F453162

General Info

Members Datasets Scaffolds Average Seq Length
485 217 970 402

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0049922|Ga0496100_0049922_156_1532
Length 458
Sequence MAEDENPEGSARHLALWFDADGSNKLKSVPVDIASPRTKFSPVFRTISPIPGRRMPDPLSINIQHLKASETVAISNEAKRRKAAGEDVLDLGVGEPDFDTPAPAAQAGIQAVQRGMTRYPPNVGIAELRRGIAQQLSAMSGGRPIDPDQIVVSSGSKQSIFNACFALFGPKDRVLIPSPAWVSYPQIVHLTRAEPVLVPGDPEWGLKVSVKDLDRMSHKLTRGLILCSPCNPTGSVYTLAELKAIAEWARKNEIWIISDEIYRRINYGPGPAPSLLDLPDELLERTVIIYGASKAYAMTGWRIGAAWAPPHVTKAMAALQSHTTTGANHPAQWAAAAAFADERVETEVNRMLAAFRRRRDYLVERFRSEAPGIEFVEPHGAFYFFFRVDGIRESDPVTGQSFCEQLMKEEGVALVPGAAFADDRWVRLSYAVSDAELEQGLDRTLRLIRRLAAAHVAA

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
133 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
136 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
137 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
138 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
196 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.8
Rhizosphere 92.58
Stem 0
Stem Tuber 0
Unclassified 5.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0049922 3300048903 Bacteria 2708
2 Ga0065715_10006160 3300005293 Unclassified 4485
3 Ga0070676_10000934 3300005328 Bacteria 14482
4 Ga0068869_100001866 3300005334 Bacteria 12665
5 Ga0070680_100004199 3300005336 Bacteria 10802
6 Ga0070680_100012127 3300005336 Bacteria 6692
7 Ga0070689_100024347 3300005340 Bacteria 4540
8 Ga0070691_10023704 3300005341 Bacteria 2851
9 Ga0070669_100007421 3300005353 Bacteria 7855
10 Ga0070675_100020480 3300005354 Bacteria 5278
11 Ga0070675_100065343 3300005354 Bacteria 3008
12 Ga0070675_100089135 3300005354 Bacteria 2582
13 Ga0070671_100028067 3300005355 Bacteria 4634
14 Ga0070674_100000831 3300005356 Bacteria 15948
15 Ga0070673_100191368 3300005364 Bacteria 1758
16 Ga0070659_100040421 3300005366 Bacteria 3644
17 Ga0070667_100119888 3300005367 Bacteria 2288
18 Ga0070703_10000467 3300005406 Bacteria 16048
19 Ga0070709_10001134 3300005434 Bacteria 14680
20 Ga0070709_10004118 3300005434 Bacteria 7841
21 Ga0070709_10090188 3300005434 Bacteria 2020
22 Ga0070713_100122884 3300005436 Bacteria 2279
23 Ga0070701_10019873 3300005438 Bacteria 3178
24 Ga0070711_100000044 3300005439 Bacteria 83348
25 Ga0070711_100001663 3300005439 Bacteria 12307
26 Ga0070705_100001959 3300005440 Bacteria 10525
27 Ga0070705_100016036 3300005440 Bacteria 3885
28 Ga0070705_100036913 3300005440 Bacteria 2752
29 Ga0070705_100149086 3300005440 Bacteria 1549
30 Ga0070705_100169014 3300005440 Bacteria 1470
31 Ga0070700_100016208 3300005441 Bacteria 4243
32 Ga0070700_100094905 3300005441 Unclassified 1954
33 Ga0070694_100001372 3300005444 Bacteria 14239
34 Ga0070694_100010970 3300005444 Bacteria 5605
35 Ga0070694_100023272 3300005444 Bacteria 3982
36 Ga0070694_100032569 3300005444 Unclassified 3423
37 Ga0070694_100045769 3300005444 Bacteria 2934
38 Ga0070694_100046640 3300005444 Bacteria 2910
39 Ga0070708_100001959 3300005445 Bacteria 15884
40 Ga0070708_100027337 3300005445 Bacteria 4894
41 Ga0070708_100108400 3300005445 Bacteria 2551
42 Ga0070708_100183227 3300005445 Bacteria 1958
43 Ga0070663_100145496 3300005455 Bacteria 1813
44 Ga0070662_100000040 3300005457 Bacteria 73497
45 Ga0068867_100000144 3300005459 Bacteria 45710
46 Ga0068867_100035776 3300005459 Bacteria 3603
47 Ga0068867_100061178 3300005459 Bacteria 2795
48 Ga0070706_100006237 3300005467 Bacteria 11276
49 Ga0070706_100024909 3300005467 Bacteria 5508
50 Ga0070706_100026956 3300005467 Bacteria 5288
51 Ga0070706_100050888 3300005467 Bacteria 3822
52 Ga0070706_100139080 3300005467 Bacteria 2266
53 Ga0070707_100012065 3300005468 Bacteria 8066
54 Ga0070707_100012961 3300005468 Bacteria 7792
55 Ga0070707_100019845 3300005468 Bacteria 6335
56 Ga0070707_100050975 3300005468 Bacteria 3967
57 Ga0070707_100111611 3300005468 Bacteria 2652
58 Ga0070707_100153008 3300005468 Bacteria 2246
59 Ga0070707_100192822 3300005468 Bacteria 1987
60 Ga0070698_100000177 3300005471 Bacteria 59810
61 Ga0070698_100015174 3300005471 Bacteria 8147
62 Ga0070698_100052113 3300005471 Bacteria 4165
63 Ga0070698_100236915 3300005471 Bacteria 1758
64 Ga0070699_100000223 3300005518 Bacteria 56220
65 Ga0070699_100001420 3300005518 Bacteria 22009
66 Ga0070699_100005236 3300005518 Bacteria 11394
67 Ga0070699_100009236 3300005518 Bacteria 8545
68 Ga0070699_100012095 3300005518 Bacteria 7448
69 Ga0070699_100017078 3300005518 Bacteria 6232
70 Ga0070699_100048129 3300005518 Bacteria 3689
71 Ga0070699_100072241 3300005518 Bacteria 3001
72 Ga0070679_100003515 3300005530 Bacteria 14351
73 Ga0070697_100002784 3300005536 Bacteria 13462
74 Ga0070697_100023228 3300005536 Bacteria 4931
75 Ga0070697_100037466 3300005536 Bacteria 3918
