F453112

General Info

Members Datasets Scaffolds Average Seq Length
485 291 456 452

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10066064|Ga0207645_100660642
Length 515
Sequence MKILFRNNMQLAKATTLVAVENLQNLNCCIQIAEGPVTKRKGNPELLLRTRQDSPSAEHLYLRTYQSQLAHMKKYFLFYLLFSQIASAQKANDVTAPLHLMKPEYAVPYGAPTKEMVQSVLDRVYNYLDRTTPTGFVNRTTGNEVSLNAIDTNTTLKPGDFRLTSYEWGVTYSGMLEIAAATGDKKYSDYTNKRVDFIISSLPAFTKLYQLYPKSSNPLRQPIAPHALDDVGALCAAMIKTLRAGGNTNIRALVDSYMQYISTKEFRLPDGTLARNRPQPNTLWLDDLYMSVPALAQMGKLTGEEKYFNDAVKQIELFSNRMFNKTLNIYMHGWVQEMNVHPEFHWARANGWALMAMTELLDVLPANHPGRAKLLEQFQAHAKGLVSFQSGQGFWHQLLDRNDSYLETSATAIYAYCLARGVNKGWLDAKAFAPAAVLAWNAVTTKVNDNGQVEGTCVGTGMGFDPAFYYYRPVNVFAAHGYGPVLLAGAEIIQLLTDFSFYINDSSLQLKEKNK

Samples

Sample ID Description Type Environment
1 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
2 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 2738543023 Pedobacter sp. OK628 Isolate Unclassified
5 2739367651 Pedobacter sp. OK291 Isolate Unclassified
6 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
7 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
8 2818991444 Filimonas endophytica 3197 Isolate Unclassified
9 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
10 2842711865 Duganella sp. R-73148 Isolate Unclassified
11 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
12 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
13 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
14 2857564685 Duganella sp. R-74599 Isolate Unclassified
15 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
16 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
17 2904424332 Duganella sp. 1411 Isolate Rhizosphere
18 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
19 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
20 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
21 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
22 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
23 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
24 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
25 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
26 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
27 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
28 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
29 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
30 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
31 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
40 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
41 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
45 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
46 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
167 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
168 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
172 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
173 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
174 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
175 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
176 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
195 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
196 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
197 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
198 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
199 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
200 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
201 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
218 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
219 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
220 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
223 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
224 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
225 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
226 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
229 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
235 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
236 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
241 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
242 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
243 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
244 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
245 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
246 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
247 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
248 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
249 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
253 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
254 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
259 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
260 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
261 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
262 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
263 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
264 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
265 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
266 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
267 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
268 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
275 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
276 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
277 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
278 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
279 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
280 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
281 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
282 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
283 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
284 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
285 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
286 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
287 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
288 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
289 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
290 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
291 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.02
Metatranscriptomes 0
Isolates 5.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.64
Nodule 0
Rhizoplane 0.62
Rhizosphere 77.73
Stem 0
Stem Tuber 0
Unclassified 7.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002008 3300001979 Bacteria 9298
2 JGI24739J22299_10000110 3300001989 Bacteria 25280
3 JGI25154J39366_1000001 3300002738 Bacteria 483450
4 JGI25150J39212_1005445 3300002774 Bacteria 2715
5 JGI25159J45721_1008811 3300002987 Bacteria 2732
6 JGI25153J46596_10000345 3300003215 Bacteria 32628
7 rootH2_10085598 3300003320 Unclassified 3733
8 rootL2_10028785 3300003322 Unclassified 2145
9 rootL2_10106168 3300003322 Bacteria 10378
10 rootL2_10136869 3300003322 Bacteria 2769
11 JGI25160J50197_1003867 3300003354 Bacteria 6569
12 Ga0055526_1003466 3300003771 Bacteria 10014
13 Ga0055526_1009128 3300003771 Bacteria 4826
14 Ga0055526_1010201 3300003771 Bacteria 4401
15 Ga0055537_1000076 3300003773 Bacteria 70798
16 Ga0055537_1000260 3300003773 Bacteria 38657
17 Ga0055524_1002833 3300003775 Bacteria 8693
18 Ga0055524_1006556 3300003775 Bacteria 5034
19 Ga0055534_1000124 3300003784 Bacteria 57565
20 Ga0055534_1003554 3300003784 Bacteria 4855
