 | Ga0466959_0528410_90_572 | 158 |
| 118 | 3300045836 | Ga0466958_0573571 | Ga0466958_0573571_21_503 | 158 |
| 119 | 3300046459 | Ga0495629_0025075 | Ga0495629_0025075_124_618 | 158 |
| 120 | 3300046475 | Ga0495639_0000549 | Ga0495639_0000549_8763_9257 | 158 |
| 121 | 3300046517 | Ga0495630_0002236 | Ga0495630_0002236_155_649 | 158 |
| 122 | 3300046531 | Ga0495665_0000358 | Ga0495665_0000358_14682_15176 | 158 |
| 123 | 3300046674 | Ga0495588_0012498 | Ga0495588_0012498_3331_3825 | 158 |
| 124 | 3300046681 | Ga0495647_0418663 | Ga0495647_0418663_71_565 | 158 |
| 125 | 3300046683 | Ga0495658_0001403 | Ga0495658_0001403_8532_9026 | 158 |
| 126 | 3300046689 | Ga0495613_0069329 | Ga0495613_0069329_1882_2376 | 158 |
| 127 | 3300046690 | Ga0495624_0459405 | Ga0495624_0459405_203_697 | 158 |
| 128 | 3300047315 | Ga0495581_0000659 | Ga0495581_0000659_7906_8400 | 158 |
| 129 | 3300047673 | Ga0495593_0000356 | Ga0495593_0000356_21120_21614 | 158 |
| 130 | 3300048089 | Ga0495614_0000638 | Ga0495614_0000638_7186_7680 | 158 |
| 131 | 3300005329 | Ga0070683_100339704 | Ga0070683_1003397042 | 159 |
| 132 | 3300005331 | Ga0070670_100963913 | Ga0070670_1009639132 | 159 |
| 133 | 3300005336 | Ga0070680_100020187 | Ga0070680_1000201875 | 159 |
| 134 | 3300005339 | Ga0070660_100500706 | Ga0070660_1005007062 | 159 |
| 135 | 3300005341 | Ga0070691_10188568 | Ga0070691_101885682 | 159 |
| 136 | 3300005344 | Ga0070661_100862154 | Ga0070661_1008621541 | 159 |
| 137 | 3300005347 | Ga0070668_100148391 | Ga0070668_1001483913 | 159 |
| 138 | 3300005347 | Ga0070668_100687019 | Ga0070668_1006870192 | 159 |
| 139 | 3300005353 | Ga0070669_100895017 | Ga0070669_1008950171 | 159 |
| 140 | 3300005355 | Ga0070671_100993761 | Ga0070671_1009937612 | 159 |
| 141 | 3300005439 | Ga0070711_100001286 | Ga0070711_10000128614 | 159 |
| 142 | 3300005440 | Ga0070705_101171262 | Ga0070705_1011712621 | 159 |
| 143 | 3300005445 | Ga0070708_100079242 | Ga0070708_1000792422 | 159 |
| 144 | 3300005455 | Ga0070663_100442520 | Ga0070663_1004425201 | 159 |
| 145 | 3300005457 | Ga0070662_101061568 | Ga0070662_1010615682 | 159 |
| 146 | 3300005458 | Ga0070681_10306667 | Ga0070681_103066672 | 159 |
| 147 | 3300005466 | Ga0070685_10634249 | Ga0070685_106342491 | 159 |
| 148 | 3300005467 | Ga0070706_100650402 | Ga0070706_1006504022 | 159 |
| 149 | 3300005467 | Ga0070706_100911943 | Ga0070706_1009119431 | 159 |
| 150 | 3300005468 | Ga0070707_100171775 | Ga0070707_1001717752 | 159 |
| 151 | 3300005518 | Ga0070699_100000824 | Ga0070699_10000082428 | 159 |
| 152 | 3300005518 | Ga0070699_100291279 | Ga0070699_1002912792 | 159 |
| 153 | 3300005530 | Ga0070679_100113171 | Ga0070679_1001131714 | 159 |
| 154 | 3300005535 | Ga0070684_100608741 | Ga0070684_1006087412 | 159 |
| 155 | 3300005536 | Ga0070697_100009789 | Ga0070697_1000097895 | 159 |
| 156 | 3300005543 | Ga0070672_100129750 | Ga0070672_1001297503 | 159 |
| 157 | 3300005543 | Ga0070672_100155226 | Ga0070672_1001552262 | 159 |
| 158 | 3300005544 | Ga0070686_101305091 | Ga0070686_1013050911 | 159 |
| 159 | 3300005545 | Ga0070695_100030682 | Ga0070695_1000306821 | 159 |
| 160 | 3300005546 | Ga0070696_100170062 | Ga0070696_1001700622 | 159 |
| 161 | 3300005549 | Ga0070704_100541263 | Ga0070704_1005412632 | 159 |
| 162 | 3300005564 | Ga0070664_100076525 | Ga0070664_1000765253 | 159 |
| 163 | 3300005564 | Ga0070664_100111051 | Ga0070664_1001110513 | 159 |
| 164 | 3300005615 | Ga0070702_100768022 | Ga0070702_1007680221 | 159 |
| 165 | 3300005618 | Ga0068864_100180637 | Ga0068864_1001806372 | 159 |
| 166 | 3300005719 | Ga0068861_100119842 | Ga0068861_1001198422 | 159 |