76 Ga0070697_100127798 3300005536 Bacteria 2129
77 Ga0070697_100132064 3300005536 Unclassified 2095
78 Ga0070697_100180846 3300005536 Bacteria 1787
79 Ga0070697_100190018 3300005536 Unclassified 1743
80 Ga0070697_100223345 3300005536 Bacteria 1606
81 Ga0068853_100082799 3300005539 Bacteria 2811
82 Ga0070672_100025889 3300005543 Bacteria 4357
83 Ga0070686_100018042 3300005544 Bacteria 4135
84 Ga0070695_100008551 3300005545 Bacteria 6080
85 Ga0070695_100008684 3300005545 Bacteria 6039
86 Ga0070695_100013216 3300005545 Bacteria 4960
87 Ga0070695_100013899 3300005545 Bacteria 4845
88 Ga0070695_100179072 3300005545 Bacteria 1501
89 Ga0070696_100001224 3300005546 Bacteria 16673
90 Ga0070696_100001318 3300005546 Bacteria 16183
91 Ga0070696_100004804 3300005546 Bacteria 9033
92 Ga0070696_100027696 3300005546 Bacteria 3864
93 Ga0070696_100036348 3300005546 Unclassified 3396
94 Ga0070696_100038315 3300005546 Bacteria 3308
95 Ga0070696_100076699 3300005546 Bacteria 2360
96 Ga0070704_100000050 3300005549 Bacteria 38334
97 Ga0070704_100002906 3300005549 Bacteria 9728
98 Ga0070704_100003486 3300005549 Bacteria 9035
99 Ga0070704_100004132 3300005549 Bacteria 8381
100 Ga0070704_100028193 3300005549 Bacteria 3733
101 Ga0070704_100144829 3300005549 Bacteria 1860
102 Ga0068855_100072041 3300005563 Bacteria 4017
103 Ga0070664_100046952 3300005564 Bacteria 3648
104 Ga0070664_100148638 3300005564 Bacteria 2067
105 Ga0068857_100011682 3300005577 Bacteria 7637
106 Ga0068854_100032078 3300005578 Bacteria 3653
107 Ga0070702_100004064 3300005615 Bacteria 6633
108 Ga0068859_100065297 3300005617 Bacteria 3674
109 Ga0068864_100057632 3300005618 Bacteria 3356
110 Ga0068861_100007692 3300005719 Bacteria 7399
111 Ga0068861_100041293 3300005719 Bacteria 3455
112 Ga0068863_100019900 3300005841 Bacteria 6420
113 Ga0068860_100008778 3300005843 Bacteria 10071
114 Ga0068862_100057316 3300005844 Bacteria 3341
115 Ga0081455_10076933 3300005937 Unclassified 2747
116 Ga0070716_100012278 3300006173 Bacteria 4338
117 Ga0097621_100023709 3300006237 Bacteria 4781
118 Ga0075428_100007805 3300006844 Bacteria 11861
119 Ga0075428_100059529 3300006844 Bacteria 4182
120 Ga0075428_100067749 3300006844 Bacteria 3906
121 Ga0075430_100157290 3300006846 Bacteria 1892
122 Ga0075431_100007015 3300006847 Bacteria 11193
123 Ga0075431_100093783 3300006847 Unclassified 3098
124 Ga0075431_100094778 3300006847 Bacteria 3081
125 Ga0075431_100190628 3300006847 Bacteria 2101
126 Ga0075431_100221819 3300006847 Bacteria 1928
127 Ga0075431_100297790 3300006847 Bacteria 1630
128 Ga0075433_10000833 3300006852 Bacteria 21593
129 Ga0075433_10002735 3300006852 Bacteria 13475
130 Ga0075433_10020927 3300006852 Bacteria 5478
131 Ga0075433_10021621 3300006852 Bacteria 5396
132 Ga0075433_10189873 3300006852 Bacteria 1828
133 Ga0075433_10292326 3300006852 Bacteria 1443
134 Ga0075434_100000172 3300006871 Bacteria 41704
135 Ga0075434_100007011 3300006871 Bacteria 10392
136 Ga0075434_100008132 3300006871 Bacteria 9727
137 Ga0075434_100013320 3300006871 Bacteria 7821
138 Ga0075434_100022204 3300006871 Bacteria 6181
139 Ga0075434_100031807 3300006871 Bacteria 5203
140 Ga0075434_100035904 3300006871 Bacteria 4901
141 Ga0075434_100045778 3300006871 Bacteria 4340
142 Ga0075434_100067893 3300006871 Unclassified 3551
143 Ga0075434_100083994 3300006871 Bacteria 3183
144 Ga0075429_100001680 3300006880 Bacteria 18303
145 Ga0075429_100008890 3300006880 Bacteria 8730
146 Ga0075429_100058075 3300006880 Bacteria 3369
147 Ga0075429_100081470 3300006880 Bacteria 2822
148 Ga0068865_100002675 3300006881 Bacteria 10572
149 Ga0075436_100001138 3300006914 Bacteria 17995
150 Ga0075436_100016578 3300006914 Bacteria 5043
151 Ga0075436_100046734 3300006914 Bacteria 2985
152 Ga0075436_100061888 3300006914 Bacteria 2586
153 Ga0075436_100067488 3300006914 Bacteria 2472
154 Ga0075436_100085636 3300006914 Bacteria 2188
155 Ga0097620_100065294 3300006931 Bacteria 3674
156 Ga0075435_100030177 3300007076 Bacteria 4260
157 Ga0075435_100057158 3300007076 Bacteria 3155
158 Ga0075435_100114279 3300007076 Unclassified 2247
159 Ga0099794_10000050 3300007265 Bacteria 47670
160 Ga0105240_10157542 3300009093 Bacteria 2699
161 Ga0111539_10201895 3300009094 Bacteria 2318
162 Ga0111539_10211587 3300009094 Bacteria 2259
163 Ga0105245_10020471 3300009098 Bacteria 5802
164 Ga0114129_10000088 3300009147 Bacteria 86607
165 Ga0114129_10067128 3300009147 Bacteria 5003
166 Ga0114129_10131295 3300009147 Bacteria 3440
167 Ga0114129_10219256 3300009147 Bacteria 2567
168 Ga0105241_10005713 3300009174 Bacteria 9181
169 Ga0105242_10002732 3300009176 Bacteria 13802
170 Ga0105248_10011028 3300009177 Bacteria 9968
171 Ga0105248_10108281 3300009177 Bacteria 3133