21 Ga0055528_1000184 3300003790 Bacteria 52910
22 Ga0055528_1002722 3300003790 Bacteria 9290
23 Ga0055528_1017889 3300003790 Bacteria 2432
24 Ga0055530_10000813 3300003791 Bacteria 25917
25 Ga0055530_10021034 3300003791 Bacteria 1933
26 Ga0065165_1000003 3300005262 Bacteria 390701
27 Ga0065165_1000053 3300005262 Bacteria 189081
28 Ga0065165_1000207 3300005262 Bacteria 101957
29 Ga0065714_10076853 3300005288 Bacteria 2747
30 Ga0065714_10079346 3300005288 Bacteria 2523
31 Ga0065704_10129106 3300005289 Bacteria 1653
32 Ga0065707_10122099 3300005295 Bacteria 2065
33 Ga0070676_10079809 3300005328 Bacteria 1982
34 Ga0070683_100042913 3300005329 Bacteria 4166
35 Ga0070683_100044280 3300005329 Bacteria 4104
36 Ga0070670_100010205 3300005331 Bacteria 8015
37 Ga0070670_100018468 3300005331 Bacteria 5983
38 Ga0070670_100023873 3300005331 Bacteria 5261
39 Ga0070670_100055993 3300005331 Bacteria 3384
40 Ga0068869_100063154 3300005334 Bacteria 2720
41 Ga0070666_10000101 3300005335 Bacteria 58900
42 Ga0070680_100110320 3300005336 Unclassified 2290
43 Ga0070682_100064521 3300005337 Bacteria 2325
44 Ga0070660_100007928 3300005339 Bacteria 7411
45 Ga0070689_100009704 3300005340 Bacteria 6829
46 Ga0070689_100028841 3300005340 Unclassified 4197
47 Ga0070669_100074814 3300005353 Bacteria 2511
48 Ga0070675_100035209 3300005354 Bacteria 4067
49 Ga0070675_100056526 3300005354 Unclassified 3234
50 Ga0070675_100140824 3300005354 Unclassified 2062
51 Ga0070675_100196692 3300005354 Bacteria 1749
52 Ga0070671_100124546 3300005355 Unclassified 2169
53 Ga0070674_100056447 3300005356 Bacteria 2723
54 Ga0070688_100069466 3300005365 Bacteria 2249
55 Ga0070659_100000542 3300005366 Bacteria 27536
56 Ga0070659_100005792 3300005366 Bacteria 8897
57 Ga0070667_100005793 3300005367 Bacteria 10312
58 Ga0070667_100031429 3300005367 Bacteria 4427
59 Ga0070678_100091498 3300005456 Bacteria 2334
60 Ga0070678_100209112 3300005456 Bacteria 1616
61 Ga0070681_10132234 3300005458 Bacteria 2427
62 Ga0070681_10349598 3300005458 Bacteria 1389
63 Ga0070685_10026104 3300005466 Unclassified 3217
64 Ga0070685_10069317 3300005466 Bacteria 2085
65 Ga0070698_100023614 3300005471 Bacteria 6426
66 Ga0070679_100133173 3300005530 Bacteria 2467
67 Ga0070684_100000646 3300005535 Bacteria 23997
68 Ga0068853_100194531 3300005539 Bacteria 1844
69 Ga0070672_100139056 3300005543 Bacteria 2001
70 Ga0068855_100002469 3300005563 Bacteria 22826
71 Ga0068855_100052092 3300005563 Unclassified 4819
72 Ga0070664_100037783 3300005564 Unclassified 4061
73 Ga0068857_100091945 3300005577 Bacteria 2716
74 Ga0068857_100169390 3300005577 Unclassified 1985
75 Ga0068857_100236158 3300005577 Bacteria 1673
76 Ga0068856_100012046 3300005614 Bacteria 8377
77 Ga0068859_100000007 3300005617 Bacteria 390070
78 Ga0068859_100061333 3300005617 Bacteria 3790
79 Ga0068859_100173451 3300005617 Bacteria 2238
80 Ga0068859_100283505 3300005617 Bacteria 1749
81 Ga0068864_100056573 3300005618 Bacteria 3389
82 Ga0068864_100078131 3300005618 Bacteria 2896
83 Ga0068861_100004034 3300005719 Bacteria 9833
84 Ga0068851_10036356 3300005834 Unclassified 2465
85 Ga0068851_10093678 3300005834 Bacteria 1585
86 Ga0068870_10094430 3300005840 Bacteria 1679
87 Ga0068863_100014664 3300005841 Bacteria 7545
88 Ga0068863_100035684 3300005841 Bacteria 4734
89 Ga0068863_100041951 3300005841 Bacteria 4349
90 Ga0068863_100156192 3300005841 Bacteria 2184
91 Ga0068858_100000829 3300005842 Bacteria 32222
92 Ga0068858_100176888 3300005842 Unclassified 2014
93 Ga0068860_100002179 3300005843 Bacteria 20606
94 Ga0068860_100058260 3300005843 Unclassified 3672
95 Ga0068862_100108257 3300005844 Bacteria 2437
96 Ga0075366_10000182 3300006195 Bacteria 27483
97 Ga0075366_10002395 3300006195 Bacteria 9623
98 Ga0097621_100017605 3300006237 Bacteria 5431
99 Ga0097621_100154255 3300006237 Bacteria 1970
100 Ga0068871_100012076 3300006358 Bacteria 6357
101 Ga0068871_100012879 3300006358 Bacteria 6193
102 Ga0075428_100091814 3300006844 Unclassified 3311
103 Ga0075431_100287993 3300006847 Bacteria 1662
104 Ga0075429_100002235 3300006880 Bacteria 16187
105 Ga0075429_100227566 3300006880 Bacteria 1633
106 Ga0097620_100000007 3300006931 Bacteria 390070
107 Ga0097620_100061332 3300006931 Bacteria 3790
108 Ga0097620_100173450 3300006931 Bacteria 2238
109 Ga0097620_100283511 3300006931 Bacteria 1749
110 Ga0105244_10001244 3300009036 Bacteria 20871
111 Ga0105240_10000273 3300009093 Bacteria 102198
112 Ga0111539_10013909 3300009094 Bacteria 10062
113 Ga0111539_10020834 3300009094 Bacteria 8074
114 Ga0111539_10021665 3300009094 Bacteria 7905
115 Ga0111539_10075668 3300009094 Unclassified 3965
116 Ga0111539_10431468 3300009094 Bacteria 1534
117 Ga0105247_10003563 3300009101 Bacteria 10115
118 Ga0105247_10013730 3300009101 Bacteria 4857
119 Ga0114129_10001095 3300009147 Bacteria 35580
120 Ga0105241_10000767 3300009174 Bacteria 24429
121 Ga0105242_10052488 3300009176 Bacteria 3327
122 Ga0105237_10027360 3300009545 Bacteria 5822
123 Ga0105237_10266648 3300009545 Bacteria 1715
124 Ga0105249_10019115 3300009553 Bacteria 6110
125 Ga0105249_10034849 3300009553 Unclassified 4563
126 Ga0105249_10035823 3300009553 Unclassified 4500
127 Ga0105249_10356852 3300009553 Bacteria 1482
128 Ga0105239_10050628 3300010375 Bacteria 4555
129 Ga0105239_10181893 3300010375 Bacteria 2352
130 Ga0105246_10033806 3300011119 Bacteria 3401
131 Ga0157373_10017412 3300013100 Bacteria 5235
132 Ga0157373_10056045 3300013100 Unclassified 2799
133 Ga0157371_10001737 3300013102 Bacteria 22072
134 Ga0157371_10021621 3300013102 Unclassified 4721
135 Ga0157371_10027275 3300013102 Bacteria 4144
136 Ga0157370_10013052 3300013104 Bacteria 8579
137 Ga0157370_10068785 3300013104 Bacteria 3346
138 Ga0157370_10076187 3300013104 Unclassified 3160
139 Ga0157370_10125905 3300013104 Bacteria 2391
140 Ga0157369_10009735 3300013105 Bacteria 10990
141 Ga0157369_10108780 3300013105 Bacteria 2948
142 Ga0157369_10222545 3300013105 Bacteria 1975
143 Ga0157374_10021485 3300013296 Bacteria 5744
144 Ga0157374_10138366 3300013296 Unclassified 2362
145 Ga0157378_10025231 3300013297 Bacteria 5236
146 Ga0163162_10001413 3300013306 Bacteria 22327
147 Ga0157372_10000016 3300013307 Bacteria 220177
148 Ga0157372_10055656 3300013307 Bacteria 4418
149 Ga0157372_10062508 3300013307 Unclassified 4172
150 Ga0157372_10220920 3300013307 Bacteria 2196
151 Ga0157375_10131168 3300013308 Bacteria 2625
152 Ga0157375_10191167 3300013308 Unclassified 2201
153 Ga0157375_10388502 3300013308 Bacteria 1562
154 Ga0163163_10001262 3300014325 Bacteria 21351
155 Ga0163163_10160808 3300014325 Bacteria 2291
156 Ga0157380_10005914 3300014326 Bacteria 8556
157 Ga0157380_10007279 3300014326 Bacteria 7853
158 Ga0157380_10059620 3300014326 Bacteria 3046
159 Ga0157377_10127610 3300014745 Bacteria 1549
160 Ga0157376_10002876 3300014969 Bacteria 11794
161 Ga0157376_10237523 3300014969 Bacteria 1696
162 Ga0182006_1000345 3300015261 Bacteria 39520
163 Ga0163161_10000616 3300017792 Bacteria 28501
164 Ga0163161_10014465 3300017792 Bacteria 5494
165 Ga0209436_101392 3300025208 Bacteria 8532
166 Ga0207425_1000110 3300025245 Bacteria 77431
167 Ga0209646_1000002 3300025246 Bacteria 1425781
168 Ga0209646_1000960 3300025246 Bacteria 9011
169 Ga0209026_1000229 3300025250 Bacteria 76521
170 Ga0209129_1012000 3300025258 Bacteria 2026
171 Ga0209565_1000018 3300025263 Bacteria 460940
172 Ga0209565_1004305 3300025263 Bacteria 4373
173 Ga0209673_1000006 3300025273 Bacteria 650600