| 167 | 3300005843 | Ga0068860_100910972 | Ga0068860_1009109722 | 159 |
| 168 | 3300005843 | Ga0068860_101262832 | Ga0068860_1012628322 | 159 |
| 169 | 3300005843 | Ga0068860_101542420 | Ga0068860_1015424202 | 159 |
| 170 | 3300005937 | Ga0081455_10050687 | Ga0081455_100506875 | 159 |
| 171 | 3300006175 | Ga0070712_100105013 | Ga0070712_1001050132 | 159 |
| 172 | 3300006844 | Ga0075428_101149041 | Ga0075428_1011490412 | 159 |
| 173 | 3300006846 | Ga0075430_100109751 | Ga0075430_1001097512 | 159 |
| 174 | 3300006847 | Ga0075431_100064200 | Ga0075431_1000642005 | 159 |
| 175 | 3300006847 | Ga0075431_100747874 | Ga0075431_1007478742 | 159 |
| 176 | 3300006871 | Ga0075434_100091187 | Ga0075434_1000911872 | 159 |
| 177 | 3300009147 | Ga0114129_10274423 | Ga0114129_102744233 | 159 |
| 178 | 3300009147 | Ga0114129_11177214 | Ga0114129_111772142 | 159 |
| 179 | 3300009148 | Ga0105243_10333503 | Ga0105243_103335032 | 159 |
| 180 | 3300009148 | Ga0105243_10880089 | Ga0105243_108800891 | 159 |
| 181 | 3300009174 | Ga0105241_10397937 | Ga0105241_103979372 | 159 |
| 182 | 3300009177 | Ga0105248_10087798 | Ga0105248_100877983 | 159 |
| 183 | 3300009177 | Ga0105248_10099173 | Ga0105248_100991733 | 159 |
| 184 | 3300009177 | Ga0105248_10454509 | Ga0105248_104545093 | 159 |
| 185 | 3300010375 | Ga0105239_11716520 | Ga0105239_117165202 | 159 |
| 186 | 3300013308 | Ga0157375_12008437 | Ga0157375_120084372 | 159 |
| 187 | 3300014325 | Ga0163163_10066631 | Ga0163163_100666312 | 159 |
| 188 | 3300014325 | Ga0163163_10171929 | Ga0163163_101719294 | 159 |
| 189 | 3300014326 | Ga0157380_10654155 | Ga0157380_106541552 | 159 |
| 190 | 3300014326 | Ga0157380_11665764 | Ga0157380_116657642 | 159 |
| 191 | 3300014968 | Ga0157379_10829323 | Ga0157379_108293232 | 159 |
| 192 | 3300014968 | Ga0157379_11046607 | Ga0157379_110466072 | 159 |
| 193 | 3300014969 | Ga0157376_10267374 | Ga0157376_102673743 | 159 |
| 194 | 3300014969 | Ga0157376_11135119 | Ga0157376_111351192 | 159 |
| 195 | 3300015262 | Ga0182007_10206684 | Ga0182007_102066841 | 159 |
| 196 | 3300025911 | Ga0207654_10079503 | Ga0207654_100795032 | 159 |
| 197 | 3300025912 | Ga0207707_10023881 | Ga0207707_100238813 | 159 |
| 198 | 3300025915 | Ga0207693_10330978 | Ga0207693_103309783 | 159 |
| 199 | 3300025916 | Ga0207663_10001490 | Ga0207663_1000149014 | 159 |
| 200 | 3300025917 | Ga0207660_10238060 | Ga0207660_102380602 | 159 |
| 201 | 3300025918 | Ga0207662_10134859 | Ga0207662_101348592 | 159 |
| 202 | 3300025919 | Ga0207657_10738236 | Ga0207657_107382362 | 159 |
| 203 | 3300025921 | Ga0207652_10644804 | Ga0207652_106448042 | 159 |
| 204 | 3300025922 | Ga0207646_10122557 | Ga0207646_101225573 | 159 |
| 205 | 3300025931 | Ga0207644_10513276 | Ga0207644_105132762 | 159 |
| 206 | 3300025932 | Ga0207690_10097772 | Ga0207690_100977723 | 159 |
| 207 | 3300025940 | Ga0207691_10164589 | Ga0207691_101645892 | 159 |
| 208 | 3300025941 | Ga0207711_10055461 | Ga0207711_100554613 | 159 |
| 209 | 3300025941 | Ga0207711_10152177 | Ga0207711_101521773 | 159 |
| 210 | 3300025944 | Ga0207661_10222512 | Ga0207661_102225122 | 159 |
| 211 | 3300025944 | Ga0207661_10244948 | Ga0207661_102449482 | 159 |
| 212 | 3300025945 | Ga0207679_10026253 | Ga0207679_100262534 | 159 |
| 213 | 3300025945 | Ga0207679_10141370 | Ga0207679_101413703 | 159 |
| 214 | 3300025945 | Ga0207679_10210109 | Ga0207679_102101093 | 159 |
| 215 | 3300025960 | Ga0207651_10042005 | Ga0207651_100420052 | 159 |
| 216 | 3300025981 | Ga0207640_10139919 | Ga0207640_101399192 | 159 |
| 217 | 3300026023 | Ga0207677_10754569 | Ga0207677_107545692 | 159 |
| 218 | 3300026067 | Ga0207678_10068814 | Ga0207678_100688144 | 159 |