172 Ga0105248_10137808 3300009177 Bacteria 2753
173 Ga0105237_10316655 3300009545 Unclassified 1563
174 Ga0105249_10018326 3300009553 Bacteria 6225
175 Ga0105239_10043001 3300010375 Unclassified 4950
176 Ga0157378_10007994 3300013297 Bacteria 9232
177 Ga0163162_10006930 3300013306 Bacteria 10986
178 Ga0157375_10027358 3300013308 Bacteria 5330
179 Ga0163163_10022598 3300014325 Bacteria 5960
180 Ga0157379_10020224 3300014968 Bacteria 5884
181 Ga0157376_10175269 3300014969 Bacteria 1956
182 Ga0207653_10000129 3300025885 Bacteria 53779
183 Ga0207653_10004357 3300025885 Bacteria 4443
184 Ga0207642_10026080 3300025899 Bacteria 2374
185 Ga0207680_10005496 3300025903 Bacteria 6058
186 Ga0207699_10000942 3300025906 Bacteria 13855
187 Ga0207645_10000321 3300025907 Bacteria 39983
188 Ga0207645_10104305 3300025907 Bacteria 1831
189 Ga0207643_10070107 3300025908 Bacteria 2016
190 Ga0207684_10015739 3300025910 Bacteria 6508
191 Ga0207684_10016947 3300025910 Bacteria 6259
192 Ga0207684_10020468 3300025910 Bacteria 5653
193 Ga0207684_10027829 3300025910 Bacteria 4815
194 Ga0207684_10047179 3300025910 Bacteria 3654
195 Ga0207684_10297273 3300025910 Bacteria 1392
196 Ga0207654_10061093 3300025911 Bacteria 2204
197 Ga0207707_10002038 3300025912 Bacteria 18339
198 Ga0207663_10000043 3300025916 Bacteria 72356
199 Ga0207660_10002666 3300025917 Bacteria 11709
200 Ga0207660_10031425 3300025917 Bacteria 3656
201 Ga0207652_10002920 3300025921 Bacteria 14305
202 Ga0207646_10000535 3300025922 Bacteria 50679
203 Ga0207646_10000629 3300025922 Bacteria 45840
204 Ga0207646_10000661 3300025922 Bacteria 44720
205 Ga0207646_10012816 3300025922 Bacteria 8036
206 Ga0207646_10028344 3300025922 Bacteria 5098
207 Ga0207646_10054370 3300025922 Bacteria 3582
208 Ga0207646_10124087 3300025922 Bacteria 2321
209 Ga0207646_10129881 3300025922 Bacteria 2267
210 Ga0207646_10225539 3300025922 Bacteria 1693
211 Ga0207681_10017751 3300025923 Bacteria 4472
212 Ga0207681_10079169 3300025923 Bacteria 2315
213 Ga0207659_10066388 3300025926 Bacteria 2618
214 Ga0207687_10011652 3300025927 Bacteria 5747
215 Ga0207644_10002175 3300025931 Bacteria 12714
216 Ga0207706_10000005 3300025933 Bacteria 224460
217 Ga0207686_10000138 3300025934 Bacteria 57684
218 Ga0207709_10001526 3300025935 Bacteria 15963
219 Ga0207709_10142504 3300025935 Bacteria 1649
220 Ga0207669_10000793 3300025937 Bacteria 13544
221 Ga0207704_10001201 3300025938 Bacteria 11543
222 Ga0207665_10005394 3300025939 Bacteria 8538
223 Ga0207691_10056259 3300025940 Bacteria 3583
224 Ga0207711_10004456 3300025941 Bacteria 11938
225 Ga0207689_10002369 3300025942 Bacteria 17598
226 Ga0207679_10206506 3300025945 Bacteria 1644
227 Ga0207712_10001867 3300025961 Bacteria 13847
228 Ga0207712_10019562 3300025961 Bacteria 4424
229 Ga0207640_10001195 3300025981 Bacteria 14196
230 Ga0207640_10144772 3300025981 Bacteria 1737
231 Ga0207658_10085146 3300025986 Bacteria 2434
232 Ga0207678_10087031 3300026067 Bacteria 2670
233 Ga0207678_10147203 3300026067 Bacteria 2010
234 Ga0207708_10011027 3300026075 Bacteria 6719
235 Ga0207708_10055996 3300026075 Bacteria 3007
236 Ga0207708_10125428 3300026075 Bacteria 2003
237 Ga0207641_10026367 3300026088 Bacteria 4796
238 Ga0207648_10000021 3300026089 Bacteria 139257
239 Ga0207676_10005318 3300026095 Bacteria 9121
240 Ga0207676_10049947 3300026095 Bacteria 3258
241 Ga0207674_10002007 3300026116 Bacteria 25837
242 Ga0207675_100005007 3300026118 Bacteria 12760
243 Ga0207683_10007954 3300026121 Bacteria 9067
244 Ga0209588_1001431 3300027671 Bacteria 6240
245 Ga0209974_10017212 3300027876 Bacteria 2398
246 Ga0268265_10076715 3300028380 Bacteria 2622
247 Ga0268264_10003167 3300028381 Bacteria 14253
248 Ga0307408_100021398 3300031548 Bacteria 4377
249 Ga0307408_100026771 3300031548 Bacteria 3966
250 Ga0307408_100032201 3300031548 Bacteria 3655
251 Ga0307408_100039457 3300031548 Bacteria 3338
252 Ga0307408_100056933 3300031548 Bacteria 2836
253 Ga0307408_100193392 3300031548 Bacteria 1641
254 Ga0307413_10003069 3300031824 Bacteria 6948
255 Ga0307413_10003750 3300031824 Bacteria 6468
256 Ga0307413_10014414 3300031824 Bacteria 4014
257 Ga0307413_10021091 3300031824 Bacteria 3481
258 Ga0307413_10030763 3300031824 Bacteria 3020
259 Ga0307410_10002313 3300031852 Bacteria 9158
260 Ga0307410_10004714 3300031852 Bacteria 7098
261 Ga0307410_10007416 3300031852 Bacteria 6003
262 Ga0307410_10027842 3300031852 Bacteria 3576
263 Ga0307410_10030575 3300031852 Bacteria 3443
264 Ga0307410_10047659 3300031852 Bacteria 2865
265 Ga0307410_10060875 3300031852 Bacteria 2582
266 Ga0307410_10084838 3300031852 Bacteria 2234
267 Ga0307410_10175098 3300031852 Bacteria 1620
268 Ga0307410_10201244 3300031852 Bacteria 1520
