F453544

General Info

Members Datasets Scaffolds Average Seq Length
488 248 488 161

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10510494|Ga0070658_105104941
Length 165
Sequence MSKVAIYAGTFDPITRGHQDLIERSLTFCDRLVVAVASNSSKAPLFSADERVALVREVVGNDPRVEVRMLKGQLLVDFARDVGATLLIRGLRAVSDFEYEFQMALMNRHLAPIETVFMVPSLDTTYISSSIVREVARYGGRVDDLLHPSVAAALRRKMDERPKPD

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
148 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
149 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
150 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
151 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
152 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
153 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
199 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
224 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
225 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
226 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
227 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
233 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
234 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.53
Rhizosphere 93.85
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10072244 3300005293 Bacteria 596
2 Ga0065707_10585356 3300005295 Bacteria 699
3 Ga0070658_10510494 3300005327 Bacteria 1039
4 Ga0070683_100058762 3300005329 Bacteria 3572
5 Ga0070683_100339704 3300005329 Bacteria 1430
6 Ga0070670_100963913 3300005331 Bacteria 775
7 Ga0070680_100020187 3300005336 Bacteria 5287
8 Ga0070680_100030601 3300005336 Bacteria 4325
9 Ga0070680_100050348 3300005336 Bacteria 3397
10 Ga0070660_100151501 3300005339 Bacteria 1865
11 Ga0070660_100500706 3300005339 Bacteria 1011
12 Ga0070660_100949199 3300005339 Bacteria 726
13 Ga0070691_10188568 3300005341 Bacteria 1077
14 Ga0070661_100003411 3300005344 Bacteria 10978
15 Ga0070661_100862154 3300005344 Bacteria 746
16 Ga0070692_10013691 3300005345 Bacteria 3788
17 Ga0070668_100148391 3300005347 Bacteria 1894
18 Ga0070668_100594652 3300005347 Bacteria 967
19 Ga0070668_100687019 3300005347 Unclassified 902
20 Ga0070669_100003079 3300005353 Bacteria 12001
21 Ga0070669_100160201 3300005353 Bacteria 1748
22 Ga0070669_100895017 3300005353 Bacteria 758
23 Ga0070671_100993761 3300005355 Bacteria 735
24 Ga0070659_100017963 3300005366 Bacteria 5330
25 Ga0070711_100001286 3300005439 Bacteria 13623
26 Ga0070705_101171262 3300005440 Bacteria 632
27 Ga0070694_100028827 3300005444 Bacteria 3616
28 Ga0070694_101167799 3300005444 Bacteria 644
29 Ga0070708_100079242 3300005445 Bacteria 2971
30 Ga0070663_100026569 3300005455 Bacteria 3923
31 Ga0070663_100230667 3300005455 Bacteria 1458
32 Ga0070663_100442520 3300005455 Bacteria 1070
33 Ga0070678_100220569 3300005456 Bacteria 1576
34 Ga0070662_100475570 3300005457 Bacteria 1040
35 Ga0070662_100636564 3300005457 Bacteria 899
36 Ga0070662_101061568 3300005457 Bacteria 694
37 Ga0070681_10008932 3300005458 Bacteria 9851
38 Ga0070681_10010307 3300005458 Bacteria 9226
39 Ga0070681_10077498 3300005458 Bacteria 3281
40 Ga0070681_10306667 3300005458 Bacteria 1497
41 Ga0068867_101010449 3300005459 Bacteria 755
42 Ga0070685_10634249 3300005466 Unclassified 772
43 Ga0070706_100650402 3300005467 Bacteria 979
44 Ga0070706_100911943 3300005467 Bacteria 812
45 Ga0070707_100171775 3300005468 Bacteria 2112
46 Ga0070707_101121778 3300005468 Bacteria 752
47 Ga0070699_100000824 3300005518 Bacteria 28768
48 Ga0070699_100065250 3300005518 Bacteria 3159
49 Ga0070699_100291279 3300005518 Bacteria 1464
50 Ga0070679_100014954 3300005530 Bacteria 7456
51 Ga0070679_100036230 3300005530 Bacteria 4896
52 Ga0070679_100043081 3300005530 Bacteria 4496
53 Ga0070679_100113171 3300005530 Bacteria 2699
54 Ga0070684_100026677 3300005535 Bacteria 4868
55 Ga0070684_100608741 3300005535 Bacteria 1016
56 Ga0070697_100009789 3300005536 Bacteria 7476
57 Ga0068853_100013646 3300005539 Bacteria 6638
58 Ga0070672_100129750 3300005543 Bacteria 2071
59 Ga0070672_100155226 3300005543 Bacteria 1895
60 Ga0070672_100203555 3300005543 Bacteria 1656
61 Ga0070672_100231388 3300005543 Bacteria 1553
62 Ga0070686_101305091 3300005544 Bacteria 606
63 Ga0070695_100030682 3300005545 Bacteria 3348
64 Ga0070695_100180696 3300005545 Bacteria 1495
65 Ga0070696_100170062 3300005546 Bacteria 1610
66 Ga0070665_100042538 3300005548 Bacteria 4567
67 Ga0070704_100541263 3300005549 Bacteria 1016
68 Ga0068855_100008571 3300005563 Bacteria 12363
69 Ga0068855_100251326 3300005563 Bacteria 1972
70 Ga0070664_100076525 3300005564 Bacteria 2876
71 Ga0070664_100111051 3300005564 Bacteria 2393
72 Ga0070664_100159760 3300005564 Bacteria 1993
73 Ga0070664_100206975 3300005564 Bacteria 1752
74 Ga0068857_100214040 3300005577 Bacteria 1759
75 Ga0070702_100768022 3300005615 Bacteria 742
76 Ga0068852_100069165 3300005616 Bacteria 3093
77 Ga0068864_100180637 3300005618 Bacteria 1929
78 Ga0068861_100119842 3300005719 Bacteria 2121
79 Ga0068861_100492059 3300005719 Bacteria 1107
80 Ga0068861_100844213 3300005719 Bacteria 863
81 Ga0068870_10002079 3300005840 Bacteria 8295
82 Ga0068863_100696157 3300005841 Bacteria 1010
83 Ga0068860_100139566 3300005843 Bacteria 2329
84 Ga0068860_100910972 3300005843 Bacteria 895
85 Ga0068860_101262832 3300005843 Unclassified 759
86 Ga0068860_101542420 3300005843 Bacteria 686
87 Ga0068862_100000376 3300005844 Bacteria 48418
88 Ga0068862_100093687 3300005844 Bacteria 2619
89 Ga0068862_100599645 3300005844 Bacteria 1057
90 Ga0081455_10050687 3300005937 Bacteria 3566
91 Ga0070717_11392994 3300006028 Bacteria 637
92 Ga0070712_100105013 3300006175 Bacteria 2097
93 Ga0075428_101147254 3300006844 Bacteria 820
94 Ga0075428_101149041 3300006844 Bacteria 819
95 Ga0075430_100109751 3300006846 Bacteria 2301
96 Ga0075431_100064200 3300006847 Bacteria 3791
97 Ga0075431_100747874 3300006847 Bacteria 953
98 Ga0075434_100091187 3300006871 Bacteria 3049
99 Ga0075429_100021264 3300006880 Bacteria 5624
100 Ga0075429_100665963 3300006880 Bacteria 912
101 Ga0068865_100020297 3300006881 Bacteria 4308
102 Ga0075435_100241786 3300007076 Bacteria 1536
103 Ga0105240_10074073 3300009093 Bacteria 4204
104 Ga0114129_10274423 3300009147 Bacteria 2255
105 Ga0114129_11177214 3300009147 Bacteria 956
106 Ga0105243_10333503 3300009148 Bacteria 1386
107 Ga0105243_10744155 3300009148 Bacteria 960
108 Ga0105243_10880089 3300009148 Bacteria 889
109 Ga0105241_10116790 3300009174 Bacteria 2143
110 Ga0105241_10397937 3300009174 Bacteria 1207
111 Ga0105248_10087798 3300009177 Bacteria 3500
112 Ga0105248_10099173 3300009177 Bacteria 3282
113 Ga0105248_10454509 3300009177 Bacteria 1443
114 Ga0105238_10073038 3300009551 Bacteria 3425
115 Ga0105249_10000115 3300009553 Bacteria 108581
116 Ga0105249_10000454 3300009553 Bacteria 38498
117 Ga0105249_10020246 3300009553 Bacteria 5947
118 Ga0105249_10262497 3300009553 Bacteria 1717
119 Ga0105239_11716520 3300010375 Bacteria 727
120 Ga0157323_1010152 3300012495 Bacteria 735
121 Ga0157370_10165029 3300013104 Bacteria 2060
122 Ga0157369_10115485 3300013105 Bacteria 2851
123 Ga0157369_10154139 3300013105 Bacteria 2428
124 Ga0163162_10059365 3300013306 Bacteria 3856
125 Ga0157372_10683897 3300013307 Bacteria 1194
126 Ga0157372_10847696 3300013307 Bacteria 1061
127 Ga0157375_10873090 3300013308 Bacteria 1045
128 Ga0157375_12008437 3300013308 Unclassified 687
129 Ga0163163_10066631 3300014325 Bacteria 3577
130 Ga0163163_10171929 3300014325 Bacteria 2213
131 Ga0163163_10806932 3300014325 Bacteria 1002
132 Ga0157380_10172196 3300014326 Bacteria 1893
133 Ga0157380_10654155 3300014326 Bacteria 1049
134 Ga0157380_11665764 3300014326 Bacteria 695
135 Ga0157379_10265372 3300014968 Bacteria 1561
136 Ga0157379_10829323 3300014968 Bacteria 874
137 Ga0157379_11046607 3300014968 Bacteria 780
138 Ga0157376_10211400 3300014969 Bacteria 1791
139 Ga0157376_10267374 3300014969 Bacteria 1605
140 Ga0157376_11135119 3300014969 Bacteria 808
141 Ga0182007_10206684 3300015262 Bacteria 688
142 Ga0207645_10067632 3300025907 Bacteria 2284
143 Ga0207643_10001951 3300025908 Bacteria 11403
144 Ga0207705_10089643 3300025909 Bacteria 2251
145 Ga0207705_10379726 3300025909 Bacteria 1091
146 Ga0207654_10079503 3300025911 Bacteria 1970
147 Ga0207707_10007791 3300025912 Bacteria 9323
148 Ga0207707_10023881 3300025912 Bacteria 5346
149 Ga0207707_10041733 3300025912 Bacteria 4006
150 Ga0207707_10412454 3300025912 Bacteria 1159
151 Ga0207695_10081615 3300025913 Bacteria 3272
152 Ga0207693_10330978 3300025915 Bacteria 1192
153 Ga0207663_10001490 3300025916 Bacteria 10915
154 Ga0207660_10095373 3300025917 Bacteria 2213
155 Ga0207660_10238060 3300025917 Bacteria 1433
156 Ga0207660_10441739 3300025917 Bacteria 1051
157 Ga0207662_10134859 3300025918 Bacteria 1560
158 Ga0207657_10005262 3300025919 Bacteria 13552
159 Ga0207657_10738236 3300025919 Bacteria 763
160 Ga0207649_10096437 3300025920 Bacteria 1948
161 Ga0207652_10008367 3300025921 Bacteria 8321
162 Ga0207652_10024204 3300025921 Bacteria 5036
163 Ga0207652_10031148 3300025921 Bacteria 4476
164 Ga0207652_10644804 3300025921 Bacteria 947
165 Ga0207646_10122557 3300025922 Bacteria 2336
166 Ga0207681_10003561 3300025923 Bacteria 9699
167 Ga0207681_10023462 3300025923 Bacteria 3947
168 Ga0207644_10513276 3300025931 Bacteria 990
169 Ga0207690_10097772 3300025932 Bacteria 2089
170 Ga0207690_10516577 3300025932 Bacteria 968
171 Ga0207706_10076182 3300025933 Bacteria 2950
172 Ga0207706_10361664 3300025933 Bacteria 1261
173 Ga0207709_10193874 3300025935 Bacteria 1445
174 Ga0207691_10052046 3300025940 Bacteria 3741
175 Ga0207691_10164589 3300025940 Bacteria 1944
176 Ga0207711_10055461 3300025941 Bacteria 3402
177 Ga0207711_10152177 3300025941 Bacteria 2088
178 Ga0207661_10222512 3300025944 Bacteria 1669
179 Ga0207661_10244948 3300025944 Bacteria 1592
180 Ga0207679_10026253 3300025945 Bacteria 4015
181 Ga0207679_10070401 3300025945 Bacteria 2636
182 Ga0207679_10141370 3300025945 Bacteria 1946
183 Ga0207679_10210109 3300025945 Bacteria 1631
184 Ga0207667_10081585 3300025949 Bacteria 3350
185 Ga0207667_10310692 3300025949 Bacteria 1610
186 Ga0207651_10042005 3300025960 Unclassified 3040
187 Ga0207712_10000499 3300025961 Bacteria 32439
188 Ga0207712_10001176 3300025961 Bacteria 18145
189 Ga0207712_10081403 3300025961 Bacteria 2358
190 Ga0207712_10797805 3300025961 Bacteria 830
191 Ga0207668_10309425 3300025972 Bacteria 1307
192 Ga0207668_10614131 3300025972 Bacteria 948
193 Ga0207640_10139919 3300025981 Bacteria 1763
194 Ga0207677_10754569 3300026023 Bacteria 868
195 Ga0207678_10068814 3300026067 Bacteria 3036
196 Ga0207678_10289810 3300026067 Bacteria 1406
197 Ga0207678_10620997 3300026067 Unclassified 948
198 Ga0207702_10057844 3300026078 Bacteria 3297
199 Ga0207702_11059431 3300026078 Bacteria 805
200 Ga0207648_10023923 3300026089 Bacteria 5460
201 Ga0207676_10226214 3300026095 Bacteria 1669
202 Ga0207676_10680541 3300026095 Bacteria 995
203 Ga0207674_10179106 3300026116 Bacteria 2071
204 Ga0207675_100059762 3300026118 Bacteria 3558
205 Ga0207675_100090617 3300026118 Bacteria 2875
206 Ga0207675_100821073 3300026118 Bacteria 944
207 Ga0207698_10013973 3300026142 Bacteria 5318
208 Ga0207698_10494551 3300026142 Bacteria 1189
209 Ga0209995_1078555 3300027471 Bacteria 566
210 Ga0207428_10129186 3300027907 Bacteria 1934
211 Ga0268266_10935521 3300028379 Bacteria 838
212 Ga0268265_10002121 3300028380 Bacteria 15384
213 Ga0268265_10072005 3300028380 Bacteria 2694
214 Ga0268265_10554481 3300028380 Bacteria 1091
215 Ga0268264_10020367 3300028381 Bacteria 5421
216 Ga0268264_11333172 3300028381 Bacteria 728
217 Ga0268264_12075754 3300028381 Bacteria 577
218 Ga0307408_100008337 3300031548 Bacteria 6844
219 Ga0307408_100143062 3300031548 Bacteria 1879
220 Ga0307408_100215144 3300031548 Bacteria 1564
221 Ga0307408_100371672 3300031548 Bacteria 1219
222 Ga0307408_100540701 3300031548 Bacteria 1026
223 Ga0307405_10004488 3300031731 Bacteria 6603
224 Ga0307405_10036009 3300031731 Bacteria 2962
225 Ga0307405_10240206 3300031731 Bacteria 1341
226 Ga0307405_10501621 3300031731 Bacteria 973
227 Ga0307413_10010972 3300031824 Bacteria 4427
228 Ga0307413_10019705 3300031824 Bacteria 3571
229 Ga0307413_10036278 3300031824 Bacteria 2837
230 Ga0307413_10165887 3300031824 Bacteria 1557
231 Ga0307413_10262852 3300031824 Bacteria 1287
232 Ga0307413_10390592 3300031824 Bacteria 1087
233 Ga0307413_10446736 3300031824 Bacteria 1025
234 Ga0307410_10002527 3300031852 Bacteria 8847
235 Ga0307410_10010146 3300031852 Bacteria 5323
236 Ga0307410_10274470 3300031852 Bacteria 1320
237 Ga0307410_10535507 3300031852 Bacteria 968
238 Ga0307410_10570322 3300031852 Bacteria 940
239 Ga0307406_10001688 3300031901 Bacteria 12133
240 Ga0307406_10014718 3300031901 Bacteria 4506
241 Ga0307406_10198542 3300031901 Bacteria 1474
242 Ga0307406_10557723 3300031901 Bacteria 938
243 Ga0307407_10018599 3300031903 Bacteria 3518
244 Ga0307407_10027368 3300031903 Bacteria 3033
245 Ga0307407_10054888 3300031903 Bacteria 2300
246 Ga0307407_10086253 3300031903 Bacteria 1912
247 Ga0307407_10453310 3300031903 Bacteria 931
248 Ga0307407_10617161 3300031903 Bacteria 809
249 Ga0307412_10080294 3300031911 Bacteria 2253
250 Ga0307412_10346886 3300031911 Bacteria 1190
251 Ga0307412_11419397 3300031911 Bacteria 629
252 Ga0307409_100000144 3300031995 Bacteria 26764
253 Ga0307409_100005669 3300031995 Bacteria 7231
254 Ga0307409_100009411 3300031995 Bacteria 6000
255 Ga0307409_100026152 3300031995 Bacteria 4111
256 Ga0307409_100120314 3300031995 Bacteria 2222
257 Ga0307409_100179122 3300031995 Bacteria 1874
258 Ga0307409_100182609 3300031995 Bacteria 1859
259 Ga0307409_100404155 3300031995 Bacteria 1305
260 Ga0307409_101049244 3300031995 Unclassified 835
261 Ga0307416_100000828 3300032002 Bacteria 16247
262 Ga0307416_100085434 3300032002 Bacteria 2686
263 Ga0307416_100121404 3300032002 Bacteria 2330
264 Ga0307416_100137033 3300032002 Bacteria 2216
265 Ga0307416_100307518 3300032002 Bacteria 1579
266 Ga0307416_100400666 3300032002 Bacteria 1409
267 Ga0307416_100528993 3300032002 Unclassified 1249
268 Ga0307416_100563387 3300032002 Bacteria 1214
269 Ga0307416_101104424 3300032002 Bacteria 898
270 Ga0307416_101873449 3300032002 Bacteria 703
271 Ga0307414_10002383 3300032004 Bacteria 9831
272 Ga0307414_10032844 3300032004 Bacteria 3422
273 Ga0307414_10137897 3300032004 Bacteria 1905
274 Ga0307414_10335255 3300032004 Bacteria 1293
275 Ga0307414_10484407 3300032004 Bacteria 1091
276 Ga0307411_10007270 3300032005 Bacteria 5620
277 Ga0307411_10016984 3300032005 Bacteria 4132
278 Ga0307411_10038481 3300032005 Bacteria 3017
279 Ga0307411_10157364 3300032005 Bacteria 1697
280 Ga0307411_10192544 3300032005 Bacteria 1558
281 Ga0307411_10293419 3300032005 Bacteria 1300
282 Ga0307411_10856079 3300032005 Bacteria 805
283 Ga0307415_100000419 3300032126 Bacteria 18192
284 Ga0307415_100036475 3300032126 Bacteria 3222
285 Ga0307415_100044728 3300032126 Bacteria 2962
286 Ga0307415_100104570 3300032126 Bacteria 2086
287 Ga0307415_100131985 3300032126 Bacteria 1893
288 Ga0307415_100293152 3300032126 Bacteria 1344
289 Ga0307415_100563413 3300032126 Bacteria 1007
290 Ga0307415_100877952 3300032126 Bacteria 825
291 Ga0307415_101204795 3300032126 Bacteria 713
292 Ga0373926_0004167 3300035083 Bacteria 4716
293 Ga0373932_0044489 3300035112 Bacteria 1295
294 Ga0373945_0027811 3300035116 Bacteria 1977
295 Ga0373960_0232818 3300035121 Bacteria 663
296 Ga0373943_0016857 3300035170 Bacteria 3338
297 Ga0373962_0134193 3300035242 Bacteria 799
298 Ga0373935_0018031 3300035692 Bacteria 4290
299 Ga0373935_0340967 3300035692 Bacteria 1067
300 Ga0373927_0026060 3300035695 Bacteria 3821
301 Ga0373947_0002126 3300035725 Bacteria 12064
302 Ga0373937_0476569 3300036401 Bacteria 1185
303 Ga0373925_0013098 3300037068 Bacteria 6002
304 Ga0395905_0434509 3300037471 Bacteria 1210
305 Ga0242420_028295 3300038996 Unclassified 1031
306 Ga0436365_0504187 3300039437 Bacteria 1133
307 Ga0439453_0033522 3300041408 Bacteria 982
308 Ga0451807_2555286 3300041486 Bacteria 1904
309 Ga0451841_0074140 3300041498 Bacteria 730
310 Ga0451849_0414375 3300041505 Bacteria 987
311 Ga0439454_017522 3300042011 Bacteria 1024
312 Ga0450921_001219 3300042123 Bacteria 1502
313 Ga0450898_068549 3300042134 Bacteria 707
314 Ga0439434_0115927 3300042435 Bacteria 870
315 Ga0439444_0079283 3300042437 Bacteria 716
316 Ga0451577_0003975 3300042876 Bacteria 15941
317 Ga0451577_0061655 3300042876 Bacteria 3345
318 Ga0466961_0592676 3300044693 Bacteria 667
319 Ga0453684_0210433 3300044712 Bacteria 2261
320 Ga0466959_0528410 3300045049 Bacteria 796
321 Ga0466958_0573571 3300045836 Bacteria 733
322 Ga0466967_1649394 3300045976 Bacteria 639
323 Ga0495629_0025075 3300046459 Bacteria 4241
324 Ga0495580_0095865 3300046472 Bacteria 2063
325 Ga0495580_0147155 3300046472 Bacteria 1632
326 Ga0495605_0259700 3300046474 Bacteria 742
327 Ga0495639_0000549 3300046475 Bacteria 17446
328 Ga0495639_0018403 3300046475 Bacteria 3041
329 Ga0495662_0025907 3300046476 Bacteria 2833
330 Ga0495664_0031638 3300046477 Bacteria 3103
331 Ga0495594_0007257 3300046499 Bacteria 5700
332 Ga0495618_0053276 3300046514 Bacteria 2558
333 Ga0495630_0002236 3300046517 Bacteria 13469
334 Ga0495630_0026160 3300046517 Bacteria 4319
335 Ga0495666_0013463 3300046526 Bacteria 4079
336 Ga0495665_0000358 3300046531 Bacteria 23104
337 Ga0495586_0012895 3300046535 Bacteria 4432
338 Ga0495635_0277029 3300046663 Bacteria 1127
339 Ga0495635_0972483 3300046663 Unclassified 541
340 Ga0495588_0012498 3300046674 Bacteria 4015
341 Ga0495647_0418663 3300046681 Bacteria 617
342 Ga0495658_0001403 3300046683 Bacteria 12652
343 Ga0495658_0008579 3300046683 Bacteria 5070
344 Ga0495613_0069329 3300046689 Bacteria 2571
345 Ga0495613_0165850 3300046689 Bacteria 1569
346 Ga0495624_0459405 3300046690 Bacteria 763
347 Ga0495581_0000659 3300047315 Bacteria 18109
348 Ga0495674_0131259 3300047319 Bacteria 2111
349 Ga0495680_0066918 3300047322 Bacteria 2748
350 Ga0495684_0070462 3300047471 Bacteria 2658
351 Ga0495593_0000356 3300047673 Bacteria 25268
352 Ga0495614_0000638 3300048089 Bacteria 14664
353 Ga0496100_0065280 3300048903 Bacteria 2411
354 Ga0496100_0905600 3300048903 Bacteria 693
355 Ga0496101_0515952 3300048904 Bacteria 944
356 Ga0496102_0269133 3300048905 Bacteria 1606
357 Ga0496102_0873782 3300048905 Bacteria 821
358 Ga0496103_0071001 3300048906 Bacteria 2179
359 Ga0496104_0207729 3300048907 Bacteria 1870
360 Ga0496104_0698224 3300048907 Bacteria 922
361 Ga0496105_0250591 3300048908 Bacteria 1435
362 Ga0496106_0053593 3300048909 Bacteria 3047
363 Ga0496106_0366757 3300048909 Bacteria 1157
364 Ga0496106_0671675 3300048909 Bacteria 827
365 Ga0496106_1134556 3300048909 Bacteria 611
366 Ga0496107_0110621 3300048910 Bacteria 2019
367 Ga0496107_0251521 3300048910 Bacteria 1315
368 Ga0496108_0075320 3300048911 Bacteria 2851
369 Ga0496108_0888305 3300048911 Bacteria 765
370 Ga0496109_0043903 3300048912 Unclassified 4053
371 Ga0496109_0419606 3300048912 Bacteria 1264
372 Ga0496110_0028810 3300048913 Bacteria 4773
373 Ga0496110_0100205 3300048913 Bacteria 2597
374 Ga0496112_0022223 3300048915 Bacteria 6044
375 Ga0496112_0661130 3300048915 Bacteria 974
376 Ga0496113_0774854 3300048916 Bacteria 763
377 Ga0496113_1242379 3300048916 Bacteria 581
378 Ga0496115_0476264 3300048918 Unclassified 1006
379 Ga0501290_017104 3300049513 Bacteria 970
380 Ga0501303_045128 3300049526 Bacteria 563
381 Ga0501031_0037498 3300049568 Bacteria 3163
382 Ga0501031_0239043 3300049568 Bacteria 1181
383 Ga0501032_0230541 3300049569 Bacteria 1204
384 Ga0501033_0144217 3300049570 Bacteria 1721
385 Ga0501034_0004342 3300049571 Bacteria 15797
386 Ga0501036_0041282 3300049572 Bacteria 3904
387 Ga0501036_0055831 3300049572 Bacteria 3346
388 Ga0501039_0383419 3300049575 Bacteria 1104
389 Ga0501040_0050648 3300049576 Bacteria 2841
390 Ga0501040_0153098 3300049576 Bacteria 1627
391 Ga0501041_0071773 3300049577 Bacteria 2126
392 Ga0501041_0114239 3300049577 Bacteria 1676
393 Ga0501042_0056601 3300049578 Bacteria 2798
394 Ga0501046_0249628 3300049580 Bacteria 1306
395 Ga0501046_0286677 3300049580 Bacteria 1205
396 Ga0501047_0053540 3300049581 Bacteria 3903
397 Ga0501047_0187163 3300049581 Bacteria 1935
398 Ga0501048_0328180 3300049582 Bacteria 1090
399 Ga0501048_0695086 3300049582 Bacteria 730
400 Ga0501067_0000353 3300049583 Bacteria 25052
401 Ga0501067_0004616 3300049583 Bacteria 7626
402 Ga0501067_0022949 3300049583 Bacteria 3455
403 Ga0501067_0434366 3300049583 Bacteria 733
404 Ga0501068_0000022 3300049584 Bacteria 58879
405 Ga0501068_0001339 3300049584 Bacteria 13056
406 Ga0501068_0389399 3300049584 Bacteria 898
407 Ga0501068_0460820 3300049584 Bacteria 823
408 Ga0501068_0561529 3300049584 Bacteria 742
409 Ga0501069_0000105 3300049585 Bacteria 38637
410 Ga0501069_0001800 3300049585 Bacteria 10728
411 Ga0501069_0032461 3300049585 Unclassified 2874
412 Ga0501069_0186503 3300049585 Bacteria 1200
413 Ga0501069_0197156 3300049585 Bacteria 1166
414 Ga0501070_0000192 3300049586 Bacteria 57359
415 Ga0501070_0027750 3300049586 Bacteria 4749
416 Ga0501070_0062415 3300049586 Bacteria 3087
417 Ga0501071_0000678 3300049587 Bacteria 17791
418 Ga0501071_0002547 3300049587 Bacteria 11102
419 Ga0501071_1035916 3300049587 Bacteria 634
420 Ga0501072_0005786 3300049588 Bacteria 9417
421 Ga0501072_0009721 3300049588 Bacteria 7315
422 Ga0501072_0305978 3300049588 Bacteria 1264
423 Ga0501073_0000949 3300049589 Bacteria 20906
424 Ga0501073_0006186 3300049589 Bacteria 8933
425 Ga0501073_0148021 3300049589 Bacteria 1627
426 Ga0501073_0533643 3300049589 Bacteria 811
427 Ga0501073_0597224 3300049589 Bacteria 762
428 Ga0501074_0000171 3300049590 Bacteria 34937
429 Ga0501074_0000742 3300049590 Bacteria 20488
430 Ga0501074_0171416 3300049590 Bacteria 1549
431 Ga0501074_0207462 3300049590 Bacteria 1396
432 Ga0501074_0238008 3300049590 Bacteria 1295
433 Ga0501074_0267314 3300049590 Bacteria 1215
434 Ga0501074_0478565 3300049590 Bacteria 883
435 Ga0501075_0018150 3300049591 Bacteria 5088
436 Ga0501075_1116760 3300049591 Bacteria 599
437 Ga0501076_0021090 3300049592 Bacteria 4993
438 Ga0501076_0272461 3300049592 Bacteria 1386
439 Ga0501077_0004768 3300049593 Bacteria 8242
440 Ga0501077_0064921 3300049593 Bacteria 2315
441 Ga0501077_0422306 3300049593 Bacteria 853
442 Ga0501202_013730 3300049652 Bacteria 1544
443 Ga0501243_028915 3300049675 Bacteria 940
444 Ga0501249_147527 3300049679 Bacteria 590
445 Ga0501253_076377 3300049683 Bacteria 749
446 Ga0501261_020553 3300049690 Bacteria 944
447 Ga0501079_0065742 3300049741 Bacteria 2798
448 Ga0501079_0076548 3300049741 Bacteria 2588
449 Ga0501079_0076836 3300049741 Bacteria 2582
450 Ga0501079_0127383 3300049741 Bacteria 1980
451 Ga0501079_1239801 3300049741 Bacteria 587
452 Ga0501080_0000060 3300049742 Bacteria 71292
453 Ga0501080_0005735 3300049742 Bacteria 11107
454 Ga0501080_0006023 3300049742 Bacteria 10866
455 Ga0501080_0111578 3300049742 Bacteria 2535
456 Ga0501080_0297281 3300049742 Bacteria 1465
457 Ga0501080_0484844 3300049742 Bacteria 1106
458 Ga0501081_0050168 3300049743 Bacteria 2875
459 Ga0501081_0718839 3300049743 Bacteria 750
460 Ga0501083_0008037 3300049744 Bacteria 7464
461 Ga0501083_0393052 3300049744 Bacteria 902
462 Ga0501268_039996 3300049765 Bacteria 879
463 Ga0501270_059470 3300049767 Bacteria 713
464 Ga0501283_049060 3300049779 Bacteria 745
465 Ga0501035_0315717 3300049822 Bacteria 1314
466 Ga0501045_0009723 3300049824 Bacteria 6728
467 Ga0501045_0014038 3300049824 Bacteria 5670
468 nmdc:mga05p37_186756_c1 3300050507 Bacteria 2519
469 nmdc:mga09592_91131_c1 3300050508 Bacteria 2605
470 nmdc:mga0qj67_3022_c1 3300050509 Bacteria 12093
471 nmdc:mga06r32_77166_c1 3300050510 Bacteria 3236
472 nmdc:mga06r32_882482_c1 3300050510 Unclassified 851
473 nmdc:mga08y16_9037_c1 3300050511 Bacteria 10459
474 nmdc:mga0n895_108355_c1 3300050512 Bacteria 2792
475 nmdc:mga0rr50_559504_c1 3300050513 Bacteria 974
476 nmdc:mga0a205_7709_c1 3300050515 Bacteria 9767
477 Ga0501084_0001187 3300054114 Bacteria 20381
478 Ga0501084_0002953 3300054114 Bacteria 13773
479 Ga0501084_0170156 3300054114 Bacteria 1839
480 Ga0501084_0202134 3300054114 Bacteria 1676
481 Ga0501084_0246566 3300054114 Bacteria 1508
482 Ga0590071_015280 3300059421 Bacteria 1801
483 Ga0501082_0006728 3300060353 Bacteria 9941
484 Ga0501082_0139082 3300060353 Bacteria 2107
485 Ga0501082_0399315 3300060353 Bacteria 1200
486 Ga0501082_0767316 3300060353 Bacteria 844
487 Ga0501082_1125055 3300060353 Bacteria 686
488 Ga0530510_0092799 3300061734 Bacteria 2204

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006880 Ga0075429_100021264 Ga0075429_1000212642 145
2 3300025912 Ga0207707_10412454 Ga0207707_104124542 145
3 3300050508 nmdc:mga09592_91131_c1 nmdc:mga09592_91131_c1_1879_2370 145
4 3300050509 nmdc:mga0qj67_3022_c1 nmdc:mga0qj67_3022_c1_2749_3240 145
5 3300050513 nmdc:mga0rr50_559504_c1 nmdc:mga0rr50_559504_c1_301_840 146
6 3300005295 Ga0065707_10585356 Ga0065707_105853561 151
7 3300005353 Ga0070669_100003079 Ga0070669_1000030794 151
8 3300005444 Ga0070694_101167799 Ga0070694_1011677991 151
9 3300005457 Ga0070662_100475570 Ga0070662_1004755702 151
10 3300005459 Ga0068867_101010449 Ga0068867_1010104491 151
11 3300005543 Ga0070672_100231388 Ga0070672_1002313882 151
12 3300005548 Ga0070665_100042538 Ga0070665_1000425385 151
13 3300005577 Ga0068857_100214040 Ga0068857_1002140403 151
14 3300005719 Ga0068861_100844213 Ga0068861_1008442132 151
15 3300005840 Ga0068870_10002079 Ga0068870_100020796 151
16 3300005844 Ga0068862_100000376 Ga0068862_1000003769 151
17 3300006844 Ga0075428_101147254 Ga0075428_1011472542 151
18 3300006881 Ga0068865_100020297 Ga0068865_1000202972 151
19 3300009148 Ga0105243_10744155 Ga0105243_107441552 151
20 3300009553 Ga0105249_10000454 Ga0105249_1000045431 151
21 3300013306 Ga0163162_10059365 Ga0163162_100593654 151
22 3300025907 Ga0207645_10067632 Ga0207645_100676322 151
23 3300025908 Ga0207643_10001951 Ga0207643_100019514 151
24 3300025923 Ga0207681_10003561 Ga0207681_100035611 151
25 3300025933 Ga0207706_10076182 Ga0207706_100761823 151
26 3300025935 Ga0207709_10193874 Ga0207709_101938741 151
27 3300025940 Ga0207691_10052046 Ga0207691_100520464 151
28 3300025961 Ga0207712_10001176 Ga0207712_1000117613 151
29 3300025972 Ga0207668_10614131 Ga0207668_106141311 151
30 3300026089 Ga0207648_10023923 Ga0207648_100239237 151
31 3300026116 Ga0207674_10179106 Ga0207674_101791063 151
32 3300026118 Ga0207675_100059762 Ga0207675_1000597622 151
33 3300028379 Ga0268266_10935521 Ga0268266_109355211 151
34 3300028380 Ga0268265_10002121 Ga0268265_100021219 151
35 3300028381 Ga0268264_12075754 Ga0268264_120757541 151
36 3300049581 Ga0501047_0053540 Ga0501047_0053540_3167_3667 151
37 3300050511 nmdc:mga08y16_9037_c1 nmdc:mga08y16_9037_c1_5173_5652 151
38 3300005456 Ga0070678_100220569 Ga0070678_1002205692 152
39 3300005564 Ga0070664_100206975 Ga0070664_1002069753 152
40 3300006880 Ga0075429_100665963 Ga0075429_1006659632 152
41 3300026095 Ga0207676_10680541 Ga0207676_106805411 152
42 3300031824 Ga0307413_10390592 Ga0307413_103905922 152
43 3300048908 Ga0496105_0250591 Ga0496105_0250591_118_585 154
44 3300049679 Ga0501249_147527 Ga0501249_147527_14_481 154
45 3300005327 Ga0070658_10510494 Ga0070658_105104941 158
46 3300005336 Ga0070680_100030601 Ga0070680_1000306015 158
47 3300005336 Ga0070680_100050348 Ga0070680_1000503483 158
48 3300005339 Ga0070660_100151501 Ga0070660_1001515011 158
49 3300005344 Ga0070661_100003411 Ga0070661_10000341110 158
50 3300005366 Ga0070659_100017963 Ga0070659_1000179635 158
51 3300005455 Ga0070663_100026569 Ga0070663_1000265694 158
52 3300005458 Ga0070681_10008932 Ga0070681_100089329 158
53 3300005458 Ga0070681_10010307 Ga0070681_100103076 158
54 3300005458 Ga0070681_10077498 Ga0070681_100774981 158
55 3300005530 Ga0070679_100014954 Ga0070679_1000149546 158
56 3300005530 Ga0070679_100036230 Ga0070679_1000362303 158
57 3300005530 Ga0070679_100043081 Ga0070679_1000430812 158
58 3300005539 Ga0068853_100013646 Ga0068853_1000136464 158
59 3300005563 Ga0068855_100008571 Ga0068855_1000085718 158
60 3300005616 Ga0068852_100069165 Ga0068852_1000691653 158
61 3300005844 Ga0068862_100599645 Ga0068862_1005996451 158
62 3300006028 Ga0070717_11392994 Ga0070717_113929941 158
63 3300009093 Ga0105240_10074073 Ga0105240_100740733 158
64 3300009174 Ga0105241_10116790 Ga0105241_101167902 158
65 3300009551 Ga0105238_10073038 Ga0105238_100730384 158
66 3300009553 Ga0105249_10000115 Ga0105249_1000011510 158
67 3300009553 Ga0105249_10262497 Ga0105249_102624972 158
68 3300013104 Ga0157370_10165029 Ga0157370_101650292 158
69 3300013105 Ga0157369_10115485 Ga0157369_101154853 158
70 3300013105 Ga0157369_10154139 Ga0157369_101541393 158
71 3300013307 Ga0157372_10683897 Ga0157372_106838971 158
72 3300013307 Ga0157372_10847696 Ga0157372_108476962 158
73 3300014325 Ga0163163_10806932 Ga0163163_108069322 158
74 3300014969 Ga0157376_10211400 Ga0157376_102114002 158
75 3300025909 Ga0207705_10089643 Ga0207705_100896433 158
76 3300025909 Ga0207705_10379726 Ga0207705_103797261 158
77 3300025912 Ga0207707_10007791 Ga0207707_100077916 158
78 3300025912 Ga0207707_10041733 Ga0207707_100417334 158
79 3300025913 Ga0207695_10081615 Ga0207695_100816153 158
80 3300025917 Ga0207660_10095373 Ga0207660_100953733 158
81 3300025917 Ga0207660_10441739 Ga0207660_104417392 158
82 3300025919 Ga0207657_10005262 Ga0207657_1000526212 158
83 3300025920 Ga0207649_10096437 Ga0207649_100964372 158
84 3300025921 Ga0207652_10008367 Ga0207652_100083673 158
85 3300025921 Ga0207652_10024204 Ga0207652_100242045 158
86 3300025921 Ga0207652_10031148 Ga0207652_100311485 158
87 3300025949 Ga0207667_10081585 Ga0207667_100815853 158
88 3300025961 Ga0207712_10000499 Ga0207712_1000049926 158
89 3300025961 Ga0207712_10797805 Ga0207712_107978052 158
90 3300026067 Ga0207678_10620997 Ga0207678_106209971 158
91 3300026078 Ga0207702_10057844 Ga0207702_100578444 158
92 3300026142 Ga0207698_10013973 Ga0207698_100139737 158
93 3300028380 Ga0268265_10554481 Ga0268265_105544811 158
94 3300031548 Ga0307408_100540701 Ga0307408_1005407012 158
95 3300031824 Ga0307413_10165887 Ga0307413_101658873 158
96 3300031824 Ga0307413_10446736 Ga0307413_104467362 158
97 3300031903 Ga0307407_10018599 Ga0307407_100185994 158
98 3300032002 Ga0307416_100085434 Ga0307416_1000854343 158
99 3300032002 Ga0307416_100137033 Ga0307416_1001370334 158
100 3300032004 Ga0307414_10484407 Ga0307414_104844072 158
101 3300032005 Ga0307411_10016984 Ga0307411_100169843 158
102 3300032126 Ga0307415_100563413 Ga0307415_1005634132 158
103 3300035083 Ga0373926_0004167 Ga0373926_0004167_3697_4191 158
104 3300035116 Ga0373945_0027811 Ga0373945_0027811_1342_1836 158
105 3300035170 Ga0373943_0016857 Ga0373943_0016857_2685_3179 158
106 3300035692 Ga0373935_0018031 Ga0373935_0018031_76_570 158
107 3300035692 Ga0373935_0340967 Ga0373935_0340967_332_826 158
108 3300035695 Ga0373927_0026060 Ga0373927_0026060_14_508 158
109 3300035725 Ga0373947_0002126 Ga0373947_0002126_3201_3695 158
110 3300037068 Ga0373925_0013098 Ga0373925_0013098_4236_4730 158
111 3300042011 Ga0439454_017522 Ga0439454_017522_407_886 158
112 3300042123 Ga0450921_001219 Ga0450921_001219_75_554 158
113 3300042134 Ga0450898_068549 Ga0450898_068549_216_695 158
114 3300042435 Ga0439434_0115927 Ga0439434_0115927_180_659 158
115 3300042876 Ga0451577_0003975 Ga0451577_0003975_3229_3708 158
116 3300044693 Ga0466961_0592676 Ga0466961_0592676_126_608 158
117 3300045049 Ga0466959_0528410 Ga0466959_0528410_90_572 158
118 3300045836 Ga0466958_0573571 Ga0466958_0573571_21_503 158
119 3300046459 Ga0495629_0025075 Ga0495629_0025075_124_618 158
120 3300046475 Ga0495639_0000549 Ga0495639_0000549_8763_9257 158
121 3300046517 Ga0495630_0002236 Ga0495630_0002236_155_649 158
122 3300046531 Ga0495665_0000358 Ga0495665_0000358_14682_15176 158
123 3300046674 Ga0495588_0012498 Ga0495588_0012498_3331_3825 158
124 3300046681 Ga0495647_0418663 Ga0495647_0418663_71_565 158
125 3300046683 Ga0495658_0001403 Ga0495658_0001403_8532_9026 158
126 3300046689 Ga0495613_0069329 Ga0495613_0069329_1882_2376 158
127 3300046690 Ga0495624_0459405 Ga0495624_0459405_203_697 158
128 3300047315 Ga0495581_0000659 Ga0495581_0000659_7906_8400 158
129 3300047673 Ga0495593_0000356 Ga0495593_0000356_21120_21614 158
130 3300048089 Ga0495614_0000638 Ga0495614_0000638_7186_7680 158
131 3300005329 Ga0070683_100339704 Ga0070683_1003397042 159
132 3300005331 Ga0070670_100963913 Ga0070670_1009639132 159
133 3300005336 Ga0070680_100020187 Ga0070680_1000201875 159
134 3300005339 Ga0070660_100500706 Ga0070660_1005007062 159
135 3300005341 Ga0070691_10188568 Ga0070691_101885682 159
136 3300005344 Ga0070661_100862154 Ga0070661_1008621541 159
137 3300005347 Ga0070668_100148391 Ga0070668_1001483913 159
138 3300005347 Ga0070668_100687019 Ga0070668_1006870192 159
139 3300005353 Ga0070669_100895017 Ga0070669_1008950171 159
140 3300005355 Ga0070671_100993761 Ga0070671_1009937612 159
141 3300005439 Ga0070711_100001286 Ga0070711_10000128614 159
142 3300005440 Ga0070705_101171262 Ga0070705_1011712621 159
143 3300005445 Ga0070708_100079242 Ga0070708_1000792422 159
144 3300005455 Ga0070663_100442520 Ga0070663_1004425201 159
145 3300005457 Ga0070662_101061568 Ga0070662_1010615682 159
146 3300005458 Ga0070681_10306667 Ga0070681_103066672 159
147 3300005466 Ga0070685_10634249 Ga0070685_106342491 159
148 3300005467 Ga0070706_100650402 Ga0070706_1006504022 159
149 3300005467 Ga0070706_100911943 Ga0070706_1009119431 159
150 3300005468 Ga0070707_100171775 Ga0070707_1001717752 159
151 3300005518 Ga0070699_100000824 Ga0070699_10000082428 159
152 3300005518 Ga0070699_100291279 Ga0070699_1002912792 159
153 3300005530 Ga0070679_100113171 Ga0070679_1001131714 159
154 3300005535 Ga0070684_100608741 Ga0070684_1006087412 159
155 3300005536 Ga0070697_100009789 Ga0070697_1000097895 159
156 3300005543 Ga0070672_100129750 Ga0070672_1001297503 159
157 3300005543 Ga0070672_100155226 Ga0070672_1001552262 159
158 3300005544 Ga0070686_101305091 Ga0070686_1013050911 159
159 3300005545 Ga0070695_100030682 Ga0070695_1000306821 159
160 3300005546 Ga0070696_100170062 Ga0070696_1001700622 159
161 3300005549 Ga0070704_100541263 Ga0070704_1005412632 159
162 3300005564 Ga0070664_100076525 Ga0070664_1000765253 159
163 3300005564 Ga0070664_100111051 Ga0070664_1001110513 159
164 3300005615 Ga0070702_100768022 Ga0070702_1007680221 159
165 3300005618 Ga0068864_100180637 Ga0068864_1001806372 159
166 3300005719 Ga0068861_100119842 Ga0068861_1001198422 159
167 3300005843 Ga0068860_100910972 Ga0068860_1009109722 159
168 3300005843 Ga0068860_101262832 Ga0068860_1012628322 159
169 3300005843 Ga0068860_101542420 Ga0068860_1015424202 159
170 3300005937 Ga0081455_10050687 Ga0081455_100506875 159
171 3300006175 Ga0070712_100105013 Ga0070712_1001050132 159
172 3300006844 Ga0075428_101149041 Ga0075428_1011490412 159
173 3300006846 Ga0075430_100109751 Ga0075430_1001097512 159
174 3300006847 Ga0075431_100064200 Ga0075431_1000642005 159
175 3300006847 Ga0075431_100747874 Ga0075431_1007478742 159
176 3300006871 Ga0075434_100091187 Ga0075434_1000911872 159
177 3300009147 Ga0114129_10274423 Ga0114129_102744233 159
178 3300009147 Ga0114129_11177214 Ga0114129_111772142 159
179 3300009148 Ga0105243_10333503 Ga0105243_103335032 159
180 3300009148 Ga0105243_10880089 Ga0105243_108800891 159
181 3300009174 Ga0105241_10397937 Ga0105241_103979372 159
182 3300009177 Ga0105248_10087798 Ga0105248_100877983 159
183 3300009177 Ga0105248_10099173 Ga0105248_100991733 159
184 3300009177 Ga0105248_10454509 Ga0105248_104545093 159
185 3300010375 Ga0105239_11716520 Ga0105239_117165202 159
186 3300013308 Ga0157375_12008437 Ga0157375_120084372 159
187 3300014325 Ga0163163_10066631 Ga0163163_100666312 159
188 3300014325 Ga0163163_10171929 Ga0163163_101719294 159
189 3300014326 Ga0157380_10654155 Ga0157380_106541552 159
190 3300014326 Ga0157380_11665764 Ga0157380_116657642 159
191 3300014968 Ga0157379_10829323 Ga0157379_108293232 159
192 3300014968 Ga0157379_11046607 Ga0157379_110466072 159
193 3300014969 Ga0157376_10267374 Ga0157376_102673743 159
194 3300014969 Ga0157376_11135119 Ga0157376_111351192 159
195 3300015262 Ga0182007_10206684 Ga0182007_102066841 159
196 3300025911 Ga0207654_10079503 Ga0207654_100795032 159
197 3300025912 Ga0207707_10023881 Ga0207707_100238813 159
198 3300025915 Ga0207693_10330978 Ga0207693_103309783 159
199 3300025916 Ga0207663_10001490 Ga0207663_1000149014 159
200 3300025917 Ga0207660_10238060 Ga0207660_102380602 159
201 3300025918 Ga0207662_10134859 Ga0207662_101348592 159
202 3300025919 Ga0207657_10738236 Ga0207657_107382362 159
203 3300025921 Ga0207652_10644804 Ga0207652_106448042 159
204 3300025922 Ga0207646_10122557 Ga0207646_101225573 159
205 3300025931 Ga0207644_10513276 Ga0207644_105132762 159
206 3300025932 Ga0207690_10097772 Ga0207690_100977723 159
207 3300025940 Ga0207691_10164589 Ga0207691_101645892 159
208 3300025941 Ga0207711_10055461 Ga0207711_100554613 159
209 3300025941 Ga0207711_10152177 Ga0207711_101521773 159
210 3300025944 Ga0207661_10222512 Ga0207661_102225122 159
211 3300025944 Ga0207661_10244948 Ga0207661_102449482 159
212 3300025945 Ga0207679_10026253 Ga0207679_100262534 159
213 3300025945 Ga0207679_10141370 Ga0207679_101413703 159
214 3300025945 Ga0207679_10210109 Ga0207679_102101093 159
215 3300025960 Ga0207651_10042005 Ga0207651_100420052 159
216 3300025981 Ga0207640_10139919 Ga0207640_101399192 159
217 3300026023 Ga0207677_10754569 Ga0207677_107545692 159
218 3300026067 Ga0207678_10068814 Ga0207678_100688144 159
219 3300026095 Ga0207676_10226214 Ga0207676_102262142 159
220 3300026118 Ga0207675_100090617 Ga0207675_1000906174 159
221 3300026142 Ga0207698_10494551 Ga0207698_104945512 159
222 3300027471 Ga0209995_1078555 Ga0209995_10785551 159
223 3300027907 Ga0207428_10129186 Ga0207428_101291862 159
224 3300028381 Ga0268264_11333172 Ga0268264_113331722 159
225 3300031548 Ga0307408_100008337 Ga0307408_1000083375 159
226 3300031548 Ga0307408_100143062 Ga0307408_1001430623 159
227 3300031548 Ga0307408_100215144 Ga0307408_1002151442 159
228 3300031548 Ga0307408_100371672 Ga0307408_1003716722 159
229 3300031731 Ga0307405_10004488 Ga0307405_100044886 159
230 3300031731 Ga0307405_10036009 Ga0307405_100360092 159
231 3300031731 Ga0307405_10501621 Ga0307405_105016212 159
232 3300031824 Ga0307413_10010972 Ga0307413_100109721 159
233 3300031824 Ga0307413_10019705 Ga0307413_100197055 159
234 3300031824 Ga0307413_10036278 Ga0307413_100362783 159
235 3300031824 Ga0307413_10262852 Ga0307413_102628522 159
236 3300031852 Ga0307410_10002527 Ga0307410_100025278 159
237 3300031852 Ga0307410_10010146 Ga0307410_100101465 159
238 3300031852 Ga0307410_10274470 Ga0307410_102744703 159
239 3300031852 Ga0307410_10535507 Ga0307410_105355072 159
240 3300031852 Ga0307410_10570322 Ga0307410_105703221 159
241 3300031901 Ga0307406_10001688 Ga0307406_100016882 159
242 3300031901 Ga0307406_10014718 Ga0307406_100147185 159
243 3300031901 Ga0307406_10198542 Ga0307406_101985422 159
244 3300031901 Ga0307406_10557723 Ga0307406_105577232 159
245 3300031903 Ga0307407_10027368 Ga0307407_100273683 159
246 3300031903 Ga0307407_10453310 Ga0307407_104533102 159
247 3300031911 Ga0307412_10080294 Ga0307412_100802943 159
248 3300031911 Ga0307412_10346886 Ga0307412_103468862 159
249 3300031911 Ga0307412_11419397 Ga0307412_114193972 159
250 3300031995 Ga0307409_100000144 Ga0307409_1000001444 159
251 3300031995 Ga0307409_100005669 Ga0307409_1000056695 159
252 3300031995 Ga0307409_100120314 Ga0307409_1001203142 159
253 3300031995 Ga0307409_100179122 Ga0307409_1001791222 159
254 3300031995 Ga0307409_100182609 Ga0307409_1001826092 159
255 3300031995 Ga0307409_100404155 Ga0307409_1004041552 159
256 3300031995 Ga0307409_101049244 Ga0307409_1010492442 159
257 3300032002 Ga0307416_100000828 Ga0307416_10000082814 159
258 3300032002 Ga0307416_100121404 Ga0307416_1001214042 159
259 3300032002 Ga0307416_100307518 Ga0307416_1003075183 159
260 3300032002 Ga0307416_100400666 Ga0307416_1004006661 159
261 3300032002 Ga0307416_100563387 Ga0307416_1005633872 159
262 3300032002 Ga0307416_101104424 Ga0307416_1011044242 159
263 3300032002 Ga0307416_101873449 Ga0307416_1018734492 159
264 3300032004 Ga0307414_10002383 Ga0307414_100023833 159
265 3300032004 Ga0307414_10032844 Ga0307414_100328445 159
266 3300032004 Ga0307414_10137897 Ga0307414_101378973 159
267 3300032004 Ga0307414_10335255 Ga0307414_103352552 159
268 3300032005 Ga0307411_10007270 Ga0307411_100072705 159
269 3300032005 Ga0307411_10038481 Ga0307411_100384813 159
270 3300032005 Ga0307411_10192544 Ga0307411_101925443 159
271 3300032005 Ga0307411_10293419 Ga0307411_102934191 159
272 3300032005 Ga0307411_10856079 Ga0307411_108560792 159
273 3300032126 Ga0307415_100000419 Ga0307415_10000041919 159
274 3300032126 Ga0307415_100036475 Ga0307415_1000364753 159
275 3300032126 Ga0307415_100044728 Ga0307415_1000447284 159
276 3300032126 Ga0307415_100104570 Ga0307415_1001045703 159
277 3300032126 Ga0307415_100131985 Ga0307415_1001319852 159
278 3300032126 Ga0307415_100877952 Ga0307415_1008779522 159
279 3300032126 Ga0307415_101204795 Ga0307415_1012047952 159
280 3300035112 Ga0373932_0044489 Ga0373932_0044489_355_837 159
281 3300036401 Ga0373937_0476569 Ga0373937_0476569_153_635 159
282 3300037471 Ga0395905_0434509 Ga0395905_0434509_358_840 159
283 3300038996 Ga0242420_028295 Ga0242420_028295_390_872 159
284 3300041408 Ga0439453_0033522 Ga0439453_0033522_330_812 159
285 3300041486 Ga0451807_2555286 Ga0451807_2555286_657_1139 159
286 3300041498 Ga0451841_0074140 Ga0451841_0074140_125_607 159
287 3300041505 Ga0451849_0414375 Ga0451849_0414375_334_816 159
288 3300042437 Ga0439444_0079283 Ga0439444_0079283_201_695 159
289 3300045976 Ga0466967_1649394 Ga0466967_1649394_120_602 159
290 3300046472 Ga0495580_0095865 Ga0495580_0095865_312_794 159
291 3300046472 Ga0495580_0147155 Ga0495580_0147155_539_1021 159
292 3300046475 Ga0495639_0018403 Ga0495639_0018403_378_860 159
293 3300046476 Ga0495662_0025907 Ga0495662_0025907_1377_1859 159
294 3300046477 Ga0495664_0031638 Ga0495664_0031638_1440_1922 159
295 3300046499 Ga0495594_0007257 Ga0495594_0007257_1656_2138 159
296 3300046514 Ga0495618_0053276 Ga0495618_0053276_1581_2063 159
297 3300046517 Ga0495630_0026160 Ga0495630_0026160_2664_3146 159
298 3300046526 Ga0495666_0013463 Ga0495666_0013463_3368_3850 159
299 3300046535 Ga0495586_0012895 Ga0495586_0012895_3666_4148 159
300 3300046663 Ga0495635_0277029 Ga0495635_0277029_400_882 159
301 3300046663 Ga0495635_0972483 Ga0495635_0972483_35_517 159
302 3300046683 Ga0495658_0008579 Ga0495658_0008579_3002_3484 159
303 3300046689 Ga0495613_0165850 Ga0495613_0165850_484_966 159
304 3300047319 Ga0495674_0131259 Ga0495674_0131259_522_1004 159
305 3300047322 Ga0495680_0066918 Ga0495680_0066918_2145_2627 159
306 3300047471 Ga0495684_0070462 Ga0495684_0070462_1781_2263 159
307 3300048903 Ga0496100_0065280 Ga0496100_0065280_1054_1536 159
308 3300048903 Ga0496100_0905600 Ga0496100_0905600_156_638 159
309 3300048904 Ga0496101_0515952 Ga0496101_0515952_65_547 159
310 3300048905 Ga0496102_0873782 Ga0496102_0873782_43_525 159
311 3300048907 Ga0496104_0207729 Ga0496104_0207729_1187_1669 159
312 3300048907 Ga0496104_0698224 Ga0496104_0698224_406_888 159
313 3300048909 Ga0496106_0053593 Ga0496106_0053593_290_772 159
314 3300048909 Ga0496106_0366757 Ga0496106_0366757_586_1068 159
315 3300048909 Ga0496106_0671675 Ga0496106_0671675_190_672 159
316 3300048910 Ga0496107_0251521 Ga0496107_0251521_420_902 159
317 3300048911 Ga0496108_0075320 Ga0496108_0075320_691_1173 159
318 3300048911 Ga0496108_0888305 Ga0496108_0888305_188_670 159
319 3300048912 Ga0496109_0043903 Ga0496109_0043903_2924_3406 159
320 3300048912 Ga0496109_0419606 Ga0496109_0419606_628_1110 159
321 3300048913 Ga0496110_0028810 Ga0496110_0028810_2288_2770 159
322 3300048913 Ga0496110_0100205 Ga0496110_0100205_604_1086 159
323 3300048915 Ga0496112_0022223 Ga0496112_0022223_2748_3230 159
324 3300048915 Ga0496112_0661130 Ga0496112_0661130_332_814 159
325 3300048916 Ga0496113_0774854 Ga0496113_0774854_31_513 159
326 3300048916 Ga0496113_1242379 Ga0496113_1242379_14_496 159
327 3300048918 Ga0496115_0476264 Ga0496115_0476264_188_670 159
328 3300049513 Ga0501290_017104 Ga0501290_017104_154_636 159
329 3300049568 Ga0501031_0037498 Ga0501031_0037498_457_939 159
330 3300049568 Ga0501031_0239043 Ga0501031_0239043_395_877 159
331 3300049569 Ga0501032_0230541 Ga0501032_0230541_301_783 159
332 3300049570 Ga0501033_0144217 Ga0501033_0144217_200_682 159
333 3300049571 Ga0501034_0004342 Ga0501034_0004342_12124_12606 159
334 3300049572 Ga0501036_0041282 Ga0501036_0041282_3332_3814 159
335 3300049572 Ga0501036_0055831 Ga0501036_0055831_25_507 159
336 3300049575 Ga0501039_0383419 Ga0501039_0383419_425_907 159
337 3300049576 Ga0501040_0050648 Ga0501040_0050648_1831_2313 159
338 3300049576 Ga0501040_0153098 Ga0501040_0153098_1078_1560 159
339 3300049577 Ga0501041_0071773 Ga0501041_0071773_316_798 159
340 3300049577 Ga0501041_0114239 Ga0501041_0114239_1137_1619 159
341 3300049578 Ga0501042_0056601 Ga0501042_0056601_1972_2454 159
342 3300049580 Ga0501046_0249628 Ga0501046_0249628_256_738 159
343 3300049580 Ga0501046_0286677 Ga0501046_0286677_578_1060 159
344 3300049581 Ga0501047_0187163 Ga0501047_0187163_1016_1498 159
345 3300049582 Ga0501048_0328180 Ga0501048_0328180_386_868 159
346 3300049582 Ga0501048_0695086 Ga0501048_0695086_141_623 159
347 3300049583 Ga0501067_0000353 Ga0501067_0000353_21270_21752 159
348 3300049583 Ga0501067_0004616 Ga0501067_0004616_2568_3050 159
349 3300049583 Ga0501067_0022949 Ga0501067_0022949_2666_3148 159
350 3300049583 Ga0501067_0434366 Ga0501067_0434366_89_571 159
351 3300049584 Ga0501068_0000022 Ga0501068_0000022_38116_38598 159
352 3300049584 Ga0501068_0001339 Ga0501068_0001339_3238_3720 159
353 3300049584 Ga0501068_0389399 Ga0501068_0389399_93_572 159
354 3300049584 Ga0501068_0460820 Ga0501068_0460820_285_767 159
355 3300049584 Ga0501068_0561529 Ga0501068_0561529_74_556 159
356 3300049585 Ga0501069_0000105 Ga0501069_0000105_165_647 159
357 3300049585 Ga0501069_0001800 Ga0501069_0001800_7020_7502 159
358 3300049585 Ga0501069_0032461 Ga0501069_0032461_199_681 159
359 3300049585 Ga0501069_0186503 Ga0501069_0186503_699_1181 159
360 3300049585 Ga0501069_0197156 Ga0501069_0197156_611_1093 159
361 3300049586 Ga0501070_0000192 Ga0501070_0000192_13568_14050 159
362 3300049586 Ga0501070_0027750 Ga0501070_0027750_1040_1522 159
363 3300049586 Ga0501070_0062415 Ga0501070_0062415_809_1291 159
364 3300049587 Ga0501071_0000678 Ga0501071_0000678_12133_12615 159
365 3300049587 Ga0501071_0002547 Ga0501071_0002547_2073_2555 159
366 3300049587 Ga0501071_1035916 Ga0501071_1035916_132_614 159
367 3300049588 Ga0501072_0005786 Ga0501072_0005786_8853_9335 159
368 3300049588 Ga0501072_0009721 Ga0501072_0009721_4163_4645 159
369 3300049588 Ga0501072_0305978 Ga0501072_0305978_540_1022 159
370 3300049589 Ga0501073_0000949 Ga0501073_0000949_5004_5486 159
371 3300049589 Ga0501073_0006186 Ga0501073_0006186_5677_6159 159
372 3300049589 Ga0501073_0148021 Ga0501073_0148021_569_1051 159
373 3300049589 Ga0501073_0533643 Ga0501073_0533643_272_754 159
374 3300049589 Ga0501073_0597224 Ga0501073_0597224_196_678 159
375 3300049590 Ga0501074_0000171 Ga0501074_0000171_5802_6284 159
376 3300049590 Ga0501074_0000742 Ga0501074_0000742_9591_10073 159
377 3300049590 Ga0501074_0171416 Ga0501074_0171416_452_934 159
378 3300049590 Ga0501074_0207462 Ga0501074_0207462_750_1232 159
379 3300049590 Ga0501074_0238008 Ga0501074_0238008_756_1238 159
380 3300049590 Ga0501074_0267314 Ga0501074_0267314_140_622 159
381 3300049590 Ga0501074_0478565 Ga0501074_0478565_124_606 159
382 3300049591 Ga0501075_0018150 Ga0501075_0018150_4499_4981 159
383 3300049591 Ga0501075_1116760 Ga0501075_1116760_87_569 159
384 3300049592 Ga0501076_0021090 Ga0501076_0021090_3726_4208 159
385 3300049592 Ga0501076_0272461 Ga0501076_0272461_334_816 159
386 3300049593 Ga0501077_0004768 Ga0501077_0004768_7015_7497 159
387 3300049593 Ga0501077_0064921 Ga0501077_0064921_1327_1809 159
388 3300049593 Ga0501077_0422306 Ga0501077_0422306_238_735 159
389 3300049652 Ga0501202_013730 Ga0501202_013730_319_801 159
390 3300049675 Ga0501243_028915 Ga0501243_028915_61_543 159
391 3300049683 Ga0501253_076377 Ga0501253_076377_213_695 159
392 3300049741 Ga0501079_0065742 Ga0501079_0065742_435_917 159
393 3300049741 Ga0501079_0076548 Ga0501079_0076548_1507_1989 159
394 3300049741 Ga0501079_0076836 Ga0501079_0076836_248_730 159
395 3300049741 Ga0501079_0127383 Ga0501079_0127383_1387_1869 159
396 3300049741 Ga0501079_1239801 Ga0501079_1239801_83_565 159
397 3300049742 Ga0501080_0000060 Ga0501080_0000060_12124_12606 159
398 3300049742 Ga0501080_0005735 Ga0501080_0005735_4258_4740 159
399 3300049742 Ga0501080_0006023 Ga0501080_0006023_8312_8794 159
400 3300049742 Ga0501080_0111578 Ga0501080_0111578_1838_2320 159
401 3300049742 Ga0501080_0297281 Ga0501080_0297281_337_819 159
402 3300049742 Ga0501080_0484844 Ga0501080_0484844_70_552 159
403 3300049743 Ga0501081_0050168 Ga0501081_0050168_1276_1758 159
404 3300049743 Ga0501081_0718839 Ga0501081_0718839_108_590 159
405 3300049744 Ga0501083_0008037 Ga0501083_0008037_3423_3905 159
406 3300049744 Ga0501083_0393052 Ga0501083_0393052_142_624 159
407 3300049765 Ga0501268_039996 Ga0501268_039996_16_498 159
408 3300049767 Ga0501270_059470 Ga0501270_059470_76_558 159
409 3300049779 Ga0501283_049060 Ga0501283_049060_51_533 159
410 3300049822 Ga0501035_0315717 Ga0501035_0315717_152_634 159
411 3300049824 Ga0501045_0009723 Ga0501045_0009723_2621_3103 159
412 3300049824 Ga0501045_0014038 Ga0501045_0014038_4866_5348 159
413 3300050507 nmdc:mga05p37_186756_c1 nmdc:mga05p37_186756_c1_1813_2295 159
414 3300050510 nmdc:mga06r32_77166_c1 nmdc:mga06r32_77166_c1_1315_1797 159
415 3300050510 nmdc:mga06r32_882482_c1 nmdc:mga06r32_882482_c1_13_498 159
416 3300050512 nmdc:mga0n895_108355_c1 nmdc:mga0n895_108355_c1_1900_2382 159
417 3300050515 nmdc:mga0a205_7709_c1 nmdc:mga0a205_7709_c1_332_814 159
418 3300054114 Ga0501084_0001187 Ga0501084_0001187_13363_13845 159
419 3300054114 Ga0501084_0002953 Ga0501084_0002953_12115_12597 159
420 3300054114 Ga0501084_0170156 Ga0501084_0170156_72_554 159
421 3300054114 Ga0501084_0202134 Ga0501084_0202134_1003_1485 159
422 3300054114 Ga0501084_0246566 Ga0501084_0246566_441_923 159
423 3300059421 Ga0590071_015280 Ga0590071_015280_559_1041 159
424 3300060353 Ga0501082_0006728 Ga0501082_0006728_7020_7502 159
425 3300060353 Ga0501082_0139082 Ga0501082_0139082_195_677 159
426 3300060353 Ga0501082_0399315 Ga0501082_0399315_137_619 159
427 3300060353 Ga0501082_0767316 Ga0501082_0767316_340_822 159
428 3300060353 Ga0501082_1125055 Ga0501082_1125055_14_496 159
429 3300061734 Ga0530510_0092799 Ga0530510_0092799_1449_1931 159
430 3300005293 Ga0065715_10072244 Ga0065715_100722441 160
431 3300005329 Ga0070683_100058762 Ga0070683_1000587623 160
432 3300005339 Ga0070660_100949199 Ga0070660_1009491991 160
433 3300005345 Ga0070692_10013691 Ga0070692_100136913 160
434 3300005347 Ga0070668_100594652 Ga0070668_1005946521 160
435 3300005353 Ga0070669_100160201 Ga0070669_1001602013 160
436 3300005444 Ga0070694_100028827 Ga0070694_1000288273 160
437 3300005455 Ga0070663_100230667 Ga0070663_1002306672 160
438 3300005457 Ga0070662_100636564 Ga0070662_1006365641 160
439 3300005468 Ga0070707_101121778 Ga0070707_1011217782 160
440 3300005518 Ga0070699_100065250 Ga0070699_1000652503 160
441 3300005535 Ga0070684_100026677 Ga0070684_1000266773 160
442 3300005543 Ga0070672_100203555 Ga0070672_1002035553 160
443 3300005545 Ga0070695_100180696 Ga0070695_1001806963 160
444 3300005563 Ga0068855_100251326 Ga0068855_1002513263 160
445 3300005564 Ga0070664_100159760 Ga0070664_1001597602 160
446 3300005719 Ga0068861_100492059 Ga0068861_1004920592 160
447 3300005841 Ga0068863_100696157 Ga0068863_1006961572 160
448 3300005843 Ga0068860_100139566 Ga0068860_1001395662 160
449 3300005844 Ga0068862_100093687 Ga0068862_1000936874 160
450 3300007076 Ga0075435_100241786 Ga0075435_1002417862 160
451 3300009553 Ga0105249_10020246 Ga0105249_100202465 160
452 3300012495 Ga0157323_1010152 Ga0157323_10101522 160
453 3300013308 Ga0157375_10873090 Ga0157375_108730902 160
454 3300014326 Ga0157380_10172196 Ga0157380_101721963 160
455 3300014968 Ga0157379_10265372 Ga0157379_102653722 160
456 3300025923 Ga0207681_10023462 Ga0207681_100234624 160
457 3300025932 Ga0207690_10516577 Ga0207690_105165772 160
458 3300025933 Ga0207706_10361664 Ga0207706_103616642 160
459 3300025945 Ga0207679_10070401 Ga0207679_100704013 160
460 3300025949 Ga0207667_10310692 Ga0207667_103106922 160
461 3300025961 Ga0207712_10081403 Ga0207712_100814032 160
462 3300025972 Ga0207668_10309425 Ga0207668_103094252 160
463 3300026067 Ga0207678_10289810 Ga0207678_102898102 160
464 3300026078 Ga0207702_11059431 Ga0207702_110594312 160
465 3300026118 Ga0207675_100821073 Ga0207675_1008210732 160
466 3300028380 Ga0268265_10072005 Ga0268265_100720053 160
467 3300028381 Ga0268264_10020367 Ga0268264_100203672 160
468 3300031731 Ga0307405_10240206 Ga0307405_102402063 160
469 3300031903 Ga0307407_10054888 Ga0307407_100548883 160
470 3300031903 Ga0307407_10086253 Ga0307407_100862533 160
471 3300031903 Ga0307407_10617161 Ga0307407_106171612 160
472 3300031995 Ga0307409_100009411 Ga0307409_1000094114 160
473 3300031995 Ga0307409_100026152 Ga0307409_1000261525 160
474 3300032002 Ga0307416_100528993 Ga0307416_1005289932 160
475 3300032005 Ga0307411_10157364 Ga0307411_101573642 160
476 3300032126 Ga0307415_100293152 Ga0307415_1002931522 160
477 3300035121 Ga0373960_0232818 Ga0373960_0232818_77_565 160
478 3300035242 Ga0373962_0134193 Ga0373962_0134193_58_546 160
479 3300039437 Ga0436365_0504187 Ga0436365_0504187_46_537 160
480 3300042876 Ga0451577_0061655 Ga0451577_0061655_505_993 160
481 3300044712 Ga0453684_0210433 Ga0453684_0210433_595_1083 160
482 3300046474 Ga0495605_0259700 Ga0495605_0259700_41_532 160
483 3300048905 Ga0496102_0269133 Ga0496102_0269133_765_1253 160
484 3300048906 Ga0496103_0071001 Ga0496103_0071001_987_1475 160
485 3300048909 Ga0496106_1134556 Ga0496106_1134556_98_586 160
486 3300048910 Ga0496107_0110621 Ga0496107_0110621_277_765 160
487 3300049526 Ga0501303_045128 Ga0501303_045128_19_507 160
488 3300049690 Ga0501261_020553 Ga0501261_020553_192_680 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

6

135

0.92

PF08218

Citrate_ly_lig

Citrate lyase ligase C-terminal domain

5

118

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i8i-assembly2.cif.gz_C-2 crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution 0.9737 2 160
6b7d-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 3-(4-chlorophenyl)-6-methoxy-4,5-dimethylpyridazine 0.9694 2 159
6b7b-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole 0.9685 2 159
8i8i-assembly2.cif.gz_C-2 crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution 0.9677 2 160
8i8j-assembly1.cif.gz_B error: 404 client error: for url: https://data.rcsb.org/rest/v1/core/entry/8i8j 0.9668 1 160
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9607 4 160 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9553 1 160 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9479 4 160 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9475 1 160 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9438 1 160 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1W9PQH9-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9845 4 122 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A5V280-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.983 4 159 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-X1CLR4-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) 0.9804 4 115 GO:0004595
GO:0005737
GO:0015937
AF-A0A373F7U0-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9787 4 160 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A3C0YCS7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.977 1 159 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Feature Viewer

pLDDT pTM Quality
92.58 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map