| 219 | 3300026095 | Ga0207676_10226214 | Ga0207676_102262142 | 159 |
| 220 | 3300026118 | Ga0207675_100090617 | Ga0207675_1000906174 | 159 |
| 221 | 3300026142 | Ga0207698_10494551 | Ga0207698_104945512 | 159 |
| 222 | 3300027471 | Ga0209995_1078555 | Ga0209995_10785551 | 159 |
| 223 | 3300027907 | Ga0207428_10129186 | Ga0207428_101291862 | 159 |
| 224 | 3300028381 | Ga0268264_11333172 | Ga0268264_113331722 | 159 |
| 225 | 3300031548 | Ga0307408_100008337 | Ga0307408_1000083375 | 159 |
| 226 | 3300031548 | Ga0307408_100143062 | Ga0307408_1001430623 | 159 |
| 227 | 3300031548 | Ga0307408_100215144 | Ga0307408_1002151442 | 159 |
| 228 | 3300031548 | Ga0307408_100371672 | Ga0307408_1003716722 | 159 |
| 229 | 3300031731 | Ga0307405_10004488 | Ga0307405_100044886 | 159 |
| 230 | 3300031731 | Ga0307405_10036009 | Ga0307405_100360092 | 159 |
| 231 | 3300031731 | Ga0307405_10501621 | Ga0307405_105016212 | 159 |
| 232 | 3300031824 | Ga0307413_10010972 | Ga0307413_100109721 | 159 |
| 233 | 3300031824 | Ga0307413_10019705 | Ga0307413_100197055 | 159 |
| 234 | 3300031824 | Ga0307413_10036278 | Ga0307413_100362783 | 159 |
| 235 | 3300031824 | Ga0307413_10262852 | Ga0307413_102628522 | 159 |
| 236 | 3300031852 | Ga0307410_10002527 | Ga0307410_100025278 | 159 |
| 237 | 3300031852 | Ga0307410_10010146 | Ga0307410_100101465 | 159 |
| 238 | 3300031852 | Ga0307410_10274470 | Ga0307410_102744703 | 159 |
| 239 | 3300031852 | Ga0307410_10535507 | Ga0307410_105355072 | 159 |
| 240 | 3300031852 | Ga0307410_10570322 | Ga0307410_105703221 | 159 |
| 241 | 3300031901 | Ga0307406_10001688 | Ga0307406_100016882 | 159 |
| 242 | 3300031901 | Ga0307406_10014718 | Ga0307406_100147185 | 159 |
| 243 | 3300031901 | Ga0307406_10198542 | Ga0307406_101985422 | 159 |
| 244 | 3300031901 | Ga0307406_10557723 | Ga0307406_105577232 | 159 |
| 245 | 3300031903 | Ga0307407_10027368 | Ga0307407_100273683 | 159 |
| 246 | 3300031903 | Ga0307407_10453310 | Ga0307407_104533102 | 159 |
| 247 | 3300031911 | Ga0307412_10080294 | Ga0307412_100802943 | 159 |
| 248 | 3300031911 | Ga0307412_10346886 | Ga0307412_103468862 | 159 |
| 249 | 3300031911 | Ga0307412_11419397 | Ga0307412_114193972 | 159 |
| 250 | 3300031995 | Ga0307409_100000144 | Ga0307409_1000001444 | 159 |
| 251 | 3300031995 | Ga0307409_100005669 | Ga0307409_1000056695 | 159 |
| 252 | 3300031995 | Ga0307409_100120314 | Ga0307409_1001203142 | 159 |
| 253 | 3300031995 | Ga0307409_100179122 | Ga0307409_1001791222 | 159 |
| 254 | 3300031995 | Ga0307409_100182609 | Ga0307409_1001826092 | 159 |
| 255 | 3300031995 | Ga0307409_100404155 | Ga0307409_1004041552 | 159 |
| 256 | 3300031995 | Ga0307409_101049244 | Ga0307409_1010492442 | 159 |
| 257 | 3300032002 | Ga0307416_100000828 | Ga0307416_10000082814 | 159 |
| 258 | 3300032002 | Ga0307416_100121404 | Ga0307416_1001214042 | 159 |
| 259 | 3300032002 | Ga0307416_100307518 | Ga0307416_1003075183 | 159 |
| 260 | 3300032002 | Ga0307416_100400666 | Ga0307416_1004006661 | 159 |
| 261 | 3300032002 | Ga0307416_100563387 | Ga0307416_1005633872 | 159 |
| 262 | 3300032002 | Ga0307416_101104424 | Ga0307416_1011044242 | 159 |
| 263 | 3300032002 | Ga0307416_101873449 | Ga0307416_1018734492 | 159 |
| 264 | 3300032004 | Ga0307414_10002383 | Ga0307414_100023833 | 159 |
| 265 | 3300032004 | Ga0307414_10032844 | Ga0307414_100328445 | 159 |
| 266 | 3300032004 | Ga0307414_10137897 | Ga0307414_101378973 | 159 |
| 267 | 3300032004 | Ga0307414_10335255 | Ga0307414_103352552 | 159 |
| 268 | 3300032005 | Ga0307411_10007270 | Ga0307411_100072705 | 159 |
| 269 | 3300032005 | Ga0307411_10038481 | Ga0307411_100384813 | 159 |