269 Ga0307406_10015959 3300031901 Bacteria 4355
270 Ga0307406_10063146 3300031901 Bacteria 2398
271 Ga0307407_10000462 3300031903 Bacteria 12434
272 Ga0307407_10020162 3300031903 Bacteria 3410
273 Ga0307407_10031233 3300031903 Bacteria 2882
274 Ga0307407_10049912 3300031903 Bacteria 2391
275 Ga0307407_10060288 3300031903 Bacteria 2214
276 Ga0307407_10062568 3300031903 Unclassified 2180
277 Ga0307409_100000247 3300031995 Bacteria 21734
278 Ga0307409_100122523 3300031995 Bacteria 2205
279 Ga0307409_100201511 3300031995 Bacteria 1781
280 Ga0307416_100001153 3300032002 Bacteria 14195
281 Ga0307416_100013871 3300032002 Bacteria 5494
282 Ga0307416_100016105 3300032002 Bacteria 5183
283 Ga0307416_100029282 3300032002 Bacteria 4110
284 Ga0307416_100110503 3300032002 Bacteria 2420
285 Ga0307416_100185076 3300032002 Bacteria 1957
286 Ga0307416_100196157 3300032002 Bacteria 1910
287 Ga0307416_100407613 3300032002 Bacteria 1399
288 Ga0307414_10007551 3300032004 Bacteria 6112
289 Ga0307414_10018951 3300032004 Bacteria 4253
290 Ga0307414_10023604 3300032004 Bacteria 3904
291 Ga0307414_10153747 3300032004 Bacteria 1818
292 Ga0307414_10313563 3300032004 Bacteria 1332
293 Ga0307411_10000866 3300032005 Bacteria 11404
294 Ga0307411_10005612 3300032005 Bacteria 6183
295 Ga0307411_10024985 3300032005 Unclassified 3571
296 Ga0307411_10033784 3300032005 Bacteria 3175
297 Ga0307411_10056301 3300032005 Bacteria 2591
298 Ga0307415_100000248 3300032126 Bacteria 23334
299 Ga0307415_100029962 3300032126 Bacteria 3485
300 Ga0307415_100031489 3300032126 Bacteria 3417
301 Ga0307415_100035119 3300032126 Bacteria 3272
302 Ga0307415_100090279 3300032126 Bacteria 2215
303 Ga0373926_0079083 3300035083 Unclassified 1214
304 Ga0373940_0012812 3300035088 Bacteria 2015
305 Ga0395905_0133931 3300037471 Bacteria 2331
306 Ga0242420_008608 3300038996 Bacteria 1659
307 Ga0439439_0003244 3300041406 Bacteria 3572
308 Ga0451845_0785350 3300041501 Bacteria 1579
309 Ga0439448_0015878 3300042005 Unclassified 2286
310 Ga0451577_0069110 3300042876 Bacteria 3150
311 Ga0451577_0288472 3300042876 Bacteria 1487
312 Ga0453683_0060361 3300044673 Bacteria 2371
313 Ga0451576_0009516 3300045051 Bacteria 11262
314 Ga0451576_0018744 3300045051 Bacteria 7569
315 Ga0451576_0045957 3300045051 Bacteria 4598
316 Ga0451576_0096160 3300045051 Bacteria 3081
317 Ga0451576_0130383 3300045051 Bacteria 2620
318 Ga0451576_0149358 3300045051 Bacteria 2437
319 Ga0495603_0007643 3300046455 Bacteria 6509
320 Ga0495603_0069946 3300046455 Bacteria 2064
321 Ga0495594_0052381 3300046499 Bacteria 2247
322 Ga0495618_0036495 3300046514 Bacteria 3084
323 Ga0495630_0037041 3300046517 Bacteria 3646
324 Ga0495666_0004475 3300046526 Bacteria 7063
325 Ga0495586_0003778 3300046535 Bacteria 8114
326 Ga0495621_0012898 3300046539 Bacteria 2615
327 Ga0495667_0107608 3300046559 Bacteria 1802
328 Ga0495634_0006976 3300046642 Bacteria 8527
329 Ga0495647_0003807 3300046681 Bacteria 4854
330 Ga0495658_0001536 3300046683 Bacteria 12093
331 Ga0495613_0129280 3300046689 Bacteria 1809
332 Ga0495624_0043460 3300046690 Unclassified 2867
333 Ga0495581_0100870 3300047315 Bacteria 1677
334 Ga0495636_0031070 3300047318 Bacteria 2188
335 Ga0495636_0079534 3300047318 Bacteria 1410
336 Ga0495674_0014539 3300047319 Bacteria 7364
337 Ga0495680_0053435 3300047322 Bacteria 3143
338 Ga0495684_0019760 3300047471 Bacteria 5191
339 Ga0496101_0009575 3300048904 Bacteria 6373
340 Ga0496101_0011362 3300048904 Bacteria 5906
341 Ga0496101_0246501 3300048904 Bacteria 1391
342 Ga0496102_0008242 3300048905 Bacteria 8923
343 Ga0496104_0003753 3300048907 Bacteria 13132
344 Ga0496104_0110673 3300048907 Bacteria 2633
345 Ga0496105_0036074 3300048908 Unclassified 4072
346 Ga0496106_0011883 3300048909 Bacteria 6429
347 Ga0496106_0067681 3300048909 Bacteria 2723
348 Ga0496106_0125594 3300048909 Unclassified 2008
349 Ga0496107_0115721 3300048910 Unclassified 1973
350 Ga0496108_0000454 3300048911 Bacteria 32702
351 Ga0496108_0009954 3300048911 Bacteria 7708
352 Ga0496108_0019660 3300048911 Bacteria 5547
353 Ga0496108_0107280 3300048911 Bacteria 2385
354 Ga0496109_0004370 3300048912 Bacteria 11806
355 Ga0496109_0005209 3300048912 Bacteria 10861
356 Ga0496109_0010198 3300048912 Bacteria 8019
357 Ga0496110_0000864 3300048913 Bacteria 21380
358 Ga0496110_0004625 3300048913 Bacteria 10691
359 Ga0496110_0019220 3300048913 Bacteria 5745
360 Ga0496111_0033533 3300048914 Bacteria 3662
361 Ga0496111_0093012 3300048914 Bacteria 2210
362 Ga0496111_0278594 3300048914 Bacteria 1240
363 Ga0496112_0000336 3300048915 Bacteria 30511
364 Ga0496112_0004662 3300048915 Bacteria 11657
365 Ga0496113_0000286 3300048916 Bacteria 23871
366 Ga0496113_0006494 3300048916 Bacteria 7419
367 Ga0496113_0011050 3300048916 Bacteria 6003
368 Ga0496113_0028948 3300048916 Bacteria 3992
369 Ga0496114_0013905 3300048917 Bacteria 6452
370 Ga0496115_0013742 3300048918 Bacteria 6130
371 Ga0496125_0004054 3300048928 Bacteria 17159
372 Ga0496126_0194101 3300048929 Bacteria 1718
373 Ga0501031_0039867 3300049568 Bacteria 3066
374 Ga0501034_0017102 3300049571 Bacteria 7438
375 Ga0501034_0212731 3300049571 Bacteria 1888
376 Ga0501039_0087081 3300049575 Bacteria 2433
377 Ga0501040_0036347 3300049576 Bacteria 3342
378 Ga0501041_0020248 3300049577 Bacteria 3976
379 Ga0501041_0042316 3300049577 Bacteria 2768
380 Ga0501042_0069499 3300049578 Bacteria 2519
381 Ga0501042_0236238 3300049578 Bacteria 1319
382 Ga0501046_0116891 3300049580 Bacteria 2032
383 Ga0501046_0131962 3300049580 Bacteria 1894
384 Ga0501046_0162260 3300049580 Unclassified 1680
385 Ga0501048_0198190 3300049582 Bacteria 1423
386 Ga0501067_0000231 3300049583 Bacteria 31040
387 Ga0501067_0002656 3300049583 Bacteria 9897
388 Ga0501067_0022414 3300049583 Bacteria 3495
389 Ga0501068_0000304 3300049584 Bacteria 24649
390 Ga0501068_0000800 3300049584 Bacteria 16291
391 Ga0501069_0000927 3300049585 Bacteria 13975
392 Ga0501069_0002309 3300049585 Bacteria 9623
393 Ga0501069_0042662 3300049585 Bacteria 2510
394 Ga0501070_0016431 3300049586 Bacteria 6218
395 Ga0501070_0017364 3300049586 Bacteria 6040
396 Ga0501070_0066037 3300049586 Bacteria 2996
397 Ga0501071_0000299 3300049587 Bacteria 23755
398 Ga0501071_0001122 3300049587 Bacteria 14936
399 Ga0501071_0077129 3300049587 Bacteria 2434
400 Ga0501072_0000976 3300049588 Bacteria 21106
401 Ga0501072_0022301 3300049588 Bacteria 4912
402 Ga0501072_0026046 3300049588 Bacteria 4557
403 Ga0501072_0142206 3300049588 Bacteria 1913
404 Ga0501073_0003940 3300049589 Bacteria 11135
405 Ga0501073_0013588 3300049589 Bacteria 5920
406 Ga0501074_0002172 3300049590 Bacteria 13596
407 Ga0501074_0029559 3300049590 Bacteria 3969
408 Ga0501074_0104644 3300049590 Bacteria 2026
409 Ga0501074_0180092 3300049590 Bacteria 1508
410 Ga0501075_0002353 3300049591 Bacteria 12550
411 Ga0501076_0003299 3300049592 Bacteria 11307
412 Ga0501076_0003849 3300049592 Bacteria 10565
413 Ga0501077_0000619 3300049593 Bacteria 21558
414 Ga0501077_0009097 3300049593 Bacteria 6165
415 Ga0501077_0016791 3300049593 Bacteria 4616
416 Ga0501077_0023446 3300049593 Bacteria 3914
417 Ga0501217_009447 3300049661 Bacteria 2122
418 Ga0501233_019878 3300049668 Bacteria 1428
419 Ga0501079_0011096 3300049741 Bacteria 6873
420 Ga0501080_0010196 3300049742 Bacteria 8593
421 Ga0501080_0011435 3300049742 Bacteria 8128
422 Ga0501080_0029630 3300049742 Bacteria 5096
423 Ga0501080_0033972 3300049742 Bacteria 4762
424 Ga0501080_0315349 3300049742 Bacteria 1416
425 Ga0501081_0002874 3300049743 Bacteria 10940
426 Ga0501081_0007418 3300049743 Bacteria 7116
427 Ga0501081_0015568 3300049743 Bacteria 5020
428 Ga0501081_0163258 3300049743 Bacteria 1606
429 Ga0501083_0003576 3300049744 Bacteria 10893
430 Ga0501083_0003755 3300049744 Bacteria 10664
431 Ga0501271_003295 3300049768 Bacteria 1483
432 Ga0501035_0162123 3300049822 Bacteria 1935
433 Ga0501045_0004905 3300049824 Bacteria 9269
434 nmdc:mga05p37_115577_c1 3300050507 Bacteria 3298
435 nmdc:mga05p37_2000_c1 3300050507 Bacteria 23799
436 nmdc:mga05p37_297739_c1 3300050507 Bacteria 1918
437 nmdc:mga05p37_483647_c1 3300050507 Bacteria 1425
438 nmdc:mga09592_105367_c1 3300050508 Bacteria 2418
439 nmdc:mga09592_37861_c1 3300050508 Unclassified 4047
440 nmdc:mga09592_51604_c1 3300050508 Bacteria 3470
441 nmdc:mga0qj67_148833_c1 3300050509 Bacteria 1899
442 nmdc:mga06r32_108663_c1 3300050510 Bacteria 2727
443 nmdc:mga06r32_238834_c1 3300050510 Unclassified 1805
444 nmdc:mga06r32_318451_c1 3300050510 Bacteria 1541
445 nmdc:mga06r32_5686_c1 3300050510 Bacteria 11222
446 nmdc:mga0n895_10955_c1 3300050512 Bacteria 8058
447 nmdc:mga0n895_13744_c1 3300050512 Bacteria 7320
448 nmdc:mga0n895_1413_c1 3300050512 Bacteria 17930
449 nmdc:mga0n895_2633_c1 3300050512 Bacteria 14142
450 nmdc:mga0n895_275579_c1 3300050512 Bacteria 1706
451 nmdc:mga0n895_5151_c1 3300050512 Bacteria 10481
452 nmdc:mga0n895_82891_c1 3300050512 Bacteria 3197
453 nmdc:mga0n895_9506_c1 3300050512 Bacteria 8510
454 nmdc:mga0rr50_29101_c1 3300050513 Bacteria 3892
455 nmdc:mga0rr50_63525_c1 3300050513 Bacteria 2789
456 nmdc:mga0rr50_99404_c1 3300050513 Unclassified 2283
457 nmdc:mga08x19_12850_c1 3300050514 Bacteria 5051
458 nmdc:mga08x19_17672_c1 3300050514 Bacteria 4367
459 nmdc:mga08x19_24051_c1 3300050514 Bacteria 3783
460 nmdc:mga08x19_2625_c1 3300050514 Bacteria 10889
461 nmdc:mga08x19_4217_c1 3300050514 Bacteria 8521
462 nmdc:mga0a205_10901_c1 3300050515 Bacteria 8362