174 Ga0209673_1000034 3300025273 Bacteria 328788
175 Ga0209130_1000036 3300025284 Bacteria 284111
176 Ga0209675_1000005 3300025291 Bacteria 849192
177 Ga0209675_1004280 3300025291 Bacteria 6421
178 Ga0209564_1000144 3300025295 Bacteria 175328
179 Ga0209564_1002599 3300025295 Bacteria 13842
180 Ga0209564_1004191 3300025295 Bacteria 8991
181 Ga0209564_1007162 3300025295 Bacteria 5815
182 Ga0209758_1000905 3300025297 Bacteria 40245
183 Ga0209758_1002114 3300025297 Bacteria 21003
184 Ga0209050_1000353 3300025298 Bacteria 88509
185 Ga0209050_1000519 3300025298 Bacteria 64306
186 Ga0209050_1013734 3300025298 Bacteria 3567
187 Ga0209256_1001475 3300025299 Bacteria 24067
188 Ga0207426_1000324 3300025302 Bacteria 91661
189 Ga0207426_1000558 3300025302 Bacteria 51284
190 Ga0207426_1015650 3300025302 Bacteria 2746
191 Ga0207426_1026657 3300025302 Bacteria 1932
192 Ga0209257_1000123 3300025304 Bacteria 219092
193 Ga0209257_1000974 3300025304 Bacteria 39098
194 Ga0209257_1004060 3300025304 Bacteria 11754
195 Ga0207656_10017925 3300025321 Unclassified 2780
196 Ga0207656_10023423 3300025321 Unclassified 2487
197 Ga0207655_1022628 3300025728 Bacteria 3143
198 Ga0207680_10000067 3300025903 Bacteria 46002
199 Ga0207645_10066064 3300025907 Bacteria 2312
200 Ga0207643_10003150 3300025908 Bacteria 8881
201 Ga0207654_10000730 3300025911 Bacteria 18282
202 Ga0207707_10082398 3300025912 Bacteria 2809
203 Ga0207695_10000130 3300025913 Bacteria 224214
204 Ga0207671_10015548 3300025914 Bacteria 5952
205 Ga0207671_10033363 3300025914 Bacteria 3830
206 Ga0207662_10123328 3300025918 Bacteria 1626
207 Ga0207657_10040845 3300025919 Bacteria 4107
208 Ga0207652_10170772 3300025921 Bacteria 1951
209 Ga0207652_10209217 3300025921 Unclassified 1756
210 Ga0207681_10064886 3300025923 Bacteria 2523
211 Ga0207650_10026245 3300025925 Bacteria 4154
212 Ga0207650_10084410 3300025925 Bacteria 2414
213 Ga0207659_10015246 3300025926 Bacteria 4974
214 Ga0207659_10232091 3300025926 Bacteria 1489
215 Ga0207690_10000668 3300025932 Bacteria 21960
216 Ga0207670_10018450 3300025936 Unclassified 4241
217 Ga0207670_10065382 3300025936 Bacteria 2495
218 Ga0207669_10021421 3300025937 Bacteria 3413
219 Ga0207691_10072929 3300025940 Bacteria 3096
220 Ga0207689_10003963 3300025942 Bacteria 13480
221 Ga0207679_10038916 3300025945 Bacteria 3393
222 Ga0207679_10062126 3300025945 Unclassified 2782
223 Ga0207667_10000131 3300025949 Bacteria 115088
224 Ga0207667_10116437 3300025949 Bacteria 2754
225 Ga0207712_10003086 3300025961 Bacteria 10629
226 Ga0207712_10006754 3300025961 Bacteria 7237
227 Ga0207712_10032897 3300025961 Unclassified 3502
228 Ga0207658_10003626 3300025986 Bacteria 10907
229 Ga0207658_10028937 3300025986 Bacteria 3906
230 Ga0207658_10133705 3300025986 Bacteria 1997
231 Ga0207658_10272664 3300025986 Bacteria 1447
232 Ga0207677_10059127 3300026023 Bacteria 2642
233 Ga0207703_10003117 3300026035 Bacteria 14003
234 Ga0207678_10119867 3300026067 Bacteria 2245
235 Ga0207641_10000090 3300026088 Bacteria 127735
236 Ga0207641_10016389 3300026088 Bacteria 6067
237 Ga0207641_10116451 3300026088 Bacteria 2378
238 Ga0207648_10102837 3300026089 Unclassified 2505
239 Ga0207676_10018135 3300026095 Bacteria 5112
240 Ga0207676_10069220 3300026095 Unclassified 2825
241 Ga0207676_10069243 3300026095 Bacteria 2825
242 Ga0207674_10010552 3300026116 Bacteria 10455
243 Ga0207674_10020192 3300026116 Bacteria 7204
244 Ga0207674_10034005 3300026116 Bacteria 5332
245 Ga0207674_10072619 3300026116 Unclassified 3456
246 Ga0207675_100028765 3300026118 Bacteria 5177
247 Ga0207675_100062070 3300026118 Bacteria 3489
248 Ga0207675_100306328 3300026118 Bacteria 1548
249 Ga0207683_10085933 3300026121 Bacteria 2796
250 Ga0207698_10060191 3300026142 Unclassified 2952
251 Ga0268264_10044515 3300028381 Unclassified 3682
252 Ga0265337_1001244 3300028556 Bacteria 12862
253 Ga0265326_10000486 3300028558 Bacteria 15324
254 Ga0265319_1001413 3300028563 Bacteria 14379
255 Ga0265319_1002391 3300028563 Bacteria 10302
256 Ga0307515_10000927 3300028794 Bacteria 67260
257 Ga0307515_10020277 3300028794 Bacteria 11872
258 Ga0265338_10000025 3300028800 Bacteria 296972
259 Ga0265338_10000282 3300028800 Bacteria 91694
260 Ga0265338_10032986 3300028800 Bacteria 5038
261 Ga0265324_10000119 3300029957 Bacteria 62736
262 Ga0316177_1086297 3300030731 Bacteria 6238
263 Ga0316176_1111498 3300030732 Bacteria 22952
264 Ga0316183_1065239 3300030742 Bacteria 28938
265 Ga0316181_1252337 3300030744 Bacteria 17298
266 Ga0265320_10007018 3300031240 Bacteria 7021
267 Ga0265339_10035271 3300031249 Bacteria 2808
268 Ga0265327_10001885 3300031251 Bacteria 24252
269 Ga0307513_10021388 3300031456 Bacteria 7638
270 Ga0307509_10015971 3300031507 Bacteria 8719
271 Ga0307408_100000328 3300031548 Bacteria 45539
272 Ga0307408_100000379 3300031548 Bacteria 40591
273 Ga0307408_100001881 3300031548 Bacteria 15279
274 Ga0307408_100064196 3300031548 Unclassified 2688
275 Ga0307508_10000341 3300031616 Bacteria 56692
276 Ga0307405_10000012 3300031731 Bacteria 233774
277 Ga0307405_10053279 3300031731 Unclassified 2519
278 Ga0307413_10000711 3300031824 Bacteria 11412
279 Ga0307406_10088561 3300031901 Bacteria 2077
280 Ga0307407_10000014 3300031903 Bacteria 156064
281 Ga0307412_10000645 3300031911 Bacteria 20247
282 Ga0307416_100000007 3300032002 Bacteria 433284
283 Ga0307414_10027362 3300032004 Bacteria 3684
284 Ga0307414_10094299 3300032004 Bacteria 2233
285 Ga0307414_10131343 3300032004 Bacteria 1944
286 Ga0307411_10000006 3300032005 Bacteria 382357
287 Ga0395899_0000414 3300037312 Bacteria 49488
288 Ga0395899_0115839 3300037312 Bacteria 1923
289 Ga0395900_0051044 3300037418 Bacteria 4260
290 Ga0395900_0243367 3300037418 Bacteria 1803
291 Ga0395898_0234639 3300037466 Bacteria 1749
292 Ga0400489_15657 3300039093 Bacteria 2403
293 Ga0439436_0013919 3300041404 Bacteria 2431
294 Ga0439447_002823 3300041407 Bacteria 6244
295 Ga0451800_1208958 3300041459 Bacteria 1403
296 Ga0451807_0526517 3300041486 Bacteria 2711
297 Ga0439449_0002361 3300042007 Bacteria 7397
298 Ga0439457_000396 3300042014 Bacteria 12362
299 Ga0450899_004254 3300042135 Unclassified 1534
300 Ga0451577_0000417 3300042876 Bacteria 77265
301 Ga0466969_0001565 3300044656 Bacteria 12259
302 Ga0466972_0000008 3300044658 Bacteria 264518
303 Ga0466972_0006217 3300044658 Bacteria 6000
304 Ga0453683_0000010 3300044673 Bacteria 470890
305 Ga0453683_0021422 3300044673 Bacteria 4127
306 Ga0466966_0000213 3300044684 Bacteria 38838
307 Ga0453684_0001245 3300044712 Bacteria 77266
308 Ga0453684_0078374 3300044712 Unclassified 4135
309 Ga0453684_0135593 3300044712 Bacteria 2948
310 Ga0466957_0004072 3300044842 Bacteria 8093
311 Ga0466957_0038439 3300044842 Bacteria 2883
312 Ga0466959_0000020 3300045049 Bacteria 133659
313 Ga0451576_0000585 3300045051 Bacteria 77207
314 Ga0451576_0032996 3300045051 Bacteria 5505
315 Ga0451576_0085643 3300045051 Bacteria 3278
316 Ga0451576_0177182 3300045051 Bacteria 2226
317 Ga0466958_0016216 3300045836 Bacteria 4286
318 Ga0495617_001854 3300046452 Bacteria 8946
319 Ga0495617_002697 3300046452 Bacteria 6886
320 Ga0495638_0000571 3300046460 Bacteria 41553
321 Ga0495638_0004487 3300046460 Bacteria 10575
322 Ga0495638_0030240 3300046460 Bacteria 3488
323 Ga0495638_0037262 3300046460 Bacteria 3094
324 Ga0495605_0000539 3300046474 Bacteria 31306
325 Ga0495664_0100937 3300046477 Bacteria 1739
326 Ga0495584_0000317 3300046491 Bacteria 33691
327 Ga0495585_0000411 3300046492 Bacteria 41565
328 Ga0495585_0003662 3300046492 Bacteria 10270
329 Ga0495585_0006134 3300046492 Bacteria 7500
330 Ga0495585_0042823 3300046492 Bacteria 2534
331 Ga0495596_0000017 3300046500 Bacteria 114761
332 Ga0495607_0003546 3300046501 Bacteria 11882
333 Ga0495607_0011694 3300046501 Bacteria 5826
334 Ga0495607_0012407 3300046501 Bacteria 5628
335 Ga0495607_0017772 3300046501 Bacteria 4553
336 Ga0495607_0029779 3300046501 Bacteria 3358
337 Ga0495583_0000008 3300046506 Bacteria 411092
338 Ga0495583_0000053 3300046506 Bacteria 210542
339 Ga0495583_0023030 3300046506 Bacteria 3160
340 Ga0495606_0000774 3300046507 Bacteria 48973
341 Ga0495606_0002023 3300046507 Bacteria 24906
342 Ga0495610_0000350 3300046512 Bacteria 48523
343 Ga0495610_0001023 3300046512 Bacteria 25724
344 Ga0495610_0004505 3300046512 Bacteria 10265
345 Ga0495610_0005409 3300046512 Bacteria 9093
346 Ga0495610_0018795 3300046512 Bacteria 3886
347 Ga0495616_0002136 3300046513 Bacteria 13237
348 Ga0495616_0004715 3300046513 Bacteria 8547
349 Ga0495616_0012674 3300046513 Bacteria 4776
350 Ga0495616_0028073 3300046513 Bacteria 2981
351 Ga0495637_0006051 3300046520 Bacteria 6109
352 Ga0495643_0000011 3300046522 Bacteria 324745
353 Ga0495643_0012267 3300046522 Bacteria 5176
354 Ga0495644_0000065 3300046523 Bacteria 51819
355 Ga0495644_0009339 3300046523 Bacteria 3781
356 Ga0495648_0000401 3300046524 Bacteria 47662
357 Ga0495609_0000180 3300046538 Bacteria 63952
358 Ga0495609_0000227 3300046538 Bacteria 54650
359 Ga0495609_0019905 3300046538 Bacteria 3103
360 Ga0495597_0000680 3300046542 Bacteria 27491
361 Ga0495633_0000047 3300046558 Bacteria 165890
362 Ga0495633_0000056 3300046558 Bacteria 149334
363 Ga0495633_0008290 3300046558 Bacteria 5875
364 Ga0495633_0033953 3300046558 Bacteria 2456
365 Ga0495668_0000021 3300046616 Bacteria 381308
366 Ga0495668_0007283 3300046616 Bacteria 7094
367 Ga0495668_0018887 3300046616 Bacteria 3982
368 Ga0495611_0000156 3300046648 Bacteria 48942
369 Ga0495611_0000216 3300046648 Bacteria 40677
370 Ga0495611_0021887 3300046648 Bacteria 2763
371 Ga0495625_0001160 3300046660 Bacteria 33970
372 Ga0495625_0002081 3300046660 Bacteria 22416
373 Ga0495625_0002464 3300046660 Bacteria 20000
374 Ga0495625_0007969 3300046660 Bacteria 9101
375 Ga0495625_0010064 3300046660 Bacteria 7859
376 Ga0495625_0012097 3300046660 Bacteria 7002
377 Ga0495625_0025823 3300046660 Bacteria 4448
378 Ga0495625_0147198 3300046660 Bacteria 1585
379 Ga0495659_0001217 3300046664 Bacteria 8907
380 Ga0495659_0008681 3300046664 Bacteria 3237
381 Ga0495659_0047092 3300046664 Bacteria 1558
382 Ga0495661_0032894 3300046665 Bacteria 3274
383 Ga0495661_0050932 3300046665 Bacteria 2503
384 Ga0495669_0000243 3300046684 Bacteria 31880
385 Ga0495670_0008784 3300046691 Bacteria 4973
386 Ga0495671_0000564 3300046692 Bacteria 27798
387 Ga0495649_0005917 3300046694 Bacteria 7669
388 Ga0495660_0011041 3300046810 Bacteria 5245
389 Ga0495636_0000101 3300047318 Bacteria 36405
390 Ga0495636_0000109 3300047318 Bacteria 34537
391 Ga0495636_0064219 3300047318 Bacteria 1557
392 Ga0495672_0000220 3300047320 Bacteria 81547
393 Ga0495672_0000274 3300047320 Bacteria 71196
394 Ga0495672_0000560 3300047320 Bacteria 42201
395 Ga0495672_0001357 3300047320 Bacteria 24270
396 Ga0495672_0004306 3300047320 Bacteria 11724
397 Ga0495683_0001054 3300047323 Bacteria 19163
398 Ga0495687_001231 3300047443 Bacteria 24486
399 Ga0495677_0000248 3300047445 Bacteria 23705
400 Ga0495677_0002074 3300047445 Bacteria 7985
401 Ga0495679_003708 3300047446 Bacteria 7270
402 Ga0495685_000167 3300047447 Bacteria 22063
403 Ga0495681_0028450 3300047470 Bacteria 2875
404 Ga0495686_0007520 3300047472 Bacteria 8158
405 Ga0496103_0002277 3300048906 Bacteria 12138
406 Ga0496123_0004540 3300048926 Bacteria 14484
407 Ga0495678_000038 3300049459 Bacteria 192188
408 Ga0495678_000274 3300049459 Bacteria 57161
409 Ga0495678_002243 3300049459 Bacteria 13471
410 Ga0495682_0000041 3300049460 Bacteria 119154
411 Ga0501300_001741 3300049523 Bacteria 3260
412 Ga0501034_0176661 3300049571 Bacteria 2101
413 Ga0501047_0271118 3300049581 Bacteria 1543
414 Ga0501070_0047941 3300049586 Bacteria 3550
415 Ga0501202_019643 3300049652 Unclassified 1336
416 Ga0501223_000073 3300049663 Bacteria 30339
417 Ga0501236_000170 3300049670 Bacteria 6723
418 Ga0501238_001566 3300049671 Unclassified 2650
419 Ga0501249_000004 3300049679 Bacteria 226777
420 Ga0501249_000428 3300049679 Bacteria 10689
421 Ga0501249_001186 3300049679 Bacteria 5477
422 Ga0501257_000375 3300049686 Bacteria 8696
423 Ga0501257_001423 3300049686 Bacteria 4951
424 Ga0501225_0000455 3300049705 Bacteria 12823
425 Ga0501225_0004100 3300049705 Bacteria 4359
426 Ga0501264_000336 3300049761 Bacteria 7328
427 Ga0501266_000008 3300049763 Bacteria 241629
428 Ga0501269_000021 3300049766 Bacteria 53792
429 Ga0501279_000241 3300049775 Bacteria 7482
430 Ga0501035_0055549 3300049822 Bacteria 3535
431 nmdc:mga0k408_2651_c1 3300050493 Bacteria 9500
432 nmdc:mga0k408_51_c3 3300050493 Bacteria 36941
433 nmdc:mga0k408_62847_c1 3300050493 Bacteria 2159
434 nmdc:mga09592_34224_c1 3300050508 Bacteria 4248
435 nmdc:mga06r32_114351_c1 3300050510 Bacteria 2657
436 nmdc:mga08y16_22340_c1 3300050511 Bacteria 6676
437 nmdc:mga08y16_263680_c1 3300050511 Unclassified 1779
438 nmdc:mga08y16_419747_c1 3300050511 Bacteria 1367
439 Ga0500578_0000065 3300053086 Bacteria 117032
440 Ga0500644_0003011 3300053088 Bacteria 4179
441 Ga0500646_0015873 3300053090 Bacteria 1963
442 Ga0500583_0000083 3300053092 Bacteria 53982
443 Ga0500583_0002029 3300053092 Bacteria 5977
444 Ga0500641_0000002 3300053096 Bacteria 291538
445 Ga0500562_000032 3300053108 Bacteria 89989
446 Ga0500618_012387 3300053125 Bacteria 2235
447 Ga0500658_0000063 3300053134 Bacteria 51146
448 Ga0500568_0001341 3300053139 Bacteria 16070
449 Ga0500588_0019289 3300053146 Bacteria 1811
450 Ga0500589_042327 3300053147 Bacteria 2124
451 Ga0500622_0001361 3300053156 Bacteria 19740
452 Ga0500622_0001604 3300053156 Bacteria 17772
453 Ga0500622_0007817 3300053156 Bacteria 6028
454 Ga0500624_008013 3300053157 Bacteria 1469
455 Ga0500611_000002 3300053727 Bacteria 345991
456 Ga0500645_008745 3300053730 Bacteria 3435

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050493 nmdc:mga0k408_62847_c1 nmdc:mga0k408_62847_c1_1028_2140 369
2 3300053090 Ga0500646_0015873 Ga0500646_0015873_21_1133 369
3 3300041404 Ga0439436_0013919 Ga0439436_0013919_30_1169 378
4 3300050511 nmdc:mga08y16_419747_c1 nmdc:mga08y16_419747_c1_186_1355 384
5 3300053157 Ga0500624_008013 Ga0500624_008013_279_1454 390
6 3300053147 Ga0500589_042327 Ga0500589_042327_881_2092 402
7 3300053146 Ga0500588_0019289 Ga0500588_0019289_573_1799 408
8 3300049679 Ga0501249_000428 Ga0501249_000428_3829_5067 410
9 3300026067 Ga0207678_10119867 Ga0207678_101198672 413
10 3300006844 Ga0075428_100091814 Ga0075428_1000918142 414
11 3300009094 Ga0111539_10013909 Ga0111539_100139092 414
12 3300050511 nmdc:mga08y16_263680_c1 nmdc:mga08y16_263680_c1_430_1734 414
13 3300005834 Ga0068851_10093678 Ga0068851_100936781 415
14 3300014326 Ga0157380_10007279 Ga0157380_100072796 418
15 3300049586 Ga0501070_0047941 Ga0501070_0047941_2278_3540 418
16 3300032004 Ga0307414_10027362 Ga0307414_100273623 420
17 3300046492 Ga0495585_0042823 Ga0495585_0042823_14_1285 421
18 3300046501 Ga0495607_0029779 Ga0495607_0029779_18_1286 421
19 3300009094 Ga0111539_10021665 Ga0111539_100216656 427
20 3300041459 Ga0451800_1208958 Ga0451800_1208958_96_1388 428
21 3300049652 Ga0501202_019643 Ga0501202_019643_26_1318 429
22 3300049670 Ga0501236_000170 Ga0501236_000170_224_1516 429
23 3300049686 Ga0501257_000375 Ga0501257_000375_4771_6063 429
24 3300049761 Ga0501264_000336 Ga0501264_000336_2755_4047 429
25 3300005339 Ga0070660_100007928 Ga0070660_10000792810 431
26 3300005366 Ga0070659_100000542 Ga0070659_10000054221 431
27 3300025919 Ga0207657_10040845 Ga0207657_100408454 431
28 3300025932 Ga0207690_10000668 Ga0207690_1000066817 431
29 3300053156 Ga0500622_0001361 Ga0500622_0001361_14643_16007 431
30 iso_pu_bacteria 2857618242 2857622901 431
31 3300037312 Ga0395899_0115839 Ga0395899_0115839_443_1834 432
32 3300037466 Ga0395898_0234639 Ga0395898_0234639_245_1636 432
33 3300045836 Ga0466958_0016216 Ga0466958_0016216_2156_3565 432
34 3300013296 Ga0157374_10138366 Ga0157374_101383662 433
35 3300046460 Ga0495638_0004487 Ga0495638_0004487_2126_3478 433
36 iso_pu_bacteria 2738543023 2739304821 433
37 3300005329 Ga0070683_100042913 Ga0070683_1000429131 434
38 3300005535 Ga0070684_100000646 Ga0070684_10000064611 434
39 3300005563 Ga0068855_100002469 Ga0068855_10000246913 434
40 3300025913 Ga0207695_10000130 Ga0207695_1000013091 434
41 3300025949 Ga0207667_10000131 Ga0207667_1000013174 434
42 3300005340 Ga0070689_100009704 Ga0070689_1000097043 435
43 3300005355 Ga0070671_100124546 Ga0070671_1001245462 435
44 3300025908 Ga0207643_10003150 Ga0207643_100031504 435
45 3300028563 Ga0265319_1001413 Ga0265319_100141312 435
46 3300031240 Ga0265320_10007018 Ga0265320_1000701810 435
47 iso_pu_bacteria 2739367651 2739586462 435
48 3300005456 Ga0070678_100209112 Ga0070678_1002091121 436
49 3300005458 Ga0070681_10132234 Ga0070681_101322342 436
50 3300005543 Ga0070672_100139056 Ga0070672_1001390562 436
51 3300005840 Ga0068870_10094430 Ga0068870_100944301 436
52 3300009094 Ga0111539_10020834 Ga0111539_100208343 436
53 3300013308 Ga0157375_10388502 Ga0157375_103885021 436
54 3300025912 Ga0207707_10082398 Ga0207707_100823982 436
55 3300025918 Ga0207662_10123328 Ga0207662_101233282 436
56 3300025986 Ga0207658_10133705 Ga0207658_101337051 436
57 3300026023 Ga0207677_10059127 Ga0207677_100591271 436
58 3300006237 Ga0097621_100017605 Ga0097621_1000176052 437
59 3300006358 Ga0068871_100012879 Ga0068871_1000128793 437
60 3300013307 Ga0157372_10055656 Ga0157372_100556561 437
61 3300028800 Ga0265338_10000282 Ga0265338_1000028283 437
62 3300029957 Ga0265324_10000119 Ga0265324_100001197 437
63 3300053139 Ga0500568_0001341 Ga0500568_0001341_6981_8351 437
64 3300005328 Ga0070676_10079809 Ga0070676_100798092 438
65 3300014326 Ga0157380_10059620 Ga0157380_100596202 438
66 3300014745 Ga0157377_10127610 Ga0157377_101276102 438
67 3300025907 Ga0207645_10066064 Ga0207645_100660642 438
68 3300025926 Ga0207659_10015246 Ga0207659_100152462 438
69 3300028558 Ga0265326_10000486 Ga0265326_100004867 438
70 3300031507 Ga0307509_10015971 Ga0307509_100159712 438
71 iso_pu_bacteria 2739367857 2740001844 438
72 iso_pu_bacteria 2739367858 2740006660 438
73 iso_pu_bacteria 8055592153 8055593014 438
74 3300005336 Ga0070680_100110320 Ga0070680_1001103202 439
75 3300005458 Ga0070681_10349598 Ga0070681_103495981 439
76 3300005577 Ga0068857_100236158 Ga0068857_1002361582 439
77 3300005614 Ga0068856_100012046 Ga0068856_1000120465 439
78 3300006195 Ga0075366_10000182 Ga0075366_100001825 439
79 3300006195 Ga0075366_10002395 Ga0075366_100023955 439
80 3300013102 Ga0157371_10021621 Ga0157371_100216212 439
81 3300013104 Ga0157370_10076187 Ga0157370_100761872 439
82 3300013105 Ga0157369_10222545 Ga0157369_102225452 439
83 3300025914 Ga0207671_10033363 Ga0207671_100333633 439
84 3300025921 Ga0207652_10209217 Ga0207652_102092172 439
85 3300025949 Ga0207667_10116437 Ga0207667_101164373 439
86 3300026116 Ga0207674_10020192 Ga0207674_100201922 439
87 3300028794 Ga0307515_10000927 Ga0307515_1000092731 439
88 3300041486 Ga0451807_0526517 Ga0451807_0526517_1141_2505 439
89 3300045051 Ga0451576_0085643 Ga0451576_0085643_1816_3192 439
90 3300046660 Ga0495625_0001160 Ga0495625_0001160_30895_32310 439
91 3300049523 Ga0501300_001741 Ga0501300_001741_690_2054 439
92 3300050493 nmdc:mga0k408_2651_c1 nmdc:mga0k408_2651_c1_5993_7378 439
93 3300050493 nmdc:mga0k408_51_c3 nmdc:mga0k408_51_c3_12898_14313 439
94 iso_pu_bacteria 2513020052 2513236083 439
95 iso_pu_bacteria 2643221667 2644373086 439
96 iso_pu_bacteria 2833640130 2833641204 439
97 iso_pu_bacteria 2842903701 2842908058 439
98 iso_pu_bacteria 2919683626 2919687261 439
99 iso_pu_bacteria 2929150217 2929154003 439
100 iso_pu_bacteria 8056440228 8056441826 439
101 3300013104 Ga0157370_10068785 Ga0157370_100687852 440
102 3300013307 Ga0157372_10062508 Ga0157372_100625083 440
103 3300028800 Ga0265338_10000025 Ga0265338_10000025105 440
104 3300031249 Ga0265339_10035271 Ga0265339_100352712 440
105 3300031824 Ga0307413_10000711 Ga0307413_100007113 440
106 3300032004 Ga0307414_10131343 Ga0307414_101313431 440
107 3300032005 Ga0307411_10000006 Ga0307411_1000000664 440
108 3300041407 Ga0439447_002823 Ga0439447_002823_2440_3768 440
109 3300049671 Ga0501238_001566 Ga0501238_001566_114_1478 440
110 3300049679 Ga0501249_001186 Ga0501249_001186_2343_3671 440
111 3300053156 Ga0500622_0001604 Ga0500622_0001604_6268_7629 440
112 iso_pu_bacteria 2977232053 2977235269 440
113 3300005288 Ga0065714_10076853 Ga0065714_100768532 441
114 3300005288 Ga0065714_10079346 Ga0065714_100793461 441
115 3300028794 Ga0307515_10020277 Ga0307515_100202773 441
116 3300030731 Ga0316177_1086297 Ga0316177_10862973 441
117 3300030732 Ga0316176_1111498 Ga0316176_11114983 441
118 3300030742 Ga0316183_1065239 Ga0316183_10652394 441
119 3300030744 Ga0316181_1252337 Ga0316181_12523376 441
120 3300046492 Ga0495585_0000411 Ga0495585_0000411_145_1545 441
121 3300046513 Ga0495616_0004715 Ga0495616_0004715_5520_6923 441
122 3300046538 Ga0495609_0019905 Ga0495609_0019905_785_2185 441
123 3300046558 Ga0495633_0000056 Ga0495633_0000056_38085_39485 441
124 3300046616 Ga0495668_0000021 Ga0495668_0000021_299630_301030 441
125 3300046660 Ga0495625_0002464 Ga0495625_0002464_15278_16678 441
126 3300046664 Ga0495659_0047092 Ga0495659_0047092_106_1455 441
127 3300047318 Ga0495636_0000101 Ga0495636_0000101_10047_11384 441
128 3300047318 Ga0495636_0064219 Ga0495636_0064219_91_1440 441
129 3300049459 Ga0495678_002243 Ga0495678_002243_9818_11221 441
130 3300049571 Ga0501034_0176661 Ga0501034_0176661_362_1693 441
131 3300049679 Ga0501249_000004 Ga0501249_000004_154968_156320 441
132 3300049763 Ga0501266_000008 Ga0501266_000008_152281_153618 441
133 3300049822 Ga0501035_0055549 Ga0501035_0055549_2045_3376 441
134 3300053096 Ga0500641_0000002 Ga0500641_0000002_107815_109167 441
135 3300053134 Ga0500658_0000063 Ga0500658_0000063_39012_40346 441
136 iso_pu_bacteria 2818991444 2819588208 441
137 3300003771 Ga0055526_1003466 Ga0055526_10034662 442
138 3300003773 Ga0055537_1000076 Ga0055537_100007621 442
139 3300003773 Ga0055537_1000260 Ga0055537_10002602 442
140 3300003775 Ga0055524_1002833 Ga0055524_10028333 442
141 3300003784 Ga0055534_1000124 Ga0055534_100012417 442
142 3300003790 Ga0055528_1000184 Ga0055528_10001842 442
143 3300005331 Ga0070670_100010205 Ga0070670_1000102052 442
144 3300005331 Ga0070670_100018468 Ga0070670_1000184682 442
145 3300005340 Ga0070689_100028841 Ga0070689_1000288413 442
146 3300005354 Ga0070675_100035209 Ga0070675_1000352093 442
147 3300005365 Ga0070688_100069466 Ga0070688_1000694662 442
148 3300005367 Ga0070667_100005793 Ga0070667_1000057932 442
149 3300005466 Ga0070685_10026104 Ga0070685_100261042 442
150 3300005617 Ga0068859_100061333 Ga0068859_1000613333 442
151 3300005618 Ga0068864_100056573 Ga0068864_1000565732 442
152 3300005841 Ga0068863_100035684 Ga0068863_1000356842 442
153 3300005843 Ga0068860_100002179 Ga0068860_10000217911 442
154 3300006358 Ga0068871_100012076 Ga0068871_1000120764 442
155 3300006931 Ga0097620_100061332 Ga0097620_1000613323 442
156 3300009553 Ga0105249_10034849 Ga0105249_100348493 442
157 3300013296 Ga0157374_10021485 Ga0157374_100214854 442
158 3300013297 Ga0157378_10025231 Ga0157378_100252313 442
159 3300013308 Ga0157375_10191167 Ga0157375_101911671 442
160 3300017792 Ga0163161_10014465 Ga0163161_100144653 442
161 3300025263 Ga0209565_1000018 Ga0209565_1000018289 442
162 3300025273 Ga0209673_1000006 Ga0209673_1000006483 442
163 3300025291 Ga0209675_1000005 Ga0209675_1000005289 442
164 3300025295 Ga0209564_1000144 Ga0209564_100014427 442
165 3300025299 Ga0209256_1001475 Ga0209256_100147510 442
166 3300025925 Ga0207650_10026245 Ga0207650_100262452 442
167 3300025936 Ga0207670_10018450 Ga0207670_100184502 442
168 3300025940 Ga0207691_10072929 Ga0207691_100729292 442
169 3300025961 Ga0207712_10006754 Ga0207712_100067542 442
170 3300025986 Ga0207658_10003626 Ga0207658_100036262 442
171 3300025986 Ga0207658_10272664 Ga0207658_102726641 442
172 3300026088 Ga0207641_10016389 Ga0207641_100163895 442
173 3300026088 Ga0207641_10116451 Ga0207641_101164512 442
174 3300026095 Ga0207676_10069243 Ga0207676_100692432 442
175 3300031251 Ga0265327_10001885 Ga0265327_1000188521 442
176 3300042876 Ga0451577_0000417 Ga0451577_0000417_23665_25002 442
177 3300044712 Ga0453684_0001245 Ga0453684_0001245_23665_25002 442
178 3300045051 Ga0451576_0000585 Ga0451576_0000585_52265_53602 442
179 3300045051 Ga0451576_0177182 Ga0451576_0177182_790_2184 442
180 3300046501 Ga0495607_0003546 Ga0495607_0003546_1909_3309 442
181 3300046523 Ga0495644_0009339 Ga0495644_0009339_1330_2724 442
182 3300046664 Ga0495659_0008681 Ga0495659_0008681_1873_3219 442
183 3300047445 Ga0495677_0000248 Ga0495677_0000248_7706_9112 442
184 3300049686 Ga0501257_001423 Ga0501257_001423_1130_2467 442
185 3300049705 Ga0501225_0004100 Ga0501225_0004100_302_1639 442
186 iso_pu_bacteria 2738541278 2738729814 442
187 iso_pu_bacteria 2842722452 2842725772 442
188 iso_pu_bacteria 2842909656 2842913024 442
189 iso_pu_bacteria 2896317667 2896319214 442
190 iso_pu_bacteria 2904424332 2904424695 442
191 iso_pu_bacteria 2911138879 2911141134 442
192 iso_pu_bacteria 2945997725 2946001310 442
193 iso_pu_bacteria 2954016120 2954018205 442
194 iso_pu_bacteria 8003151029 8003152268 442
195 3300002987 JGI25159J45721_1008811 JGI25159J45721_10088111 443
196 3300005262 Ga0065165_1000003 Ga0065165_1000003101 443
197 3300005337 Ga0070682_100064521 Ga0070682_1000645212 443
198 3300005577 Ga0068857_100091945 Ga0068857_1000919452 443
199 3300009094 Ga0111539_10075668 Ga0111539_100756682 443
200 3300025284 Ga0209130_1000036 Ga0209130_1000036229 443
201 3300025961 Ga0207712_10032897 Ga0207712_100328972 443
202 3300026089 Ga0207648_10102837 Ga0207648_101028372 443
203 3300026116 Ga0207674_10010552 Ga0207674_100105525 443
204 3300028556 Ga0265337_1001244 Ga0265337_10012443 443
205 3300028563 Ga0265319_1002391 Ga0265319_10023915 443
206 3300028800 Ga0265338_10032986 Ga0265338_100329862 443
207 3300031731 Ga0307405_10053279 Ga0307405_100532791 443
208 3300031901 Ga0307406_10088561 Ga0307406_100885613 443
209 3300046477 Ga0495664_0100937 Ga0495664_0100937_88_1485 443
210 3300046506 Ga0495583_0000008 Ga0495583_0000008_43950_45299 443
211 3300048926 Ga0496123_0004540 Ga0496123_0004540_12931_14337 443
212 3300049663 Ga0501223_000073 Ga0501223_000073_3245_4627 443
213 3300050511 nmdc:mga08y16_22340_c1 nmdc:mga08y16_22340_c1_1346_2707 443
214 iso_pu_bacteria 3003233435 3003233563 443
215 3300003322 rootL2_10028785 rootL2_100287852 444
216 3300005331 Ga0070670_100023873 Ga0070670_1000238733 444
217 3300005354 Ga0070675_100056526 Ga0070675_1000565262 444
218 3300005354 Ga0070675_100196692 Ga0070675_1001966921 444
219 3300005456 Ga0070678_100091498 Ga0070678_1000914983 444
220 3300005841 Ga0068863_100041951 Ga0068863_1000419514 444
221 3300005842 Ga0068858_100176888 Ga0068858_1001768881 444
222 3300006880 Ga0075429_100227566 Ga0075429_1002275661 444
223 3300009036 Ga0105244_10001244 Ga0105244_100012446 444
224 3300009094 Ga0111539_10431468 Ga0111539_104314681 444
225 3300013102 Ga0157371_10001737 Ga0157371_100017372 444
226 3300013104 Ga0157370_10125905 Ga0157370_101259052 444
227 3300013105 Ga0157369_10009735 Ga0157369_100097355 444
228 3300013307 Ga0157372_10000016 Ga0157372_10000016137 444
229 3300014326 Ga0157380_10005914 Ga0157380_100059143 444
230 3300015261 Ga0182006_1000345 Ga0182006_100034520 444
231 3300017792 Ga0163161_10000616 Ga0163161_1000061617 444
232 3300025246 Ga0209646_1000960 Ga0209646_10009603 444
233 3300025728 Ga0207655_1022628 Ga0207655_10226282 444
234 3300025925 Ga0207650_10084410 Ga0207650_100844102 444
235 3300025926 Ga0207659_10232091 Ga0207659_102320911 444
236 3300025936 Ga0207670_10065382 Ga0207670_100653823 444
237 3300026095 Ga0207676_10069220 Ga0207676_100692202 444
238 3300026118 Ga0207675_100062070 Ga0207675_1000620705 444
239 3300026118 Ga0207675_100306328 Ga0207675_1003063281 444
240 3300026121 Ga0207683_10085933 Ga0207683_100859333 444
241 3300031731 Ga0307405_10000012 Ga0307405_10000012166 444
242 3300031903 Ga0307407_10000014 Ga0307407_1000001480 444
243 3300032002 Ga0307416_100000007 Ga0307416_100000007140 444
244 3300037312 Ga0395899_0000414 Ga0395899_0000414_2785_4164 444
245 3300037418 Ga0395900_0051044 Ga0395900_0051044_834_2261 444
246 3300037418 Ga0395900_0243367 Ga0395900_0243367_136_1563 444
247 3300044658 Ga0466972_0000008 Ga0466972_0000008_241313_242656 444
248 3300044658 Ga0466972_0006217 Ga0466972_0006217_1038_2381 444
249 3300044673 Ga0453683_0000010 Ga0453683_0000010_366819_368198 444
250 3300044842 Ga0466957_0004072 Ga0466957_0004072_5675_7018 444
251 3300045051 Ga0451576_0032996 Ga0451576_0032996_2278_3660 444
252 3300046512 Ga0495610_0000350 Ga0495610_0000350_43883_45265 444
253 3300046512 Ga0495610_0004505 Ga0495610_0004505_6971_8332 444
254 3300046558 Ga0495633_0033953 Ga0495633_0033953_743_2104 444
255 3300048906 Ga0496103_0002277 Ga0496103_0002277_605_1966 444
256 3300049705 Ga0501225_0000455 Ga0501225_0000455_4970_6313 444
257 3300049766 Ga0501269_000021 Ga0501269_000021_37327_38688 444
258 3300050510 nmdc:mga06r32_114351_c1 nmdc:mga06r32_114351_c1_1169_2545 444
259 3300053086 Ga0500578_0000065 Ga0500578_0000065_24666_26009 444
260 3300053156 Ga0500622_0007817 Ga0500622_0007817_1894_3240 444
261 iso_pu_bacteria 2842711865 2842713478 444
262 iso_pu_bacteria 2929921140 2929922928 444
263 iso_pu_bacteria 2958512119 2958513699 444
264 3300002774 JGI25150J39212_1005445 JGI25150J39212_10054452 445
265 3300003322 rootL2_10136869 rootL2_101368692 445
266 3300003771 Ga0055526_1010201 Ga0055526_10102012 445
267 3300003775 Ga0055524_1006556 Ga0055524_10065562 445
268 3300003784 Ga0055534_1003554 Ga0055534_10035542 445
269 3300003790 Ga0055528_1017889 Ga0055528_10178892 445
270 3300003791 Ga0055530_10021034 Ga0055530_100210342 445
271 3300005289 Ga0065704_10129106 Ga0065704_101291062 445
272 3300005295 Ga0065707_10122099 Ga0065707_101220992 445
273 3300005329 Ga0070683_100044280 Ga0070683_1000442802 445
274 3300005331 Ga0070670_100055993 Ga0070670_1000559931 445
275 3300005353 Ga0070669_100074814 Ga0070669_1000748142 445
276 3300005366 Ga0070659_100005792 Ga0070659_1000057925 445
277 3300005471 Ga0070698_100023614 Ga0070698_1000236143 445
278 3300005530 Ga0070679_100133173 Ga0070679_1001331732 445
279 3300005539 Ga0068853_100194531 Ga0068853_1001945311 445
280 3300005563 Ga0068855_100052092 Ga0068855_1000520923 445
281 3300005564 Ga0070664_100037783 Ga0070664_1000377832 445
282 3300005617 Ga0068859_100173451 Ga0068859_1001734511 445
283 3300005719 Ga0068861_100004034 Ga0068861_1000040343 445
284 3300006847 Ga0075431_100287993 Ga0075431_1002879931 445
285 3300006880 Ga0075429_100002235 Ga0075429_10000223510 445
286 3300006931 Ga0097620_100173450 Ga0097620_1001734502 445
287 3300013100 Ga0157373_10056045 Ga0157373_100560452 445
288 3300013105 Ga0157369_10108780 Ga0157369_101087802 445
289 3300014325 Ga0163163_10001262 Ga0163163_100012623 445
290 3300025208 Ga0209436_101392 Ga0209436_1013924 445
291 3300025245 Ga0207425_1000110 Ga0207425_100011026 445
292 3300025258 Ga0209129_1012000 Ga0209129_10120002 445
293 3300025263 Ga0209565_1004305 Ga0209565_10043053 445
294 3300025291 Ga0209675_1004280 Ga0209675_10042805 445
295 3300025295 Ga0209564_1007162 Ga0209564_10071622 445
296 3300025298 Ga0209050_1000519 Ga0209050_100051926 445
297 3300025298 Ga0209050_1013734 Ga0209050_10137342 445
298 3300025302 Ga0207426_1026657 Ga0207426_10266572 445
299 3300025304 Ga0209257_1000123 Ga0209257_100012377 445
300 3300025304 Ga0209257_1004060 Ga0209257_10040603 445
301 3300025921 Ga0207652_10170772 Ga0207652_101707722 445
302 3300025923 Ga0207681_10064886 Ga0207681_100648862 445
303 3300025945 Ga0207679_10038916 Ga0207679_100389161 445
304 3300025945 Ga0207679_10062126 Ga0207679_100621263 445
305 3300026116 Ga0207674_10072619 Ga0207674_100726193 445
306 3300026118 Ga0207675_100028765 Ga0207675_1000287652 445
307 3300031456 Ga0307513_10021388 Ga0307513_100213882 445
308 3300031548 Ga0307408_100001881 Ga0307408_1000018819 445
309 3300039093 Ga0400489_15657 Ga0400489_15657_250_1644 445
310 3300042007 Ga0439449_0002361 Ga0439449_0002361_2954_4300 445
311 3300044712 Ga0453684_0078374 Ga0453684_0078374_2551_3894 445
312 3300046452 Ga0495617_002697 Ga0495617_002697_1600_2952 445
313 3300046460 Ga0495638_0037262 Ga0495638_0037262_1395_2750 445
314 3300046506 Ga0495583_0023030 Ga0495583_0023030_743_2098 445
315 3300046507 Ga0495606_0000774 Ga0495606_0000774_7951_9303 445
316 3300046507 Ga0495606_0002023 Ga0495606_0002023_5901_7259 445
317 3300046512 Ga0495610_0018795 Ga0495610_0018795_272_1630 445
318 3300046513 Ga0495616_0012674 Ga0495616_0012674_637_1992 445
319 3300046520 Ga0495637_0006051 Ga0495637_0006051_2561_3913 445
320 3300046538 Ga0495609_0000227 Ga0495609_0000227_18885_20240 445
321 3300046558 Ga0495633_0000047 Ga0495633_0000047_53395_54747 445
322 3300046616 Ga0495668_0018887 Ga0495668_0018887_2004_3359 445
323 3300046660 Ga0495625_0010064 Ga0495625_0010064_6034_7389 445
324 3300046660 Ga0495625_0147198 Ga0495625_0147198_107_1483 445
325 3300046665 Ga0495661_0050932 Ga0495661_0050932_661_2016 445
326 3300046684 Ga0495669_0000243 Ga0495669_0000243_11717_13072 445
327 3300046810 Ga0495660_0011041 Ga0495660_0011041_2268_3623 445
328 3300047446 Ga0495679_003708 Ga0495679_003708_4705_6060 445
329 3300047470 Ga0495681_0028450 Ga0495681_0028450_683_2038 445
330 3300049581 Ga0501047_0271118 Ga0501047_0271118_27_1373 445
331 3300049775 Ga0501279_000241 Ga0501279_000241_4366_5721 445
332 3300050508 nmdc:mga09592_34224_c1 nmdc:mga09592_34224_c1_1974_3338 445
333 3300053092 Ga0500583_0002029 Ga0500583_0002029_988_2334 445
334 3300053125 Ga0500618_012387 Ga0500618_012387_727_2085 445
335 iso_pu_bacteria 2857564685 2857568646 445
336 3300005262 Ga0065165_1000207 Ga0065165_100020749 446
337 3300005354 Ga0070675_100140824 Ga0070675_1001408242 446
338 3300005356 Ga0070674_100056447 Ga0070674_1000564472 446
339 3300005577 Ga0068857_100169390 Ga0068857_1001693902 446
340 3300005617 Ga0068859_100283505 Ga0068859_1002835052 446
341 3300005841 Ga0068863_100014664 Ga0068863_1000146645 446
342 3300005844 Ga0068862_100108257 Ga0068862_1001082572 446
343 3300006931 Ga0097620_100283511 Ga0097620_1002835112 446
344 3300009093 Ga0105240_10000273 Ga0105240_1000027390 446
345 3300009101 Ga0105247_10013730 Ga0105247_100137303 446
346 3300009147 Ga0114129_10001095 Ga0114129_1000109520 446
347 3300009545 Ga0105237_10027360 Ga0105237_100273604 446
348 3300009553 Ga0105249_10035823 Ga0105249_100358232 446
349 3300009553 Ga0105249_10356852 Ga0105249_103568521 446
350 3300010375 Ga0105239_10050628 Ga0105239_100506282 446
351 3300010375 Ga0105239_10181893 Ga0105239_101818932 446
352 3300013100 Ga0157373_10017412 Ga0157373_100174123 446
353 3300013102 Ga0157371_10027275 Ga0157371_100272753 446
354 3300013104 Ga0157370_10013052 Ga0157370_100130528 446
355 3300025321 Ga0207656_10017925 Ga0207656_100179252 446
356 3300025937 Ga0207669_10021421 Ga0207669_100214212 446
357 3300026116 Ga0207674_10034005 Ga0207674_100340052 446
358 3300026142 Ga0207698_10060191 Ga0207698_100601912 446
359 3300031616 Ga0307508_10000341 Ga0307508_1000034131 446
360 3300042014 Ga0439457_000396 Ga0439457_000396_1496_2845 446
361 3300044656 Ga0466969_0001565 Ga0466969_0001565_7123_8472 446
362 3300044673 Ga0453683_0021422 Ga0453683_0021422_1206_2570 446
363 3300044684 Ga0466966_0000213 Ga0466966_0000213_29873_31222 446
364 3300044712 Ga0453684_0135593 Ga0453684_0135593_437_1801 446
365 3300045049 Ga0466959_0000020 Ga0466959_0000020_108961_110310 446
366 3300046460 Ga0495638_0030240 Ga0495638_0030240_1557_2921 446
367 3300046512 Ga0495610_0001023 Ga0495610_0001023_13664_15028 446
368 3300046512 Ga0495610_0005409 Ga0495610_0005409_2402_3766 446
369 3300046522 Ga0495643_0000011 Ga0495643_0000011_270076_271440 446
370 3300046542 Ga0495597_0000680 Ga0495597_0000680_15210_16574 446
371 3300046660 Ga0495625_0002081 Ga0495625_0002081_14284_15648 446
372 3300046660 Ga0495625_0012097 Ga0495625_0012097_4767_6125 446
373 3300046694 Ga0495649_0005917 Ga0495649_0005917_3113_4471 446
374 3300047320 Ga0495672_0000274 Ga0495672_0000274_16756_18120 446
375 3300047472 Ga0495686_0007520 Ga0495686_0007520_1970_3322 446
376 3300049459 Ga0495678_000038 Ga0495678_000038_137644_139008 446
377 3300053088 Ga0500644_0003011 Ga0500644_0003011_759_2123 446
378 3300053092 Ga0500583_0000083 Ga0500583_0000083_6078_7430 446
379 3300053108 Ga0500562_000032 Ga0500562_000032_88410_89774 446
380 3300053730 Ga0500645_008745 Ga0500645_008745_1592_2956 446
381 3300001989 JGI24739J22299_10000110 JGI24739J22299_100001104 447
382 3300003320 rootH2_10085598 rootH2_100855984 447
383 3300003322 rootL2_10106168 rootL2_1010616811 447
384 3300003771 Ga0055526_1009128 Ga0055526_10091282 447
385 3300003790 Ga0055528_1002722 Ga0055528_10027224 447
386 3300003791 Ga0055530_10000813 Ga0055530_100008137 447
387 3300005262 Ga0065165_1000053 Ga0065165_100005311 447
388 3300005334 Ga0068869_100063154 Ga0068869_1000631542 447
389 3300005335 Ga0070666_10000101 Ga0070666_100001015 447
390 3300005367 Ga0070667_100031429 Ga0070667_1000314293 447
391 3300005466 Ga0070685_10069317 Ga0070685_100693172 447
392 3300005617 Ga0068859_100000007 Ga0068859_100000007161 447
393 3300005618 Ga0068864_100078131 Ga0068864_1000781314 447
394 3300005834 Ga0068851_10036356 Ga0068851_100363563 447
395 3300005841 Ga0068863_100156192 Ga0068863_1001561923 447
396 3300005842 Ga0068858_100000829 Ga0068858_1000008293 447
397 3300005843 Ga0068860_100058260 Ga0068860_1000582602 447
398 3300006237 Ga0097621_100154255 Ga0097621_1001542553 447
399 3300006931 Ga0097620_100000007 Ga0097620_100000007162 447
400 3300009101 Ga0105247_10003563 Ga0105247_100035634 447
401 3300009174 Ga0105241_10000767 Ga0105241_1000076721 447
402 3300009176 Ga0105242_10052488 Ga0105242_100524883 447
403 3300009545 Ga0105237_10266648 Ga0105237_102666481 447
404 3300009553 Ga0105249_10019115 Ga0105249_100191153 447
405 3300011119 Ga0105246_10033806 Ga0105246_100338062 447
406 3300013306 Ga0163162_10001413 Ga0163162_1000141310 447
407 3300013307 Ga0157372_10220920 Ga0157372_102209202 447
408 3300013308 Ga0157375_10131168 Ga0157375_101311682 447
409 3300014325 Ga0163163_10160808 Ga0163163_101608082 447
410 3300014969 Ga0157376_10002876 Ga0157376_100028762 447
411 3300014969 Ga0157376_10237523 Ga0157376_102375232 447
412 3300025273 Ga0209673_1000034 Ga0209673_1000034186 447
413 3300025295 Ga0209564_1002599 Ga0209564_100259910 447
414 3300025295 Ga0209564_1004191 Ga0209564_10041916 447
415 3300025297 Ga0209758_1000905 Ga0209758_10009056 447
416 3300025297 Ga0209758_1002114 Ga0209758_100211417 447
417 3300025298 Ga0209050_1000353 Ga0209050_100035314 447
418 3300025302 Ga0207426_1000558 Ga0207426_100055823 447
419 3300025302 Ga0207426_1015650 Ga0207426_10156502 447
420 3300025304 Ga0209257_1000974 Ga0209257_100097424 447
421 3300025321 Ga0207656_10023423 Ga0207656_100234232 447
422 3300025903 Ga0207680_10000067 Ga0207680_1000006723 447
423 3300025911 Ga0207654_10000730 Ga0207654_100007308 447
424 3300025914 Ga0207671_10015548 Ga0207671_100155482 447
425 3300025942 Ga0207689_10003963 Ga0207689_1000396311 447
426 3300025961 Ga0207712_10003086 Ga0207712_100030867 447
427 3300025986 Ga0207658_10028937 Ga0207658_100289373 447
428 3300026035 Ga0207703_10003117 Ga0207703_1000311710 447
429 3300026088 Ga0207641_10000090 Ga0207641_100000903 447
430 3300026095 Ga0207676_10018135 Ga0207676_100181352 447
431 3300028381 Ga0268264_10044515 Ga0268264_100445153 447
432 3300031548 Ga0307408_100000328 Ga0307408_10000032817 447
433 3300031548 Ga0307408_100000379 Ga0307408_10000037928 447
434 3300031548 Ga0307408_100064196 Ga0307408_1000641961 447
435 3300031911 Ga0307412_10000645 Ga0307412_100006455 447
436 3300032004 Ga0307414_10094299 Ga0307414_100942992 447
437 3300042135 Ga0450899_004254 Ga0450899_004254_73_1449 447
438 3300044842 Ga0466957_0038439 Ga0466957_0038439_393_1748 447
439 3300046452 Ga0495617_001854 Ga0495617_001854_332_1714 447
440 3300046460 Ga0495638_0000571 Ga0495638_0000571_30167_31549 447
441 3300046474 Ga0495605_0000539 Ga0495605_0000539_4358_5740 447
442 3300046491 Ga0495584_0000317 Ga0495584_0000317_26871_28253 447
443 3300046492 Ga0495585_0003662 Ga0495585_0003662_4531_5913 447
444 3300046492 Ga0495585_0006134 Ga0495585_0006134_6060_7442 447
445 3300046500 Ga0495596_0000017 Ga0495596_0000017_14338_15783 447
446 3300046501 Ga0495607_0011694 Ga0495607_0011694_3058_4440 447
447 3300046501 Ga0495607_0012407 Ga0495607_0012407_1259_2641 447
448 3300046501 Ga0495607_0017772 Ga0495607_0017772_886_2268 447
449 3300046506 Ga0495583_0000053 Ga0495583_0000053_48554_49936 447
450 3300046513 Ga0495616_0002136 Ga0495616_0002136_941_2323 447
451 3300046513 Ga0495616_0028073 Ga0495616_0028073_358_1740 447
452 3300046522 Ga0495643_0012267 Ga0495643_0012267_2239_3594 447
453 3300046523 Ga0495644_0000065 Ga0495644_0000065_2080_3462 447
454 3300046524 Ga0495648_0000401 Ga0495648_0000401_26754_28136 447
455 3300046538 Ga0495609_0000180 Ga0495609_0000180_40081_41463 447
456 3300046558 Ga0495633_0008290 Ga0495633_0008290_3678_5060 447
457 3300046616 Ga0495668_0007283 Ga0495668_0007283_1708_3063 447
458 3300046648 Ga0495611_0000156 Ga0495611_0000156_2091_3473 447
459 3300046648 Ga0495611_0000216 Ga0495611_0000216_6820_8202 447
460 3300046648 Ga0495611_0021887 Ga0495611_0021887_248_1630 447
461 3300046660 Ga0495625_0007969 Ga0495625_0007969_2488_3870 447
462 3300046660 Ga0495625_0025823 Ga0495625_0025823_1361_2743 447
463 3300046664 Ga0495659_0001217 Ga0495659_0001217_5121_6503 447
464 3300046665 Ga0495661_0032894 Ga0495661_0032894_733_2115 447
465 3300046691 Ga0495670_0008784 Ga0495670_0008784_1159_2541 447
466 3300046692 Ga0495671_0000564 Ga0495671_0000564_6496_7878 447
467 3300047318 Ga0495636_0000109 Ga0495636_0000109_3489_4871 447
468 3300047320 Ga0495672_0000220 Ga0495672_0000220_34128_35528 447
469 3300047320 Ga0495672_0000560 Ga0495672_0000560_15214_16596 447
470 3300047320 Ga0495672_0001357 Ga0495672_0001357_14605_15987 447
471 3300047320 Ga0495672_0004306 Ga0495672_0004306_5891_7246 447
472 3300047323 Ga0495683_0001054 Ga0495683_0001054_14421_15803 447
473 3300047443 Ga0495687_001231 Ga0495687_001231_14442_15824 447
474 3300047445 Ga0495677_0002074 Ga0495677_0002074_1564_2946 447
475 3300047447 Ga0495685_000167 Ga0495685_000167_6733_8115 447
476 3300049459 Ga0495678_000274 Ga0495678_000274_8756_10138 447
477 3300049460 Ga0495682_0000041 Ga0495682_0000041_80556_81938 447
478 3300001979 JGI24740J21852_10002008 JGI24740J21852_100020085 448
479 3300002738 JGI25154J39366_1000001 JGI25154J39366_1000001212 448
480 3300003215 JGI25153J46596_10000345 JGI25153J46596_1000034521 448
481 3300003354 JGI25160J50197_1003867 JGI25160J50197_10038672 448
482 3300025246 Ga0209646_1000002 Ga0209646_1000002212 448
483 3300025250 Ga0209026_1000229 Ga0209026_100022933 448
484 3300025302 Ga0207426_1000324 Ga0207426_100032461 448
485 3300053727 Ga0500611_000002 Ga0500611_000002_273507_274856 448

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07470

Glyco_hydro_88

Glycosyl Hydrolase Family 88

137

496

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k11-assembly1.cif.gz_A crystal structure of putative glycosyl hydrolase (np_813087.1) from bacteroides thetaiotaomicron vpi-5482 at 1.80 a resolution 0.9787 25 448
3k11-assembly1.cif.gz_A crystal structure of putative glycosyl hydrolase (np_813087.1) from bacteroides thetaiotaomicron vpi-5482 at 1.80 a resolution 0.9435 25 448
4wu0-assembly2.cif.gz_B structural analysis of c. acetobutylicum atcc 824 glycoside hydrolase from family 105 0.8392 99 427
3pmm-assembly1.cif.gz_A the crystal structure of a possible member of gh105 family from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8331 42 434
4xuv-assembly1.cif.gz_B crystal structure of a glycoside hydrolase family 105 (gh105) enzyme from thielavia terrestris 0.8297 46 429
ID Description Score Start End Superfamily
3k11A00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.9728 25 448 1.50.10.10
3k11A00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.9415 25 448 1.50.10.10
2gh4A00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.8203 48 432 1.50.10.10
4xuvA00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.8176 46 429 1.50.10.10
3pmmA00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.8146 42 434 1.50.10.10
ID Description Score Start End GO Terms
AF-A0A3C1TD52-F1-model_v4 Family 88 glycosyl hydrolase 0.9924 201 448 GO:0005975
GO:0016787
AF-A0A520JIJ7-F1-model_v4 Glycoside hydrolase family 88 protein 0.992 314 431 GO:0005975
AF-A0A3C1TD52-F1-model_v4 Family 88 glycosyl hydrolase 0.9845 201 448 GO:0005975
GO:0016787
AF-A0A069D0Y3-F1-model_v4 Rhamnogalacturonides degradation protein RhiN 0.9844 30 448 GO:0005975
AF-A0A519V5D7-F1-model_v4 Glycoside hydrolase family 88 protein 0.9837 67 447 GO:0005975
GO:0016787

Feature Viewer

pLDDT pTM Quality
92.18 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map