| 270 | 3300032005 | Ga0307411_10192544 | Ga0307411_101925443 | 159 |
| 271 | 3300032005 | Ga0307411_10293419 | Ga0307411_102934191 | 159 |
| 272 | 3300032005 | Ga0307411_10856079 | Ga0307411_108560792 | 159 |
| 273 | 3300032126 | Ga0307415_100000419 | Ga0307415_10000041919 | 159 |
| 274 | 3300032126 | Ga0307415_100036475 | Ga0307415_1000364753 | 159 |
| 275 | 3300032126 | Ga0307415_100044728 | Ga0307415_1000447284 | 159 |
| 276 | 3300032126 | Ga0307415_100104570 | Ga0307415_1001045703 | 159 |
| 277 | 3300032126 | Ga0307415_100131985 | Ga0307415_1001319852 | 159 |
| 278 | 3300032126 | Ga0307415_100877952 | Ga0307415_1008779522 | 159 |
| 279 | 3300032126 | Ga0307415_101204795 | Ga0307415_1012047952 | 159 |
| 280 | 3300035112 | Ga0373932_0044489 | Ga0373932_0044489_355_837 | 159 |
| 281 | 3300036401 | Ga0373937_0476569 | Ga0373937_0476569_153_635 | 159 |
| 282 | 3300037471 | Ga0395905_0434509 | Ga0395905_0434509_358_840 | 159 |
| 283 | 3300038996 | Ga0242420_028295 | Ga0242420_028295_390_872 | 159 |
| 284 | 3300041408 | Ga0439453_0033522 | Ga0439453_0033522_330_812 | 159 |
| 285 | 3300041486 | Ga0451807_2555286 | Ga0451807_2555286_657_1139 | 159 |
| 286 | 3300041498 | Ga0451841_0074140 | Ga0451841_0074140_125_607 | 159 |
| 287 | 3300041505 | Ga0451849_0414375 | Ga0451849_0414375_334_816 | 159 |
| 288 | 3300042437 | Ga0439444_0079283 | Ga0439444_0079283_201_695 | 159 |
| 289 | 3300045976 | Ga0466967_1649394 | Ga0466967_1649394_120_602 | 159 |
| 290 | 3300046472 | Ga0495580_0095865 | Ga0495580_0095865_312_794 | 159 |
| 291 | 3300046472 | Ga0495580_0147155 | Ga0495580_0147155_539_1021 | 159 |
| 292 | 3300046475 | Ga0495639_0018403 | Ga0495639_0018403_378_860 | 159 |
| 293 | 3300046476 | Ga0495662_0025907 | Ga0495662_0025907_1377_1859 | 159 |
| 294 | 3300046477 | Ga0495664_0031638 | Ga0495664_0031638_1440_1922 | 159 |
| 295 | 3300046499 | Ga0495594_0007257 | Ga0495594_0007257_1656_2138 | 159 |
| 296 | 3300046514 | Ga0495618_0053276 | Ga0495618_0053276_1581_2063 | 159 |
| 297 | 3300046517 | Ga0495630_0026160 | Ga0495630_0026160_2664_3146 | 159 |
| 298 | 3300046526 | Ga0495666_0013463 | Ga0495666_0013463_3368_3850 | 159 |
| 299 | 3300046535 | Ga0495586_0012895 | Ga0495586_0012895_3666_4148 | 159 |
| 300 | 3300046663 | Ga0495635_0277029 | Ga0495635_0277029_400_882 | 159 |
| 301 | 3300046663 | Ga0495635_0972483 | Ga0495635_0972483_35_517 | 159 |
| 302 | 3300046683 | Ga0495658_0008579 | Ga0495658_0008579_3002_3484 | 159 |
| 303 | 3300046689 | Ga0495613_0165850 | Ga0495613_0165850_484_966 | 159 |
| 304 | 3300047319 | Ga0495674_0131259 | Ga0495674_0131259_522_1004 | 159 |
| 305 | 3300047322 | Ga0495680_0066918 | Ga0495680_0066918_2145_2627 | 159 |
| 306 | 3300047471 | Ga0495684_0070462 | Ga0495684_0070462_1781_2263 | 159 |
| 307 | 3300048903 | Ga0496100_0065280 | Ga0496100_0065280_1054_1536 | 159 |
| 308 | 3300048903 | Ga0496100_0905600 | Ga0496100_0905600_156_638 | 159 |
| 309 | 3300048904 | Ga0496101_0515952 | Ga0496101_0515952_65_547 | 159 |
| 310 | 3300048905 | Ga0496102_0873782 | Ga0496102_0873782_43_525 | 159 |
| 311 | 3300048907 | Ga0496104_0207729 | Ga0496104_0207729_1187_1669 | 159 |
| 312 | 3300048907 | Ga0496104_0698224 | Ga0496104_0698224_406_888 | 159 |
| 313 | 3300048909 | Ga0496106_0053593 | Ga0496106_0053593_290_772 | 159 |
| 314 | 3300048909 | Ga0496106_0366757 | Ga0496106_0366757_586_1068 | 159 |
| 315 | 3300048909 | Ga0496106_0671675 | Ga0496106_0671675_190_672 | 159 |
| 316 | 3300048910 | Ga0496107_0251521 | Ga0496107_0251521_420_902 | 159 |
| 317 | 3300048911 | Ga0496108_0075320 | Ga0496108_0075320_691_1173 | 159 |
| 318 | 3300048911 | Ga0496108_0888305 | Ga0496108_0888305_188_670 | 159 |