463 nmdc:mga0a205_119996_c1 3300050515 Bacteria 2529
464 nmdc:mga0a205_140133_c1 3300050515 Bacteria 2319
465 nmdc:mga0a205_18558_c1 3300050515 Bacteria 6542
466 nmdc:mga0a205_262884_c1 3300050515 Bacteria 1603
467 nmdc:mga0a205_32364_c1 3300050515 Bacteria 5014
468 Ga0501084_0002204 3300054114 Bacteria 15623
469 Ga0501084_0003477 3300054114 Bacteria 12796
470 Ga0501084_0003949 3300054114 Bacteria 12082
471 Ga0501084_0004681 3300054114 Bacteria 11173
472 Ga0501084_0023406 3300054114 Bacteria 5155
473 Ga0501084_0183575 3300054114 Unclassified 1766
474 Ga0590071_001783 3300059421 Bacteria 5559
475 Ga0590071_007629 3300059421 Bacteria 2557
476 Ga0590071_013862 3300059421 Bacteria 1889
477 Ga0590074_002313 3300059423 Bacteria 3126
478 Ga0590077_003194 3300059426 Bacteria 3412
479 Ga0501082_0009979 3300060353 Bacteria 8188
480 Ga0501082_0024675 3300060353 Bacteria 5182
481 Ga0501082_0034861 3300060353 Bacteria 4337
482 Ga0501082_0091120 3300060353 Unclassified 2632
483 Ga0501082_0109164 3300060353 Bacteria 2395
484 Ga0530510_0152252 3300061734 Bacteria 1708
485 Ga0530510_0180138 3300061734 Bacteria 1567
486 Ga0496100_0049922
487 Ga0065715_10006160
488 Ga0070676_10000934
489 Ga0068869_100001866
490 Ga0070680_100004199
491 Ga0070680_100012127
492 Ga0070689_100024347
493 Ga0070691_10023704
494 Ga0070669_100007421
495 Ga0070675_100020480
496 Ga0070675_100065343
497 Ga0070675_100089135
498 Ga0070671_100028067
499 Ga0070674_100000831
500 Ga0070673_100191368
501 Ga0070659_100040421
502 Ga0070667_100119888
503 Ga0070703_10000467
504 Ga0070709_10001134
505 Ga0070709_10004118
506 Ga0070709_10090188
507 Ga0070713_100122884
508 Ga0070701_10019873
509 Ga0070711_100000044
510 Ga0070711_100001663
511 Ga0070705_100001959
512 Ga0070705_100016036
513 Ga0070705_100036913
514 Ga0070705_100149086
515 Ga0070705_100169014
516 Ga0070700_100016208
517 Ga0070700_100094905
518 Ga0070694_100001372
519 Ga0070694_100010970
520 Ga0070694_100023272
521 Ga0070694_100032569
522 Ga0070694_100045769
523 Ga0070694_100046640
524 Ga0070708_100001959
525 Ga0070708_100027337
526 Ga0070708_100108400
527 Ga0070708_100183227
528 Ga0070663_100145496
529 Ga0070662_100000040
530 Ga0068867_100000144
531 Ga0068867_100035776
532 Ga0068867_100061178
533 Ga0070706_100006237
534 Ga0070706_100024909
535 Ga0070706_100026956
536 Ga0070706_100050888
537 Ga0070706_100139080
538 Ga0070707_100012065
539 Ga0070707_100012961
540 Ga0070707_100019845
541 Ga0070707_100050975
542 Ga0070707_100111611
543 Ga0070707_100153008
544 Ga0070707_100192822
545 Ga0070698_100000177
546 Ga0070698_100015174
547 Ga0070698_100052113
548 Ga0070698_100236915
549 Ga0070699_100000223
550 Ga0070699_100001420
551 Ga0070699_100005236
552 Ga0070699_100009236
553 Ga0070699_100012095
554 Ga0070699_100017078
555 Ga0070699_100048129
556 Ga0070699_100072241
557 Ga0070679_100003515
558 Ga0070697_100002784
559 Ga0070697_100023228
560 Ga0070697_100037466
561 Ga0070697_100127798
562 Ga0070697_100132064
563 Ga0070697_100180846
564 Ga0070697_100190018
565 Ga0070697_100223345
566 Ga0068853_100082799
567 Ga0070672_100025889
568 Ga0070686_100018042
569 Ga0070695_100008551
570 Ga0070695_100008684
571 Ga0070695_100013216
572 Ga0070695_100013899
573 Ga0070695_100179072
574 Ga0070696_100001224
575 Ga0070696_100001318
576 Ga0070696_100004804
577 Ga0070696_100027696
578 Ga0070696_100036348
579 Ga0070696_100038315
580 Ga0070696_100076699
581 Ga0070704_100000050
582 Ga0070704_100002906
583 Ga0070704_100003486
584 Ga0070704_100004132
585 Ga0070704_100028193
586 Ga0070704_100144829
587 Ga0068855_100072041
588 Ga0070664_100046952
589 Ga0070664_100148638
590 Ga0068857_100011682
591 Ga0068854_100032078
592 Ga0070702_100004064
593 Ga0068859_100065297
594 Ga0068864_100057632
595 Ga0068861_100007692
596 Ga0068861_100041293
597 Ga0068863_100019900
598 Ga0068860_100008778
599 Ga0068862_100057316
600 Ga0081455_10076933
601 Ga0070716_100012278
602 Ga0097621_100023709
603 Ga0075428_100007805
604 Ga0075428_100059529
605 Ga0075428_100067749
606 Ga0075430_100157290
607 Ga0075431_100007015
608 Ga0075431_100093783
609 Ga0075431_100094778
610 Ga0075431_100190628
611 Ga0075431_100221819
612 Ga0075431_100297790
613 Ga0075433_10000833
614 Ga0075433_10002735
615 Ga0075433_10020927
616 Ga0075433_10021621
617 Ga0075433_10189873
618 Ga0075433_10292326
619 Ga0075434_100000172
620 Ga0075434_100007011
621 Ga0075434_100008132
622 Ga0075434_100013320
623 Ga0075434_100022204
624 Ga0075434_100031807
625 Ga0075434_100035904
626 Ga0075434_100045778
627 Ga0075434_100067893
628 Ga0075434_100083994
629 Ga0075429_100001680
630 Ga0075429_100008890
631 Ga0075429_100058075
632 Ga0075429_100081470
633 Ga0068865_100002675
634 Ga0075436_100001138
635 Ga0075436_100016578
636 Ga0075436_100046734
637 Ga0075436_100061888
638 Ga0075436_100067488
639 Ga0075436_100085636
640 Ga0097620_100065294
641 Ga0075435_100030177
642 Ga0075435_100057158
643 Ga0075435_100114279
644 Ga0099794_10000050
645 Ga0105240_10157542
646 Ga0111539_10201895
647 Ga0111539_10211587
648 Ga0105245_10020471
649 Ga0114129_10000088
650 Ga0114129_10067128
651 Ga0114129_10131295
652 Ga0114129_10219256
653 Ga0105241_10005713
654 Ga0105242_10002732
655 Ga0105248_10011028
656 Ga0105248_10108281
657 Ga0105248_10137808
658 Ga0105237_10316655
659 Ga0105249_10018326
660 Ga0105239_10043001
661 Ga0157378_10007994
662 Ga0163162_10006930
663 Ga0157375_10027358
664 Ga0163163_10022598
665 Ga0157379_10020224
666 Ga0157376_10175269
667 Ga0207653_10000129
668 Ga0207653_10004357
669 Ga0207642_10026080
670 Ga0207680_10005496
671 Ga0207699_10000942
672 Ga0207645_10000321
673 Ga0207645_10104305
674 Ga0207643_10070107
675 Ga0207684_10015739
676 Ga0207684_10016947
677 Ga0207684_10020468
678 Ga0207684_10027829
679 Ga0207684_10047179
680 Ga0207684_10297273
681 Ga0207654_10061093
682 Ga0207707_10002038
683 Ga0207663_10000043
684 Ga0207660_10002666
685 Ga0207660_10031425
686 Ga0207652_10002920
687 Ga0207646_10000535
688 Ga0207646_10000629
689 Ga0207646_10000661
690 Ga0207646_10012816
691 Ga0207646_10028344
692 Ga0207646_10054370
693 Ga0207646_10124087
694 Ga0207646_10129881
695 Ga0207646_10225539
696 Ga0207681_10017751
697 Ga0207681_10079169
698 Ga0207659_10066388
699 Ga0207687_10011652
700 Ga0207644_10002175
701 Ga0207706_10000005
702 Ga0207686_10000138
703 Ga0207709_10001526
704 Ga0207709_10142504
705 Ga0207669_10000793
706 Ga0207704_10001201
707 Ga0207665_10005394
708 Ga0207691_10056259
709 Ga0207711_10004456
710 Ga0207689_10002369
711 Ga0207679_10206506
712 Ga0207712_10001867
713 Ga0207712_10019562
714 Ga0207640_10001195
715 Ga0207640_10144772
716 Ga0207658_10085146
717 Ga0207678_10087031
718 Ga0207678_10147203
719 Ga0207708_10011027
720 Ga0207708_10055996
721 Ga0207708_10125428
722 Ga0207641_10026367
723 Ga0207648_10000021
724 Ga0207676_10005318
725 Ga0207676_10049947
726 Ga0207674_10002007
727 Ga0207675_100005007
728 Ga0207683_10007954
729 Ga0209588_1001431
730 Ga0209974_10017212
731 Ga0268265_10076715
732 Ga0268264_10003167
733 Ga0307408_100021398
734 Ga0307408_100026771
735 Ga0307408_100032201
736 Ga0307408_100039457
737 Ga0307408_100056933
738 Ga0307408_100193392
739 Ga0307413_10003069
740 Ga0307413_10003750
741 Ga0307413_10014414
742 Ga0307413_10021091
743 Ga0307413_10030763
744 Ga0307410_10002313
745 Ga0307410_10004714
746 Ga0307410_10007416
747 Ga0307410_10027842
748 Ga0307410_10030575
749 Ga0307410_10047659
750 Ga0307410_10060875
751 Ga0307410_10084838
752 Ga0307410_10175098
753 Ga0307410_10201244
754 Ga0307406_10015959
755 Ga0307406_10063146
756 Ga0307407_10000462
757 Ga0307407_10020162
758 Ga0307407_10031233
759 Ga0307407_10049912
760 Ga0307407_10060288
761 Ga0307407_10062568
762 Ga0307409_100000247
763 Ga0307409_100122523
764 Ga0307409_100201511
765 Ga0307416_100001153
766 Ga0307416_100013871
767 Ga0307416_100016105
768 Ga0307416_100029282
769 Ga0307416_100110503
770 Ga0307416_100185076
771 Ga0307416_100196157
772 Ga0307416_100407613
773 Ga0307414_10007551
774 Ga0307414_10018951
775 Ga0307414_10023604
776 Ga0307414_10153747
777 Ga0307414_10313563
778 Ga0307411_10000866
779 Ga0307411_10005612
780 Ga0307411_10024985
781 Ga0307411_10033784
782 Ga0307411_10056301
783 Ga0307415_100000248
784 Ga0307415_100029962
785 Ga0307415_100031489
786 Ga0307415_100035119
787 Ga0307415_100090279
788 Ga0373926_0079083
789 Ga0373940_0012812
790 Ga0395905_0133931
791 Ga0242420_008608
792 Ga0439439_0003244
793 Ga0451845_0785350
794 Ga0439448_0015878
795 Ga0451577_0069110
796 Ga0451577_0288472
797 Ga0453683_0060361
798 Ga0451576_0009516
799 Ga0451576_0018744
800 Ga0451576_0045957
801 Ga0451576_0096160
802 Ga0451576_0130383
803 Ga0451576_0149358
804 Ga0495603_0007643
805 Ga0495603_0069946
806 Ga0495594_0052381
807 Ga0495618_0036495
808 Ga0495630_0037041
809 Ga0495666_0004475
810 Ga0495586_0003778
811 Ga0495621_0012898
812 Ga0495667_0107608
813 Ga0495634_0006976
814 Ga0495647_0003807
815 Ga0495658_0001536
816 Ga0495613_0129280
817 Ga0495624_0043460
818 Ga0495581_0100870
819 Ga0495636_0031070
820 Ga0495636_0079534
821 Ga0495674_0014539
822 Ga0495680_0053435
823 Ga0495684_0019760
824 Ga0496101_0009575
825 Ga0496101_0011362
826 Ga0496101_0246501
827 Ga0496102_0008242
828 Ga0496104_0003753
829 Ga0496104_0110673
830 Ga0496105_0036074
831 Ga0496106_0011883
832 Ga0496106_0067681
833 Ga0496106_0125594
834 Ga0496107_0115721
835 Ga0496108_0000454
836 Ga0496108_0009954
837 Ga0496108_0019660
838 Ga0496108_0107280
839 Ga0496109_0004370
840 Ga0496109_0005209
841 Ga0496109_0010198
842 Ga0496110_0000864
843 Ga0496110_0004625
844 Ga0496110_0019220
845 Ga0496111_0033533
846 Ga0496111_0093012
847 Ga0496111_0278594
848 Ga0496112_0000336
849 Ga0496112_0004662
850 Ga0496113_0000286
851 Ga0496113_0006494
852 Ga0496113_0011050
853 Ga0496113_0028948
854 Ga0496114_0013905
855 Ga0496115_0013742
856 Ga0496125_0004054
857 Ga0496126_0194101
858 Ga0501031_0039867
859 Ga0501034_0017102
860 Ga0501034_0212731
861 Ga0501039_0087081
862 Ga0501040_0036347
863 Ga0501041_0020248
864 Ga0501041_0042316
865 Ga0501042_0069499
866 Ga0501042_0236238
867 Ga0501046_0116891
868 Ga0501046_0131962
869 Ga0501046_0162260
870 Ga0501048_0198190
871 Ga0501067_0000231
872 Ga0501067_0002656
873 Ga0501067_0022414
874 Ga0501068_0000304
875 Ga0501068_0000800
876 Ga0501069_0000927
877 Ga0501069_0002309
878 Ga0501069_0042662
879 Ga0501070_0016431
880 Ga0501070_0017364
881 Ga0501070_0066037
882 Ga0501071_0000299
883 Ga0501071_0001122
884 Ga0501071_0077129
885 Ga0501072_0000976
886 Ga0501072_0022301
887 Ga0501072_0026046
888 Ga0501072_0142206
889 Ga0501073_0003940
890 Ga0501073_0013588
891 Ga0501074_0002172
892 Ga0501074_0029559
893 Ga0501074_0104644
894 Ga0501074_0180092
895 Ga0501075_0002353
896 Ga0501076_0003299
897 Ga0501076_0003849
898 Ga0501077_0000619
899 Ga0501077_0009097
900 Ga0501077_0016791
901 Ga0501077_0023446
902 Ga0501217_009447
903 Ga0501233_019878
904 Ga0501079_0011096
905 Ga0501080_0010196
906 Ga0501080_0011435
907 Ga0501080_0029630
908 Ga0501080_0033972
909 Ga0501080_0315349
910 Ga0501081_0002874
911 Ga0501081_0007418
912 Ga0501081_0015568
913 Ga0501081_0163258
914 Ga0501083_0003576
915 Ga0501083_0003755
916 Ga0501271_003295
917 Ga0501035_0162123
918 Ga0501045_0004905
919 nmdc:mga05p37_115577_c1
920 nmdc:mga05p37_2000_c1
921 nmdc:mga05p37_297739_c1
922 nmdc:mga05p37_483647_c1
923 nmdc:mga09592_105367_c1
924 nmdc:mga09592_37861_c1
925 nmdc:mga09592_51604_c1
926 nmdc:mga0qj67_148833_c1
927 nmdc:mga06r32_108663_c1
928 nmdc:mga06r32_238834_c1
929 nmdc:mga06r32_318451_c1
930 nmdc:mga06r32_5686_c1
931 nmdc:mga0n895_10955_c1
932 nmdc:mga0n895_13744_c1
933 nmdc:mga0n895_1413_c1
934 nmdc:mga0n895_2633_c1
935 nmdc:mga0n895_275579_c1
936 nmdc:mga0n895_5151_c1
937 nmdc:mga0n895_82891_c1
938 nmdc:mga0n895_9506_c1
939 nmdc:mga0rr50_29101_c1
940 nmdc:mga0rr50_63525_c1
941 nmdc:mga0rr50_99404_c1
942 nmdc:mga08x19_12850_c1
943 nmdc:mga08x19_17672_c1
944 nmdc:mga08x19_24051_c1
945 nmdc:mga08x19_2625_c1
946 nmdc:mga08x19_4217_c1
947 nmdc:mga0a205_10901_c1
948 nmdc:mga0a205_119996_c1
949 nmdc:mga0a205_140133_c1
950 nmdc:mga0a205_18558_c1
951 nmdc:mga0a205_262884_c1
952 nmdc:mga0a205_32364_c1
953 Ga0501084_0002204
954 Ga0501084_0003477
955 Ga0501084_0003949
956 Ga0501084_0004681
957 Ga0501084_0023406
958 Ga0501084_0183575
959 Ga0590071_001783
960 Ga0590071_007629
961 Ga0590071_013862
962 Ga0590074_002313
963 Ga0590077_003194
964 Ga0501082_0009979
965 Ga0501082_0024675
966 Ga0501082_0034861
967 Ga0501082_0091120
968 Ga0501082_0109164
969 Ga0530510_0152252
970 Ga0530510_0180138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

86

443

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j32-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9662 4 396
1bkg-assembly1.cif.gz_B aspartate aminotransferase from thermus thermophilus with maleate 0.9617 4 392
1j32-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9565 4 396
1gd9-assembly1.cif.gz_B crystall structure of pyrococcus protein-a1 0.9558 8 397
1o4s-assembly1.cif.gz_A crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution 0.9536 5 395
ID Description Score Start End Superfamily
1j32B02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9649 64 285 3.40.640.10
af_A0A0R0HS10_77_301_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9573 63 285 3.40.640.10
1gd9A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9546 64 285 3.40.640.10
1j32B02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9523 64 285 3.40.640.10
6f77C02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9516 64 285 3.40.640.10
ID Description Score Start End GO Terms
AF-X0Z4H7-F1-model_v4 Aminotransferase class I/classII large domain-containing protein 0.9751 4 307 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A2H0PKY0-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.967 1 395 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A497JEZ3-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9666 11 303 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A7X3ZA16-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9664 20 332 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A3B8U1D6-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9663 5 396 GO:0006520
GO:0008483
GO:0009058
GO:0030170

Map