| 319 | 3300048912 | Ga0496109_0043903 | Ga0496109_0043903_2924_3406 | 159 |
| 320 | 3300048912 | Ga0496109_0419606 | Ga0496109_0419606_628_1110 | 159 |
| 321 | 3300048913 | Ga0496110_0028810 | Ga0496110_0028810_2288_2770 | 159 |
| 322 | 3300048913 | Ga0496110_0100205 | Ga0496110_0100205_604_1086 | 159 |
| 323 | 3300048915 | Ga0496112_0022223 | Ga0496112_0022223_2748_3230 | 159 |
| 324 | 3300048915 | Ga0496112_0661130 | Ga0496112_0661130_332_814 | 159 |
| 325 | 3300048916 | Ga0496113_0774854 | Ga0496113_0774854_31_513 | 159 |
| 326 | 3300048916 | Ga0496113_1242379 | Ga0496113_1242379_14_496 | 159 |
| 327 | 3300048918 | Ga0496115_0476264 | Ga0496115_0476264_188_670 | 159 |
| 328 | 3300049513 | Ga0501290_017104 | Ga0501290_017104_154_636 | 159 |
| 329 | 3300049568 | Ga0501031_0037498 | Ga0501031_0037498_457_939 | 159 |
| 330 | 3300049568 | Ga0501031_0239043 | Ga0501031_0239043_395_877 | 159 |
| 331 | 3300049569 | Ga0501032_0230541 | Ga0501032_0230541_301_783 | 159 |
| 332 | 3300049570 | Ga0501033_0144217 | Ga0501033_0144217_200_682 | 159 |
| 333 | 3300049571 | Ga0501034_0004342 | Ga0501034_0004342_12124_12606 | 159 |
| 334 | 3300049572 | Ga0501036_0041282 | Ga0501036_0041282_3332_3814 | 159 |
| 335 | 3300049572 | Ga0501036_0055831 | Ga0501036_0055831_25_507 | 159 |
| 336 | 3300049575 | Ga0501039_0383419 | Ga0501039_0383419_425_907 | 159 |
| 337 | 3300049576 | Ga0501040_0050648 | Ga0501040_0050648_1831_2313 | 159 |
| 338 | 3300049576 | Ga0501040_0153098 | Ga0501040_0153098_1078_1560 | 159 |
| 339 | 3300049577 | Ga0501041_0071773 | Ga0501041_0071773_316_798 | 159 |
| 340 | 3300049577 | Ga0501041_0114239 | Ga0501041_0114239_1137_1619 | 159 |
| 341 | 3300049578 | Ga0501042_0056601 | Ga0501042_0056601_1972_2454 | 159 |
| 342 | 3300049580 | Ga0501046_0249628 | Ga0501046_0249628_256_738 | 159 |
| 343 | 3300049580 | Ga0501046_0286677 | Ga0501046_0286677_578_1060 | 159 |
| 344 | 3300049581 | Ga0501047_0187163 | Ga0501047_0187163_1016_1498 | 159 |
| 345 | 3300049582 | Ga0501048_0328180 | Ga0501048_0328180_386_868 | 159 |
| 346 | 3300049582 | Ga0501048_0695086 | Ga0501048_0695086_141_623 | 159 |
| 347 | 3300049583 | Ga0501067_0000353 | Ga0501067_0000353_21270_21752 | 159 |
| 348 | 3300049583 | Ga0501067_0004616 | Ga0501067_0004616_2568_3050 | 159 |
| 349 | 3300049583 | Ga0501067_0022949 | Ga0501067_0022949_2666_3148 | 159 |
| 350 | 3300049583 | Ga0501067_0434366 | Ga0501067_0434366_89_571 | 159 |
| 351 | 3300049584 | Ga0501068_0000022 | Ga0501068_0000022_38116_38598 | 159 |
| 352 | 3300049584 | Ga0501068_0001339 | Ga0501068_0001339_3238_3720 | 159 |
| 353 | 3300049584 | Ga0501068_0389399 | Ga0501068_0389399_93_572 | 159 |
| 354 | 3300049584 | Ga0501068_0460820 | Ga0501068_0460820_285_767 | 159 |
| 355 | 3300049584 | Ga0501068_0561529 | Ga0501068_0561529_74_556 | 159 |
| 356 | 3300049585 | Ga0501069_0000105 | Ga0501069_0000105_165_647 | 159 |
| 357 | 3300049585 | Ga0501069_0001800 | Ga0501069_0001800_7020_7502 | 159 |
| 358 | 3300049585 | Ga0501069_0032461 | Ga0501069_0032461_199_681 | 159 |
| 359 | 3300049585 | Ga0501069_0186503 | Ga0501069_0186503_699_1181 | 159 |
| 360 | 3300049585 | Ga0501069_0197156 | Ga0501069_0197156_611_1093 | 159 |
| 361 | 3300049586 | Ga0501070_0000192 | Ga0501070_0000192_13568_14050 | 159 |
| 362 | 3300049586 | Ga0501070_0027750 | Ga0501070_0027750_1040_1522 | 159 |
| 363 | 3300049586 | Ga0501070_0062415 | Ga0501070_0062415_809_1291 | 159 |
| 364 | 3300049587 | Ga0501071_0000678 | Ga0501071_0000678_12133_12615 | 159 |
| 365 | 3300049587 | Ga0501071_0002547 | Ga0501071_0002547_2073_2555 | 159 |
| 366 | 3300049587 | Ga0501071_1035916 | Ga0501071_1035916_132_614 | 159 |
| 367 | 3300049588 | Ga0501072_0005786 | Ga0501072_0005786_8853_9335 | 159 |
| 368 | 3300049588 | Ga0501072_0009721 | Ga0501072_0009721_4163_4645 | 159 |
| 369 | 3300049588 | Ga0501072_0305978 | Ga0501072_0305978_540_1022 | 159 |
| 370 | 3300049589 | Ga0501073_0000949 | Ga0501073_0000949_5004_5486 | 159 |
| 371 | 3300049589 | Ga0501073_0006186 | Ga0501073_0006186_5677_6159 | 159 |
| 372 | 3300049589 | Ga0501073_0148021 | Ga0501073_0148021_569_1051 | 159 |
| 373 | 3300049589 | Ga0501073_0533643 | Ga0501073_0533643_272_754 | 159 |
| 374 | 3300049589 | Ga0501073_0597224 | Ga0501073_0597224_196_678 | 159 |
| 375 | 3300049590 | Ga0501074_0000171 | Ga0501074_0000171_5802_6284 | 159 |
| 376 | 3300049590 | Ga0501074_0000742 | Ga0501074_0000742_9591_10073 | 159 |
| 377 | 3300049590 | Ga0501074_0171416 | Ga0501074_0171416_452_934 | 159 |
| 378 | 3300049590 | Ga0501074_0207462 | Ga0501074_0207462_750_1232 | 159 |
| 379 | 3300049590 | Ga0501074_0238008 | Ga0501074_0238008_756_1238 | 159 |
| 380 | 3300049590 | Ga0501074_0267314 | Ga0501074_0267314_140_622 | 159 |
| 381 | 3300049590 | Ga0501074_0478565 | Ga0501074_0478565_124_606 | 159 |
| 382 | 3300049591 | Ga0501075_0018150 | Ga0501075_0018150_4499_4981 | 159 |
| 383 | 3300049591 | Ga0501075_1116760 | Ga0501075_1116760_87_569 | 159 |
| 384 | 3300049592 | Ga0501076_0021090 | Ga0501076_0021090_3726_4208 | 159 |
| 385 | 3300049592 | Ga0501076_0272461 | Ga0501076_0272461_334_816 | 159 |
| 386 | 3300049593 | Ga0501077_0004768 | Ga0501077_0004768_7015_7497 | 159 |
| 387 | 3300049593 | Ga0501077_0064921 | Ga0501077_0064921_1327_1809 | 159 |
| 388 | 3300049593 | Ga0501077_0422306 | Ga0501077_0422306_238_735 | 159 |
| 389 | 3300049652 | Ga0501202_013730 | Ga0501202_013730_319_801 | 159 |
| 390 | 3300049675 | Ga0501243_028915 | Ga0501243_028915_61_543 | 159 |
| 391 | 3300049683 | Ga0501253_076377 | Ga0501253_076377_213_695 | 159 |
| 392 | 3300049741 | Ga0501079_0065742 | Ga0501079_0065742_435_917 | 159 |
| 393 | 3300049741 | Ga0501079_0076548 | Ga0501079_0076548_1507_1989 | 159 |
| 394 | 3300049741 | Ga0501079_0076836 | Ga0501079_0076836_248_730 | 159 |
| 395 | 3300049741 | Ga0501079_0127383 | Ga0501079_0127383_1387_1869 | 159 |
| 396 | 3300049741 | Ga0501079_1239801 | Ga0501079_1239801_83_565 | 159 |
| 397 | 3300049742 | Ga0501080_0000060 | Ga0501080_0000060_12124_12606 | 159 |
| 398 | 3300049742 | Ga0501080_0005735 | Ga0501080_0005735_4258_4740 | 159 |
| 399 | 3300049742 | Ga0501080_0006023 | Ga0501080_0006023_8312_8794 | 159 |
| 400 | 3300049742 | Ga0501080_0111578 | Ga0501080_0111578_1838_2320 | 159 |
| 401 | 3300049742 | Ga0501080_0297281 | Ga0501080_0297281_337_819 | 159 |
| 402 | 3300049742 | Ga0501080_0484844 | Ga0501080_0484844_70_552 | 159 |
| 403 | 3300049743 | Ga0501081_0050168 | Ga0501081_0050168_1276_1758 | 159 |
| 404 | 3300049743 | Ga0501081_0718839 | Ga0501081_0718839_108_590 | 159 |
| 405 | 3300049744 | Ga0501083_0008037 | Ga0501083_0008037_3423_3905 | 159 |
| 406 | 3300049744 | Ga0501083_0393052 | Ga0501083_0393052_142_624 | 159 |
| 407 | 3300049765 | Ga0501268_039996 | Ga0501268_039996_16_498 | 159 |
| 408 | 3300049767 | Ga0501270_059470 | Ga0501270_059470_76_558 | 159 |
| 409 | 3300049779 | Ga0501283_049060 | Ga0501283_049060_51_533 | 159 |
| 410 | 3300049822 | Ga0501035_0315717 | Ga0501035_0315717_152_634 | 159 |
| 411 | 3300049824 | Ga0501045_0009723 | Ga0501045_0009723_2621_3103 | 159 |
| 412 | 3300049824 | Ga0501045_0014038 | Ga0501045_0014038_4866_5348 | 159 |
| 413 | 3300050507 | nmdc:mga05p37_186756_c1 | nmdc:mga05p37_186756_c1_1813_2295 | 159 |
| 414 | 3300050510 | nmdc:mga06r32_77166_c1 | nmdc:mga06r32_77166_c1_1315_1797 | 159 |
| 415 | 3300050510 | nmdc:mga06r32_882482_c1 | nmdc:mga06r32_882482_c1_13_498 | 159 |
| 416 | 3300050512 | nmdc:mga0n895_108355_c1 | nmdc:mga0n895_108355_c1_1900_2382 | 159 |
| 417 | 3300050515 | nmdc:mga0a205_7709_c1 | nmdc:mga0a205_7709_c1_332_814 | 159 |
| 418 | 3300054114 | Ga0501084_0001187 | Ga0501084_0001187_13363_13845 | 159 |
| 419 | 3300054114 | Ga0501084_0002953 | Ga0501084_0002953_12115_12597 | 159 |
| 420 | 3300054114 | Ga0501084_0170156 | Ga0501084_0170156_72_554 | 159 |
| 421 | 3300054114 | Ga0501084_0202134 | Ga0501084_0202134_1003_1485 | 159 |
| 422 | 3300054114 | Ga0501084_0246566 | Ga0501084_0246566_441_923 | 159 |
| 423 | 3300059421 | Ga0590071_015280 | Ga0590071_015280_559_1041 | 159 |
| 424 | 3300060353 | Ga0501082_0006728 | Ga0501082_0006728_7020_7502 | 159 |
| 425 | 3300060353 | Ga0501082_0139082 | Ga0501082_0139082_195_677 | 159 |
| 426 | 3300060353 | Ga0501082_0399315 | Ga0501082_0399315_137_619 | 159 |
| 427 | 3300060353 | Ga0501082_0767316 | Ga0501082_0767316_340_822 | 159 |
| 428 | 3300060353 | Ga0501082_1125055 | Ga0501082_1125055_14_496 | 159 |
| 429 | 3300061734 | Ga0530510_0092799 | Ga0530510_0092799_1449_1931 | 159 |
| 430 | 3300005293 | Ga0065715_10072244 | Ga0065715_100722441 | 160 |
| 431 | 3300005329 | Ga0070683_100058762 | Ga0070683_1000587623 | 160 |
| 432 | 3300005339 | Ga0070660_100949199 | Ga0070660_1009491991 | 160 |
| 433 | 3300005345 | Ga0070692_10013691 | Ga0070692_100136913 | 160 |
| 434 | 3300005347 | Ga0070668_100594652 | Ga0070668_1005946521 | 160 |
| 435 | 3300005353 | Ga0070669_100160201 | Ga0070669_1001602013 | 160 |
| 436 | 3300005444 | Ga0070694_100028827 | Ga0070694_1000288273 | 160 |
| 437 | 3300005455 | Ga0070663_100230667 | Ga0070663_1002306672 | 160 |
| 438 | 3300005457 | Ga0070662_100636564 | Ga0070662_1006365641 | 160 |
| 439 | 3300005468 | Ga0070707_101121778 | Ga0070707_1011217782 | 160 |
| 440 | 3300005518 | Ga0070699_100065250 | Ga0070699_1000652503 | 160 |
| 441 | 3300005535 | Ga0070684_100026677 | Ga0070684_1000266773 | 160 |
| 442 | 3300005543 | Ga0070672_100203555 | Ga0070672_1002035553 | 160 |
| 443 | 3300005545 | Ga0070695_100180696 | Ga0070695_1001806963 | 160 |
| 444 | 3300005563 | Ga0068855_100251326 | Ga0068855_1002513263 | 160 |
| 445 | 3300005564 | Ga0070664_100159760 | Ga0070664_1001597602 | 160 |
| 446 | 3300005719 | Ga0068861_100492059 | Ga0068861_1004920592 | 160 |
| 447 | 3300005841 | Ga0068863_100696157 | Ga0068863_1006961572 | 160 |
| 448 | 3300005843 | Ga0068860_100139566 | Ga0068860_1001395662 | 160 |
| 449 | 3300005844 | Ga0068862_100093687 | Ga0068862_1000936874 | 160 |
| 450 | 3300007076 | Ga0075435_100241786 | Ga0075435_1002417862 | 160 |
| 451 | 3300009553 | Ga0105249_10020246 | Ga0105249_100202465 | 160 |
| 452 | 3300012495 | Ga0157323_1010152 | Ga0157323_10101522 | 160 |
| 453 | 3300013308 | Ga0157375_10873090 | Ga0157375_108730902 | 160 |
| 454 | 3300014326 | Ga0157380_10172196 | Ga0157380_101721963 | 160 |
| 455 | 3300014968 | Ga0157379_10265372 | Ga0157379_102653722 | 160 |
| 456 | 3300025923 | Ga0207681_10023462 | Ga0207681_100234624 | 160 |
| 457 | 3300025932 | Ga0207690_10516577 | Ga0207690_105165772 | 160 |
| 458 | 3300025933 | Ga0207706_10361664 | Ga0207706_103616642 | 160 |
| 459 | 3300025945 | Ga0207679_10070401 | Ga0207679_100704013 | 160 |
| 460 | 3300025949 | Ga0207667_10310692 | Ga0207667_103106922 | 160 |
| 461 | 3300025961 | Ga0207712_10081403 | Ga0207712_100814032 | 160 |
| 462 | 3300025972 | Ga0207668_10309425 | Ga0207668_103094252 | 160 |
| 463 | 3300026067 | Ga0207678_10289810 | Ga0207678_102898102 | 160 |
| 464 | 3300026078 | Ga0207702_11059431 | Ga0207702_110594312 | 160 |
| 465 | 3300026118 | Ga0207675_100821073 | Ga0207675_1008210732 | 160 |
| 466 | 3300028380 | Ga0268265_10072005 | Ga0268265_100720053 | 160 |
| 467 | 3300028381 | Ga0268264_10020367 | Ga0268264_100203672 | 160 |
| 468 | 3300031731 | Ga0307405_10240206 | Ga0307405_102402063 | 160 |
| 469 | 3300031903 | Ga0307407_10054888 | Ga0307407_100548883 | 160 |
| 470 | 3300031903 | Ga0307407_10086253 | Ga0307407_100862533 | 160 |
| 471 | 3300031903 | Ga0307407_10617161 | Ga0307407_106171612 | 160 |
| 472 | 3300031995 | Ga0307409_100009411 | Ga0307409_1000094114 | 160 |
| 473 | 3300031995 | Ga0307409_100026152 | Ga0307409_1000261525 | 160 |
| 474 | 3300032002 | Ga0307416_100528993 | Ga0307416_1005289932 | 160 |
| 475 | 3300032005 | Ga0307411_10157364 | Ga0307411_101573642 | 160 |
| 476 | 3300032126 | Ga0307415_100293152 | Ga0307415_1002931522 | 160 |
| 477 | 3300035121 | Ga0373960_0232818 | Ga0373960_0232818_77_565 | 160 |
| 478 | 3300035242 | Ga0373962_0134193 | Ga0373962_0134193_58_546 | 160 |
| 479 | 3300039437 | Ga0436365_0504187 | Ga0436365_0504187_46_537 | 160 |
| 480 | 3300042876 | Ga0451577_0061655 | Ga0451577_0061655_505_993 | 160 |
| 481 | 3300044712 | Ga0453684_0210433 | Ga0453684_0210433_595_1083 | 160 |
| 482 | 3300046474 | Ga0495605_0259700 | Ga0495605_0259700_41_532 | 160 |
| 483 | 3300048905 | Ga0496102_0269133 | Ga0496102_0269133_765_1253 | 160 |
| 484 | 3300048906 | Ga0496103_0071001 | Ga0496103_0071001_987_1475 | 160 |
| 485 | 3300048909 | Ga0496106_1134556 | Ga0496106_1134556_98_586 | 160 |
| 486 | 3300048910 | Ga0496107_0110621 | Ga0496107_0110621_277_765 | 160 |
| 487 | 3300049526 | Ga0501303_045128 | Ga0501303_045128_19_507 | 160 |
| 488 | 3300049690 | Ga0501261_020553 | Ga0501261_020553_192_680 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8i8i-assembly2.cif.gz_C-2 | crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution | 0.9737 | 2 | 160 |
| 6b7d-assembly1.cif.gz_A | crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 3-(4-chlorophenyl)-6-methoxy-4,5-dimethylpyridazine | 0.9694 | 2 | 159 |
| 6b7b-assembly1.cif.gz_A | crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole | 0.9685 | 2 | 159 |
| 8i8i-assembly2.cif.gz_C-2 | crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution | 0.9677 | 2 | 160 |
| 8i8j-assembly1.cif.gz_B | error: 404 client error: for url: https://data.rcsb.org/rest/v1/core/entry/8i8j | 0.9668 | 1 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9607 | 4 | 160 | 3.40.50.620 |
| 3nbkD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9553 | 1 | 160 | 3.40.50.620 |
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9479 | 4 | 160 | 3.40.50.620 |
| 5ts2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9475 | 1 | 160 | 3.40.50.620 |
| 3nbkD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9438 | 1 | 160 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1W9PQH9-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9845 | 4 | 122 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A5V280-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.983 | 4 | 159 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-X1CLR4-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) | 0.9804 | 4 | 115 |
GO:0004595
GO:0005737 GO:0015937 |
| AF-A0A373F7U0-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9787 | 4 | 160 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A3C0YCS7-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.977 | 1 | 159 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar