F453043

General Info

Members Datasets Scaffolds Average Seq Length
485 251 451 284

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10164954|Ga0065712_101649542
Length 307
Sequence MIRLYGLVYFIQQLAFSAKTIYTMKDQKPRKLDIVVISDVHLGTYGCHAKELLCYLKSIRPKTLILNGDFVDIWQFSKRYWPKSHMKVVKQITKMISKGIKVYYVTGNHDEMLRKFEGFKLGSFQIVNKLLLELDNGEKAWIFHGDVFDVTMKHSRWLAKLGAVGYDLLILLNSFVNYTSERILKKGKISLSKKIKNSVKKAVSFIDDFEQTAADIGIYNNYSYVICGHIHHPQMKMIENSEGRIVYLNSGDWIENLTALEYSKGNWNIYQYQEKEFAHADLNDDDELSTTELFDNMVKEFDLLKAV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2738543023 Pedobacter sp. OK628 Isolate Unclassified
8 2739367651 Pedobacter sp. OK291 Isolate Unclassified
9 2739367656 Pedobacter sp. CF523 Isolate Unclassified
10 2739367663 Pedobacter sp. YR510 Isolate Unclassified
11 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
12 2818991437 Pedobacter terrae 518 Isolate Unclassified
13 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
14 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
15 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
16 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
17 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
18 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
19 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
20 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
21 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
22 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
23 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
24 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
25 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
26 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
27 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
28 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
29 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
30 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
31 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
32 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
33 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
34 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
35 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
36 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
37 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
38 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
39 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
40 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
41 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
42 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
43 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
44 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
45 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
46 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
47 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
48 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
49 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
53 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
54 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
59 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
111 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
112 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
113 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
114 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
115 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
150 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
151 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
152 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
153 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
176 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
179 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
192 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
193 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
194 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
195 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
209 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
210 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
211 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
222 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
225 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
226 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
227 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
228 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
229 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
230 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
231 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
241 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
242 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
243 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
244 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
245 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
246 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
247 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
248 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
249 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
250 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
251 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.58
Metatranscriptomes 0.41
Isolates 7.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.9
Nodule 0
Rhizoplane 0.82
Rhizosphere 77.11
Stem 0
Stem Tuber 0
Unclassified 12.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1762462 2162886007 Bacteria 256265
2 JGI24735J21928_10000015 3300002067 Bacteria 167231
3 JGI25162J39368_1000016 3300002737 Bacteria 288734
4 JGI25162J39368_1000866 3300002737 Bacteria 19829
5 JGI25152J39213_1000300 3300002773 Bacteria 31900
6 JGI25150J39212_1000023 3300002774 Bacteria 130663
7 JGI25151J46595_10000082 3300003187 Bacteria 130832
8 JGI25165J46597_1001134 3300003214 Bacteria 16713
9 JGI25153J46596_10000060 3300003215 Bacteria 131744
10 rootH1_10000428 3300003316 Bacteria 39625
11 rootH1_10013947 3300003316 Bacteria 8478
12 rootH1_10034433 3300003316 Bacteria 16075
13 rootH1_10123889 3300003316 Bacteria 3234
14 rootH2_10009276 3300003320 Bacteria 41219
15 rootH2_10047461 3300003320 Bacteria 5913
16 rootH2_10105521 3300003320 Bacteria 2204
17 rootH2_10198930 3300003320 Bacteria 1991
18 rootL2_10006331 3300003322 Bacteria 36194
19 rootL2_10102636 3300003322 Bacteria 10012
20 rootL2_10125346 3300003322 Bacteria 1465
21 rootL2_10194838 3300003322 Unclassified 2943
22 rootL2_10199322 3300003322 Bacteria 2840
23 rootH1_10003399 3300003323 Bacteria 54122
24 rootH1_10005185 3300003323 Bacteria 15491
25 rootH1_10010280 3300003323 Bacteria 25170
26 rootH1_10016834 3300003323 Bacteria 4138
27 rootH1_10016835 3300003323 Bacteria 2241
28 rootH1_10026116 3300003323 Bacteria 22314
29 rootH1_10055014 3300003323 Bacteria 1762
30 rootH1_10061130 3300003323 Bacteria 27123
31 rootH1_10065583 3300003323 Bacteria 19600
32 rootH1_10079729 3300003323 Bacteria 6006
33 rootH1_10100344 3300003323 Unclassified 3356
34 rootH1_10174448 3300003323 Unclassified 4422
35 Ga0055536_1000002 3300003781 Bacteria 605605
36 Ga0055530_10001421 3300003791 Bacteria 17576
37 Ga0055531_10000287 3300003794 Bacteria 50954
38 Ga0058862_12302803 3300004803 Bacteria 1754
39 Ga0065165_1001313 3300005262 Bacteria 27754
40 Ga0065714_10002204 3300005288 Bacteria 57902
41 Ga0065714_10002553 3300005288 Bacteria 19114
42 Ga0065714_10007689 3300005288 Bacteria 3481
43 Ga0065714_10007833 3300005288 Bacteria 4607
44 Ga0065714_10015308 3300005288 Bacteria 4329
45 Ga0065714_10131349 3300005288 Bacteria 1247
46 Ga0065714_10150540 3300005288 Bacteria 1109
47 Ga0065704_10000188 3300005289 Bacteria 267216
48 Ga0065704_10001732 3300005289 Bacteria 6723
49 Ga0065704_10006409 3300005289 Bacteria 4105
50 Ga0065704_10072149 3300005289 Bacteria 9061
51 Ga0065712_10164954 3300005290 Bacteria 1278
52 Ga0070658_10006144 3300005327 Bacteria 9741
53 Ga0070683_100319255 3300005329 Bacteria 1478
54 Ga0070690_100096244 3300005330 Bacteria 1956
55 Ga0070670_100009693 3300005331 Bacteria 8222
56 Ga0070670_100504946 3300005331 Bacteria 1076
57 Ga0070680_100065076 3300005336 Bacteria 2988
58 Ga0070682_100006134 3300005337 Bacteria 6732
59 Ga0070660_100182562 3300005339 Bacteria 1698
60 Ga0070661_100313666 3300005344 Bacteria 1223
61 Ga0070668_100523284 3300005347 Bacteria 1029
62 Ga0070659_100090664 3300005366 Bacteria 2450
63 Ga0070663_100085742 3300005455 Bacteria 2324
64 Ga0070681_10048767 3300005458 Bacteria 4230
65 Ga0070681_10113532 3300005458 Bacteria 2648
66 Ga0070679_100457246 3300005530 Bacteria 1221
67 Ga0070684_100165640 3300005535 Bacteria 2006
68 Ga0068853_100051494 3300005539 Bacteria 3544
69 Ga0068853_100090283 3300005539 Bacteria 2692
70 Ga0070665_100000061 3300005548 Bacteria 222138
71 Ga0070665_100001020 3300005548 Bacteria 35168
72 Ga0070665_100256672 3300005548 Bacteria 1749
73 Ga0070665_100763166 3300005548 Bacteria 980
74 Ga0068855_100000074 3300005563 Bacteria 119759
75 Ga0068855_100017943 3300005563 Bacteria 8503
76 Ga0068855_100303912 3300005563 Bacteria 1766
77 Ga0068855_100316861 3300005563 Bacteria 1725
78 Ga0068855_100331748 3300005563 Bacteria 1679
79 Ga0068857_100087534 3300005577 Bacteria 2786
80 Ga0068854_100042783 3300005578 Bacteria 3208
81 Ga0068854_100071901 3300005578 Bacteria 2532
82 Ga0068856_100033530 3300005614 Bacteria 5028
83 Ga0068856_100046164 3300005614 Bacteria 4291
84 Ga0068856_100047619 3300005614 Bacteria 4224
85 Ga0068856_100049718 3300005614 Bacteria 4132
86 Ga0068852_100340122 3300005616 Bacteria 1462
87 Ga0068852_100393268 3300005616 Bacteria 1362
88 Ga0068859_100000272 3300005617 Bacteria 51348
89 Ga0068859_100190473 3300005617 Bacteria 2135
90 Ga0068858_100453248 3300005842 Bacteria 1236
91 Ga0068862_100207461 3300005844 Bacteria 1769
92 Ga0075366_10000170 3300006195 Bacteria 27881
93 Ga0075366_10005159 3300006195 Bacteria 7067
94 Ga0075429_100015472 3300006880 Bacteria 6610
95 Ga0097620_100000272 3300006931 Bacteria 51348
96 Ga0097620_100093992 3300006931 Bacteria 3050
97 Ga0097620_100190471 3300006931 Bacteria 2135
98 Ga0105244_10097085 3300009036 Bacteria 1444
99 Ga0105240_10000066 3300009093 Bacteria 212612
100 Ga0105240_10000082 3300009093 Bacteria 195184
101 Ga0105240_10001333 3300009093 Bacteria 42441
102 Ga0105240_10014355 3300009093 Bacteria 10816
103 Ga0105240_10056121 3300009093 Bacteria 4929
104 Ga0105240_10188862 3300009093 Bacteria 2424
105 Ga0105240_10240960 3300009093 Bacteria 2096
106 Ga0105240_10623136 3300009093 Bacteria 1185
107 Ga0105240_10760491 3300009093 Unclassified 1053
108 Ga0111539_10137145 3300009094 Bacteria 2865
109 Ga0111539_10275785 3300009094 Bacteria 1957
110 Ga0114129_10018647 3300009147 Bacteria 9879
111 Ga0105243_10000004 3300009148 Bacteria 601266
112 Ga0105243_10031449 3300009148 Bacteria 4092
113 Ga0105241_10009078 3300009174 Bacteria 7315
114 Ga0105241_10021457 3300009174 Bacteria 4773
115 Ga0105241_10035417 3300009174 Bacteria 3754
116 Ga0105241_10056412 3300009174 Bacteria 3011
117 Ga0105241_10324125 3300009174 Bacteria 1329
118 Ga0105242_10541681 3300009176 Bacteria 1114
119 Ga0105237_10000310 3300009545 Bacteria 67887
120 Ga0105237_10007457 3300009545 Bacteria 11970
121 Ga0105237_10009371 3300009545 Bacteria 10489
122 Ga0105237_10052440 3300009545 Bacteria 4094
123 Ga0105237_10078416 3300009545 Bacteria 3293
124 Ga0105237_10168228 3300009545 Bacteria 2191
125 Ga0105237_10172748 3300009545 Bacteria 2161
126 Ga0105238_10045351 3300009551 Bacteria 4441
127 Ga0105238_10325296 3300009551 Bacteria 1524
128 Ga0105238_10668365 3300009551 Bacteria 1050
129 Ga0105249_10183886 3300009553 Bacteria 2035
130 Ga0105249_10589779 3300009553 Bacteria 1165
131 Ga0105239_10000009 3300010375 Bacteria 361182
132 Ga0105239_10000049 3300010375 Bacteria 177578
133 Ga0105239_10001076 3300010375 Bacteria 37960
134 Ga0105239_10003303 3300010375 Bacteria 19863
135 Ga0105239_10008608 3300010375 Bacteria 11568
136 Ga0105239_10008871 3300010375 Bacteria 11379
137 Ga0105239_10009059 3300010375 Bacteria 11263
138 Ga0105239_10024974 3300010375 Bacteria 6582
139 Ga0105239_10025805 3300010375 Bacteria 6471
140 Ga0105239_10141793 3300010375 Unclassified 2678
141 Ga0105239_10403540 3300010375 Bacteria 1547
142 Ga0157373_10000089 3300013100 Bacteria 78449
143 Ga0157373_10005376 3300013100 Bacteria 9618
144 Ga0157373_10014003 3300013100 Bacteria 5880
145 Ga0157373_10020052 3300013100 Bacteria 4864
146 Ga0157373_10037473 3300013100 Bacteria 3475
147 Ga0157373_10339836 3300013100 Bacteria 1070
148 Ga0157371_10000025 3300013102 Bacteria 279746
149 Ga0157371_10000511 3300013102 Bacteria 46681
150 Ga0157371_10007554 3300013102 Bacteria 8783
151 Ga0157371_10009528 3300013102 Bacteria 7636
152 Ga0157371_10013702 3300013102 Bacteria 6149
153 Ga0157371_10033409 3300013102 Bacteria 3696
154 Ga0157371_10067622 3300013102 Bacteria 2529
155 Ga0157370_10002659 3300013104 Bacteria 21448
156 Ga0157370_10014967 3300013104 Bacteria 7909
157 Ga0157370_10040234 3300013104 Bacteria 4513
158 Ga0157370_10049504 3300013104 Bacteria 4021
159 Ga0157370_10072875 3300013104 Bacteria 3240
160 Ga0157370_10080886 3300013104 Bacteria 3058
161 Ga0157370_10126398 3300013104 Bacteria 2386
162 Ga0157370_10156635 3300013104 Bacteria 2119
163 Ga0157370_10290874 3300013104 Bacteria 1509
164 Ga0157370_10467965 3300013104 Bacteria 1158
165 Ga0157369_10000038 3300013105 Bacteria 189078
166 Ga0157369_10004248 3300013105 Bacteria 16965
167 Ga0157369_10044949 3300013105 Bacteria 4805
168 Ga0157369_10101380 3300013105 Bacteria 3068
169 Ga0157369_10377807 3300013105 Bacteria 1471
170 Ga0157378_10006650 3300013297 Bacteria 10102
171 Ga0157378_10028505 3300013297 Bacteria 4928
172 Ga0157378_10042477 3300013297 Bacteria 4036
173 Ga0163162_10000012 3300013306 Bacteria 292674
174 Ga0163162_10000123 3300013306 Bacteria 68905
175 Ga0163162_10010257 3300013306 Bacteria 9103
176 Ga0157372_10000039 3300013307 Bacteria 165839
177 Ga0157372_10000241 3300013307 Bacteria 60488
178 Ga0157372_10001390 3300013307 Bacteria 26087
179 Ga0157372_10024320 3300013307 Bacteria 6578
180 Ga0157372_10035628 3300013307 Bacteria 5479
181 Ga0157372_10047927 3300013307 Bacteria 4749
182 Ga0157372_10069376 3300013307 Bacteria 3964
183 Ga0157372_10075801 3300013307 Bacteria 3796
184 Ga0157372_10166305 3300013307 Bacteria 2551
185 Ga0157372_10172189 3300013307 Bacteria 2505
186 Ga0157372_10389845 3300013307 Bacteria 1623
187 Ga0157372_10443063 3300013307 Bacteria 1514
188 Ga0157375_10012196 3300013308 Bacteria 7617
189 Ga0157375_10014406 3300013308 Bacteria 7053
190 Ga0157375_10124046 3300013308 Bacteria 2696
191 Ga0163163_10044177 3300014325 Bacteria 4370
192 Ga0157380_10066264 3300014326 Bacteria 2904
193 Ga0182008_10000020 3300014497 Bacteria 228333
194 Ga0182008_10000052 3300014497 Bacteria 103193
195 Ga0182008_10000170 3300014497 Bacteria 50871
196 Ga0182008_10073976 3300014497 Bacteria 1676
197 Ga0182006_1000270 3300015261 Bacteria 46578
198 Ga0182006_1000276 3300015261 Bacteria 45977
199 Ga0182006_1001187 3300015261 Bacteria 16320
200 Ga0182006_1002937 3300015261 Bacteria 9019
201 Ga0182007_10000024 3300015262 Bacteria 181761
202 Ga0182007_10044537 3300015262 Bacteria 1472
203 Ga0183373_1002 3300015682 Bacteria 990153
204 Ga0163161_10000093 3300017792 Bacteria 90618
205 Ga0163161_10000094 3300017792 Bacteria 90423
206 Ga0163161_10001375 3300017792 Bacteria 18039
207 Ga0163161_10010803 3300017792 Bacteria 6327
208 Ga0163161_10032876 3300017792 Bacteria 3705
209 Ga0163161_10099575 3300017792 Bacteria 2162
210 Ga0206351_10116577 3300020077 Bacteria 1438
211 Ga0213872_10152853 3300021361 Bacteria 1007
212 Ga0207427_100122 3300025231 Bacteria 99064
213 Ga0209437_100048 3300025233 Bacteria 405107
214 Ga0209437_100119 3300025233 Bacteria 206549
215 Ga0207425_1000051 3300025245 Bacteria 166795
216 Ga0209026_1000304 3300025250 Bacteria 53704
217 Ga0209129_1000121 3300025258 Bacteria 135404
218 Ga0209129_1016863 3300025258 Bacteria 1452
219 Ga0209233_1000029 3300025261 Bacteria 641642
220 Ga0209233_1004779 3300025261 Bacteria 4564
221 Ga0209455_1004796 3300025272 Bacteria 4328
222 Ga0209676_1000022 3300025292 Bacteria 605659
223 Ga0209025_1000160 3300025294 Bacteria 166795
224 Ga0209758_1000147 3300025297 Bacteria 166795
225 Ga0209050_1000020 3300025298 Bacteria 605671
226 Ga0209050_1008089 3300025298 Bacteria 5709
227 Ga0209257_1000006 3300025304 Bacteria 1570111
228 Ga0207647_10000256 3300025904 Bacteria 43702
229 Ga0207647_10018432 3300025904 Bacteria 4720
230 Ga0207647_10106557 3300025904 Unclassified 1659
231 Ga0207705_10066007 3300025909 Bacteria 2617
232 Ga0207705_10109677 3300025909 Bacteria 2038
233 Ga0207707_10003763 3300025912 Bacteria 13445
234 Ga0207695_10000053 3300025913 Bacteria 396740
235 Ga0207695_10000078 3300025913 Bacteria 297378
236 Ga0207695_10003291 3300025913 Bacteria 22952
237 Ga0207695_10018400 3300025913 Bacteria 8080
238 Ga0207695_10022995 3300025913 Bacteria 7059
239 Ga0207695_10099538 3300025913 Bacteria 2905
240 Ga0207695_10163907 3300025913 Bacteria 2152
241 Ga0207695_10248135 3300025913 Bacteria 1680
242 Ga0207671_10000298 3300025914 Bacteria 73044
243 Ga0207671_10000366 3300025914 Bacteria 64454
244 Ga0207671_10000925 3300025914 Bacteria 36841
245 Ga0207671_10007835 3300025914 Bacteria 9180
246 Ga0207671_10049768 3300025914 Bacteria 3102
247 Ga0207671_10052325 3300025914 Bacteria 3026
248 Ga0207671_10093179 3300025914 Bacteria 2272
249 Ga0207660_10163179 3300025917 Bacteria 1721
250 Ga0207657_10105867 3300025919 Bacteria 2328
251 Ga0207657_10287979 3300025919 Bacteria 1303
252 Ga0207652_10056206 3300025921 Bacteria 3388
253 Ga0207652_10059778 3300025921 Bacteria 3286
254 Ga0207694_10326178 3300025924 Bacteria 1268
255 Ga0207650_10001645 3300025925 Bacteria 15921
256 Ga0207650_10355542 3300025925 Unclassified 1206
257 Ga0207644_10007855 3300025931 Bacteria 6970
258 Ga0207690_10038238 3300025932 Bacteria 3122
259 Ga0207709_10000010 3300025935 Bacteria 601305
260 Ga0207661_10317036 3300025944 Bacteria 1401
261 Ga0207667_10000014 3300025949 Bacteria 421261
262 Ga0207667_10000274 3300025949 Bacteria 71328
263 Ga0207667_10008386 3300025949 Bacteria 12280
264 Ga0207667_10023957 3300025949 Bacteria 6715
265 Ga0207667_10117429 3300025949 Bacteria 2742
266 Ga0207667_10154923 3300025949 Bacteria 2358
267 Ga0207640_10097857 3300025981 Unclassified 2049
268 Ga0207640_10413466 3300025981 Bacteria 1102
269 Ga0207703_10117350 3300026035 Bacteria 2280
270 Ga0207703_10467729 3300026035 Bacteria 1180
271 Ga0207639_10047672 3300026041 Bacteria 3240
272 Ga0207639_10062748 3300026041 Bacteria 2875
273 Ga0207678_10142918 3300026067 Bacteria 2042
274 Ga0207702_10036427 3300026078 Bacteria 4115
275 Ga0207702_10037437 3300026078 Bacteria 4061
276 Ga0207702_10044099 3300026078 Bacteria 3747
277 Ga0207702_10149098 3300026078 Bacteria 2126
278 Ga0207702_10291775 3300026078 Bacteria 1545
279 Ga0207702_10321537 3300026078 Bacteria 1473
280 Ga0207641_10023895 3300026088 Bacteria 5039
281 Ga0207648_10138436 3300026089 Bacteria 2145
282 Ga0207674_10072885 3300026116 Bacteria 3449
283 Ga0207698_10203921 3300026142 Bacteria 1773
284 Ga0207698_10243091 3300026142 Bacteria 1642
285 Ga0207428_10165457 3300027907 Bacteria 1677
286 Ga0268266_10000053 3300028379 Bacteria 295181
287 Ga0268266_10001833 3300028379 Bacteria 24026
288 Ga0307515_10000001 3300028794 Bacteria 4259510
289 Ga0307515_10000016 3300028794 Bacteria 554870
290 Ga0307515_10000316 3300028794 Bacteria 119243
291 Ga0307515_10001308 3300028794 Bacteria 56577
292 Ga0307515_10207796 3300028794 Bacteria 1812
293 Ga0307515_10212349 3300028794 Bacteria 1776
294 Ga0265338_10105050 3300028800 Bacteria 2290
295 Ga0265338_10197563 3300028800 Bacteria 1519
296 Ga0265324_10006646 3300029957 Bacteria 4784
297 Ga0316177_1066261 3300030731 Bacteria 12027
298 Ga0316176_1102297 3300030732 Bacteria 14584
299 Ga0316183_1153674 3300030742 Bacteria 79729
300 Ga0316181_1001096 3300030744 Bacteria 4407
301 Ga0265331_10109396 3300031250 Bacteria 1268
302 Ga0265327_10000006 3300031251 Bacteria 693716
303 Ga0265327_10000013 3300031251 Bacteria 519549
304 Ga0265327_10000228 3300031251 Bacteria 114387
305 Ga0307513_10134206 3300031456 Bacteria 2414
306 Ga0307408_100000889 3300031548 Bacteria 23506
307 Ga0307408_100001538 3300031548 Bacteria 17127
308 Ga0307408_100003026 3300031548 Bacteria 11610
309 Ga0307408_100056973 3300031548 Bacteria 2835
310 Ga0265342_10185149 3300031712 Bacteria 1139
311 Ga0307405_10000011 3300031731 Bacteria 241071
312 Ga0316577_10050394 3300031733 Unclassified 2324
313 Ga0307407_10000018 3300031903 Bacteria 135979
314 Ga0307412_10000001 3300031911 Bacteria 822691
315 Ga0307412_10004065 3300031911 Bacteria 8150
316 Ga0307412_10106720 3300031911 Bacteria 1992
317 Ga0307409_100007913 3300031995 Bacteria 6403
318 Ga0307416_100000050 3300032002 Bacteria 116313
319 Ga0307416_100277840 3300032002 Bacteria 1649
320 Ga0307414_10000816 3300032004 Bacteria 15915
321 Ga0307414_10004830 3300032004 Bacteria 7360
322 Ga0307414_10025228 3300032004 Bacteria 3804
323 Ga0307414_10091015 3300032004 Bacteria 2266
324 Ga0307414_10092388 3300032004 Bacteria 2253
325 Ga0307414_10113908 3300032004 Unclassified 2065
326 Ga0307414_10276225 3300032004 Bacteria 1409
327 Ga0307507_10000337 3300033179 Bacteria 95356
328 Ga0307510_10001184 3300033180 Bacteria 28153
329 Ga0373927_0105157 3300035695 Bacteria 1838
330 Ga0316584_0001440 3300036712 Bacteria 14261
331 Ga0395899_0000282 3300037312 Bacteria 66053
332 Ga0395899_0001270 3300037312 Bacteria 21938
333 Ga0395899_0039694 3300037312 Bacteria 3522
334 Ga0395900_0000195 3300037418 Bacteria 97204
335 Ga0395900_0002423 3300037418 Bacteria 20558
336 Ga0395900_0055381 3300037418 Bacteria 4084
337 Ga0395900_0467557 3300037418 Bacteria 1215
338 Ga0395898_0014682 3300037466 Bacteria 8043
339 Ga0395898_0396359 3300037466 Bacteria 1316
340 Ga0395905_0001272 3300037471 Bacteria 31128
341 Ga0395905_0002456 3300037471 Bacteria 20520
342 Ga0395905_0076270 3300037471 Bacteria 3142
343 Ga0395905_0407966 3300037471 Bacteria 1254
344 Ga0395901_0000644 3300038443 Bacteria 40364
345 Ga0395901_0056799 3300038443 Bacteria 4072
346 Ga0395901_0100689 3300038443 Bacteria 3031
347 Ga0395901_0428910 3300038443 Bacteria 1355
348 Ga0400483_270292 3300039062 Bacteria 1860
349 Ga0400489_08300 3300039093 Archaea 5286
350 Ga0436361_0887739 3300039447 Bacteria 5753
351 Ga0439449_0009241 3300042007 Bacteria 3736
352 Ga0439462_0031620 3300042015 Bacteria 1402
353 Ga0466966_0024501 3300044684 Bacteria 3945
354 Ga0453684_0029777 3300044712 Bacteria 7737
355 Ga0466957_0219227 3300044842 Bacteria 1256
356 Ga0495592_0109311 3300046454 Bacteria 1959
357 Ga0495638_0000036 3300046460 Bacteria 275731
358 Ga0495651_0233501 3300046462 Bacteria 1265
359 Ga0495650_0000144 3300046471 Bacteria 165957
360 Ga0495585_0000091 3300046492 Bacteria 95620
361 Ga0495585_0000642 3300046492 Bacteria 32168
362 Ga0495607_0198071 3300046501 Bacteria 996
363 Ga0495606_0000919 3300046507 Bacteria 43453
364 Ga0495606_0013016 3300046507 Bacteria 6614
365 Ga0495606_0035940 3300046507 Bacteria 3381
366 Ga0495606_0064542 3300046507 Bacteria 2330
367 Ga0495610_0000219 3300046512 Bacteria 61501
368 Ga0495610_0002599 3300046512 Bacteria 14973
369 Ga0495616_0096556 3300046513 Bacteria 1391
370 Ga0495637_0026724 3300046520 Bacteria 2588
371 Ga0495644_0015559 3300046523 Bacteria 2914
372 Ga0495648_0018526 3300046524 Bacteria 4925
373 Ga0495648_0066806 3300046524 Bacteria 2106
374 Ga0495642_0029863 3300046528 Bacteria 2179
375 Ga0495652_0118795 3300046529 Bacteria 2112
376 Ga0495609_0016237 3300046538 Bacteria 3469
377 Ga0495609_0049323 3300046538 Bacteria 1879
378 Ga0495645_0109387 3300046543 Bacteria 1957
379 Ga0495633_0000026 3300046558 Bacteria 204722
380 Ga0495633_0007299 3300046558 Bacteria 6381
381 Ga0495668_0000054 3300046616 Bacteria 203960
382 Ga0495668_0000449 3300046616 Bacteria 52562
383 Ga0495634_0016241 3300046642 Bacteria 5327
384 Ga0495625_0000059 3300046660 Bacteria 180330
385 Ga0495625_0001227 3300046660 Bacteria 32490
386 Ga0495625_0001942 3300046660 Bacteria 23400
387 Ga0495625_0009347 3300046660 Bacteria 8211
388 Ga0495625_0037628 3300046660 Bacteria 3548
389 Ga0495625_0103408 3300046660 Bacteria 1953
390 Ga0495625_0136645 3300046660 Bacteria 1657
391 Ga0495661_0003215 3300046665 Bacteria 12199
392 Ga0495658_0055719 3300046683 Bacteria 2253
393 Ga0495649_0000031 3300046694 Bacteria 151547
394 Ga0495649_0051659 3300046694 Bacteria 2229
395 Ga0495636_0000011 3300047318 Bacteria 87862
396 Ga0495680_0374483 3300047322 Bacteria 987
397 Ga0495683_0043965 3300047323 Bacteria 2247
398 Ga0495687_001100 3300047443 Bacteria 26388
399 Ga0495685_095960 3300047447 Bacteria 980
400 Ga0495681_0113712 3300047470 Bacteria 1169
401 Ga0495686_0000230 3300047472 Bacteria 102747
402 Ga0495686_0000533 3300047472 Bacteria 54324
403 Ga0495686_0002591 3300047472 Bacteria 16802
404 Ga0495614_0036502 3300048089 Bacteria 2110
405 Ga0496114_0004685 3300048917 Bacteria 10637
406 Ga0496115_0002329 3300048918 Bacteria 13612
407 Ga0496115_0123289 3300048918 Bacteria 2133
408 Ga0496116_0010979 3300048919 Bacteria 7542
409 Ga0496117_0001536 3300048920 Bacteria 32827
410 Ga0496122_0000876 3300048925 Bacteria 56653
411 Ga0496123_0019398 3300048926 Bacteria 5361
412 Ga0496123_0059317 3300048926 Bacteria 2475
413 Ga0496125_0077654 3300048928 Bacteria 2558
414 Ga0495678_035096 3300049459 Bacteria 2059
415 Ga0495682_0043051 3300049460 Bacteria 1654
416 Ga0501043_0146613 3300049579 Bacteria 1848
417 Ga0501217_051790 3300049661 Bacteria 1075
418 Ga0501222_000312 3300049662 Bacteria 7702
419 Ga0501242_001440 3300049674 Bacteria 2385
420 Ga0501249_018597 3300049679 Bacteria 1504
421 Ga0501253_012227 3300049683 Bacteria 1339
422 Ga0501257_000664 3300049686 Bacteria 6861
423 Ga0501241_000534 3300049758 Bacteria 8160
424 Ga0501264_000044 3300049761 Bacteria 17523
425 Ga0501035_0116040 3300049822 Bacteria 2343
426 nmdc:mga0k408_1202_c1 3300050493 Bacteria 14176
427 nmdc:mga0k408_82_c1 3300050493 Bacteria 45008
428 nmdc:mga05p37_20345_c1 3300050507 Bacteria 8029
429 nmdc:mga09592_35482_c1 3300050508 Bacteria 4175
430 nmdc:mga06r32_23982_c1 3300050510 Bacteria 5655
431 nmdc:mga08y16_18441_c1 3300050511 Bacteria 7353
432 nmdc:mga08y16_239016_c1 3300050511 Bacteria 1878
433 nmdc:mga08y16_253949_c1 3300050511 Bacteria 1816
434 Ga0500647_0035688 3300053091 Bacteria 2377
435 Ga0500651_0001126 3300053093 Bacteria 13227
436 Ga0500556_0009883 3300053104 Unclassified 2786
437 Ga0500592_009917 3300053116 Unclassified 1515
438 Ga0500608_002212 3300053122 Bacteria 7015
439 Ga0500608_020989 3300053122 Bacteria 3012
440 Ga0500618_000018 3300053125 Bacteria 163272
441 Ga0500618_036621 3300053125 Bacteria 1136
442 Ga0500642_0046343 3300053130 Bacteria 1901
443 Ga0500559_0041595 3300053136 Bacteria 2003
444 Ga0500568_0031471 3300053139 Bacteria 2189
445 Ga0500616_0000004 3300053153 Bacteria 1002714
446 Ga0500616_0000868 3300053153 Bacteria 33454
447 Ga0500616_0028960 3300053153 Bacteria 3050
448 Ga0500616_0109880 3300053153 Bacteria 1333
449 Ga0500622_0001026 3300053156 Bacteria 23406
450 Ga0500624_000264 3300053157 Bacteria 18308
451 Ga0500627_0089500 3300053158 Unclassified 1377

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047470 Ga0495681_0113712 Ga0495681_0113712_15_830 262
2 3300049822 Ga0501035_0116040 Ga0501035_0116040_383_1276 264
3 iso_pu_bacteria 2904780799 2904785837 265
4 iso_pu_bacteria 2919177583 2919182459 265
5 3300046520 Ga0495637_0026724 Ga0495637_0026724_1215_2024 266
6 3300046507 Ga0495606_0013016 Ga0495606_0013016_524_1378 267
7 3300048919 Ga0496116_0010979 Ga0496116_0010979_647_1465 268
8 3300048920 Ga0496117_0001536 Ga0496117_0001536_14894_15712 268
9 3300048926 Ga0496123_0059317 Ga0496123_0059317_28_846 268
10 3300005288 Ga0065714_10131349 Ga0065714_101313491 269
11 3300005289 Ga0065704_10072149 Ga0065704_100721494 269
12 3300009148 Ga0105243_10000004 Ga0105243_1000000414 269
13 3300025935 Ga0207709_10000010 Ga0207709_1000001015 269
14 3300026088 Ga0207641_10023895 Ga0207641_100238952 269
15 3300032004 Ga0307414_10091015 Ga0307414_100910151 269
16 3300005578 Ga0068854_100071901 Ga0068854_1000719015 270
17 3300009545 Ga0105237_10078416 Ga0105237_100784162 270
18 3300010375 Ga0105239_10024974 Ga0105239_100249743 270
19 3300013100 Ga0157373_10000089 Ga0157373_1000008923 270
20 3300013104 Ga0157370_10126398 Ga0157370_101263984 270
21 3300013307 Ga0157372_10035628 Ga0157372_100356286 270
22 3300025914 Ga0207671_10049768 Ga0207671_100497681 270
23 3300053122 Ga0500608_020989 Ga0500608_020989_1231_2085 270
24 3300002737 JGI25162J39368_1000016 JGI25162J39368_1000016185 271
25 3300003781 Ga0055536_1000002 Ga0055536_1000002497 271
26 3300003791 Ga0055530_10001421 Ga0055530_1000142115 271
27 3300010375 Ga0105239_10008608 Ga0105239_1000860810 271
28 3300013104 Ga0157370_10072875 Ga0157370_100728753 271
29 3300013104 Ga0157370_10080886 Ga0157370_100808862 271
30 3300025233 Ga0209437_100119 Ga0209437_100119103 271
31 3300025258 Ga0209129_1016863 Ga0209129_10168632 271
32 3300025292 Ga0209676_1000022 Ga0209676_100002241 271
33 3300025298 Ga0209050_1000020 Ga0209050_1000020500 271
34 3300025913 Ga0207695_10163907 Ga0207695_101639072 271
35 3300046507 Ga0495606_0035940 Ga0495606_0035940_2303_3157 271
36 3300046513 Ga0495616_0096556 Ga0495616_0096556_188_1042 271
37 3300046660 Ga0495625_0103408 Ga0495625_0103408_285_1139 271
38 3300049459 Ga0495678_035096 Ga0495678_035096_826_1680 271
39 3300013307 Ga0157372_10389845 Ga0157372_103898452 272
40 3300003323 rootH1_10079729 rootH1_100797293 273
41 3300005614 Ga0068856_100047619 Ga0068856_1000476193 273
42 3300026078 Ga0207702_10321537 Ga0207702_103215371 273
43 3300046524 Ga0495648_0018526 Ga0495648_0018526_1215_2069 274
44 3300047472 Ga0495686_0002591 Ga0495686_0002591_13144_13998 274
45 iso_pu_bacteria 2833640130 2833643452 274
46 3300044712 Ga0453684_0029777 Ga0453684_0029777_1389_2237 275
47 3300053125 Ga0500618_000018 Ga0500618_000018_110574_111428 275
48 3300053157 Ga0500624_000264 Ga0500624_000264_9318_10172 275
49 3300005339 Ga0070660_100182562 Ga0070660_1001825623 276
50 3300005366 Ga0070659_100090664 Ga0070659_1000906643 276
51 3300005577 Ga0068857_100087534 Ga0068857_1000875343 276
52 3300025261 Ga0209233_1004779 Ga0209233_10047793 276
53 3300025904 Ga0207647_10000256 Ga0207647_1000025621 276
54 3300025919 Ga0207657_10105867 Ga0207657_101058672 276
55 3300025932 Ga0207690_10038238 Ga0207690_100382382 276
56 3300026116 Ga0207674_10072885 Ga0207674_100728854 276
57 3300038443 Ga0395901_0056799 Ga0395901_0056799_1628_2485 276
58 3300042007 Ga0439449_0009241 Ga0439449_0009241_162_1028 276
59 3300042015 Ga0439462_0031620 Ga0439462_0031620_83_949 276
60 iso_pu_bacteria 2599185184 2599481995 276
61 iso_pu_bacteria 2842903701 2842904969 276
62 iso_pu_bacteria 2852623160 2852625524 276
63 iso_pu_bacteria 2884933994 2884934527 276
64 iso_pu_bacteria 2928078545 2928082104 276
65 iso_pu_bacteria 2928147474 2928149318 276
66 iso_pu_bacteria 2932082852 2932087946 276
67 iso_pu_bacteria 2977232053 2977234198 276
68 iso_pu_bacteria 2585427687 2586209950 277
69 iso_pu_bacteria 2738541302 2738852440 277
70 iso_pu_bacteria 2739367651 2739591452 277
71 iso_pu_bacteria 2739367656 2739615266 277
72 iso_pu_bacteria 2739367663 2739645606 277
73 iso_pu_bacteria 2818991437 2819549565 277
74 iso_pu_bacteria 2842722452 2842727320 277
75 iso_pu_bacteria 2842909656 2842913717 277
76 iso_pu_bacteria 2849281842 2849285451 277
77 iso_pu_bacteria 2852627209 2852630654 277
78 iso_pu_bacteria 2857627736 2857628228 277
79 iso_pu_bacteria 2902048731 2902049722 277
80 iso_pu_bacteria 2904445276 2904447300 277
81 iso_pu_bacteria 2919186247 2919190614 277
82 iso_pu_bacteria 2945997725 2945998359 277
83 iso_pu_bacteria 2954016120 2954020827 277
84 3300048918 Ga0496115_0002329 Ga0496115_0002329_6557_7393 278
85 3300053136 Ga0500559_0041595 Ga0500559_0041595_650_1492 278
86 iso_pu_bacteria 2738541283 2738756086 278
87 iso_pu_bacteria 2738541284 2738763292 278
88 iso_pu_bacteria 2738543023 2739304171 278
89 iso_pu_bacteria 2775506987 2776616102 278
90 3300002737 JGI25162J39368_1000866 JGI25162J39368_10008668 279
91 3300003214 JGI25165J46597_1001134 JGI25165J46597_100113416 279
92 3300003323 rootH1_10003399 rootH1_1000339923 279
93 3300025231 Ga0207427_100122 Ga0207427_10012283 279
94 3300025233 Ga0209437_100048 Ga0209437_100048213 279
95 3300025261 Ga0209233_1000029 Ga0209233_1000029163 279
96 3300039062 Ga0400483_270292 Ga0400483_270292_324_1175 279
97 3300046523 Ga0495644_0015559 Ga0495644_0015559_1016_1867 279
98 3300046528 Ga0495642_0029863 Ga0495642_0029863_1268_2119 279
99 3300047447 Ga0495685_095960 Ga0495685_095960_38_889 279
100 iso_pu_bacteria 2910245624 2910250803 279
101 3300002067 JGI24735J21928_10000015 JGI24735J21928_1000001519 280
102 3300003316 rootH1_10034433 rootH1_1003443314 280
103 3300004803 Ga0058862_12302803 Ga0058862_123028031 280
104 3300005336 Ga0070680_100065076 Ga0070680_1000650763 280
105 3300005455 Ga0070663_100085742 Ga0070663_1000857422 280
106 3300005458 Ga0070681_10048767 Ga0070681_100487673 280
107 3300005530 Ga0070679_100457246 Ga0070679_1004572461 280
108 3300005539 Ga0068853_100090283 Ga0068853_1000902834 280
109 3300005548 Ga0070665_100000061 Ga0070665_100000061153 280
110 3300005563 Ga0068855_100000074 Ga0068855_1000000749 280
111 3300005563 Ga0068855_100017943 Ga0068855_1000179433 280
112 3300005563 Ga0068855_100331748 Ga0068855_1003317483 280
113 3300005614 Ga0068856_100033530 Ga0068856_1000335303 280
114 3300005614 Ga0068856_100046164 Ga0068856_1000461642 280
115 3300005616 Ga0068852_100340122 Ga0068852_1003401222 280
116 3300006195 Ga0075366_10000170 Ga0075366_1000017012 280
117 3300006195 Ga0075366_10005159 Ga0075366_100051595 280
118 3300009093 Ga0105240_10000082 Ga0105240_1000008259 280
119 3300009093 Ga0105240_10001333 Ga0105240_1000133310 280
120 3300009093 Ga0105240_10014355 Ga0105240_100143557 280
121 3300009093 Ga0105240_10056121 Ga0105240_100561213 280
122 3300009093 Ga0105240_10188862 Ga0105240_101888621 280
123 3300009093 Ga0105240_10623136 Ga0105240_106231362 280
124 3300009148 Ga0105243_10031449 Ga0105243_100314494 280
125 3300009174 Ga0105241_10009078 Ga0105241_100090786 280
126 3300009174 Ga0105241_10021457 Ga0105241_100214573 280
127 3300009174 Ga0105241_10056412 Ga0105241_100564124 280
128 3300009174 Ga0105241_10324125 Ga0105241_103241252 280
129 3300009176 Ga0105242_10541681 Ga0105242_105416811 280
130 3300009545 Ga0105237_10000310 Ga0105237_1000031022 280
131 3300009545 Ga0105237_10007457 Ga0105237_100074573 280
132 3300009545 Ga0105237_10009371 Ga0105237_100093717 280
133 3300009545 Ga0105237_10172748 Ga0105237_101727484 280
134 3300009551 Ga0105238_10045351 Ga0105238_100453513 280
135 3300009551 Ga0105238_10325296 Ga0105238_103252962 280
136 3300009551 Ga0105238_10668365 Ga0105238_106683652 280
137 3300010375 Ga0105239_10000009 Ga0105239_1000000912 280
138 3300010375 Ga0105239_10000049 Ga0105239_10000049102 280
139 3300010375 Ga0105239_10003303 Ga0105239_1000330321 280
140 3300010375 Ga0105239_10008871 Ga0105239_100088717 280
141 3300010375 Ga0105239_10025805 Ga0105239_100258055 280
142 3300010375 Ga0105239_10403540 Ga0105239_104035402 280
143 3300013102 Ga0157371_10013702 Ga0157371_100137023 280
144 3300013104 Ga0157370_10156635 Ga0157370_101566352 280
145 3300013104 Ga0157370_10290874 Ga0157370_102908742 280
146 3300013105 Ga0157369_10004248 Ga0157369_100042482 280
147 3300013105 Ga0157369_10044949 Ga0157369_100449497 280
148 3300013105 Ga0157369_10101380 Ga0157369_101013803 280
149 3300013297 Ga0157378_10006650 Ga0157378_100066506 280
150 3300013297 Ga0157378_10042477 Ga0157378_100424774 280
151 3300013306 Ga0163162_10000012 Ga0163162_10000012211 280
152 3300013306 Ga0163162_10010257 Ga0163162_100102578 280
153 3300013307 Ga0157372_10000039 Ga0157372_1000003965 280
154 3300013307 Ga0157372_10001390 Ga0157372_1000139018 280
155 3300013307 Ga0157372_10047927 Ga0157372_100479273 280
156 3300013308 Ga0157375_10014406 Ga0157375_100144065 280
157 3300013308 Ga0157375_10124046 Ga0157375_101240463 280
158 3300015262 Ga0182007_10044537 Ga0182007_100445371 280
159 3300020077 Ga0206351_10116577 Ga0206351_101165772 280
160 3300021361 Ga0213872_10152853 Ga0213872_101528531 280
161 3300025250 Ga0209026_1000304 Ga0209026_100030423 280
162 3300025272 Ga0209455_1004796 Ga0209455_10047965 280
163 3300025904 Ga0207647_10018432 Ga0207647_100184324 280
164 3300025909 Ga0207705_10066007 Ga0207705_100660072 280
165 3300025912 Ga0207707_10003763 Ga0207707_1000376316 280
166 3300025913 Ga0207695_10000053 Ga0207695_10000053292 280
167 3300025913 Ga0207695_10003291 Ga0207695_100032914 280
168 3300025913 Ga0207695_10018400 Ga0207695_100184003 280
169 3300025913 Ga0207695_10248135 Ga0207695_102481351 280
170 3300025914 Ga0207671_10000366 Ga0207671_1000036643 280
171 3300025914 Ga0207671_10007835 Ga0207671_100078358 280
172 3300025914 Ga0207671_10052325 Ga0207671_100523252 280
173 3300025917 Ga0207660_10163179 Ga0207660_101631791 280
174 3300025919 Ga0207657_10287979 Ga0207657_102879791 280
175 3300025921 Ga0207652_10059778 Ga0207652_100597782 280
176 3300025924 Ga0207694_10326178 Ga0207694_103261782 280
177 3300025931 Ga0207644_10007855 Ga0207644_100078557 280
178 3300025949 Ga0207667_10000014 Ga0207667_1000001497 280
179 3300025949 Ga0207667_10000274 Ga0207667_1000027441 280
180 3300025949 Ga0207667_10008386 Ga0207667_100083869 280
181 3300026035 Ga0207703_10117350 Ga0207703_101173503 280
182 3300026067 Ga0207678_10142918 Ga0207678_101429184 280
183 3300026078 Ga0207702_10036427 Ga0207702_100364272 280
184 3300026078 Ga0207702_10037437 Ga0207702_100374372 280
185 3300026078 Ga0207702_10044099 Ga0207702_100440995 280
186 3300026078 Ga0207702_10149098 Ga0207702_101490982 280
187 3300026142 Ga0207698_10243091 Ga0207698_102430912 280
188 3300028379 Ga0268266_10000053 Ga0268266_1000005351 280
189 3300028794 Ga0307515_10000316 Ga0307515_1000031693 280
190 3300028794 Ga0307515_10001308 Ga0307515_1000130822 280
191 3300028794 Ga0307515_10207796 Ga0307515_102077962 280
192 3300028800 Ga0265338_10105050 Ga0265338_101050504 280
193 3300028800 Ga0265338_10197563 Ga0265338_101975631 280
194 3300030731 Ga0316177_1066261 Ga0316177_10662615 280
195 3300030732 Ga0316176_1102297 Ga0316176_11022972 280
196 3300030742 Ga0316183_1153674 Ga0316183_115367459 280
197 3300030744 Ga0316181_1001096 Ga0316181_10010961 280
198 3300031548 Ga0307408_100001538 Ga0307408_10000153814 280
199 3300031548 Ga0307408_100003026 Ga0307408_1000030265 280
200 3300031733 Ga0316577_10050394 Ga0316577_100503941 280
201 3300031911 Ga0307412_10004065 Ga0307412_100040655 280
202 3300032002 Ga0307416_100277840 Ga0307416_1002778402 280
203 3300033179 Ga0307507_10000337 Ga0307507_1000033736 280
204 3300033180 Ga0307510_10001184 Ga0307510_1000118412 280
205 3300036712 Ga0316584_0001440 Ga0316584_0001440_6733_7587 280
206 3300037312 Ga0395899_0000282 Ga0395899_0000282_63704_64558 280
207 3300037312 Ga0395899_0001270 Ga0395899_0001270_9515_10369 280
208 3300037418 Ga0395900_0000195 Ga0395900_0000195_40444_41298 280
209 3300037418 Ga0395900_0002423 Ga0395900_0002423_4635_5489 280
210 3300037418 Ga0395900_0467557 Ga0395900_0467557_177_1031 280
211 3300037466 Ga0395898_0014682 Ga0395898_0014682_3049_3903 280
212 3300037471 Ga0395905_0001272 Ga0395905_0001272_17186_18040 280
213 3300038443 Ga0395901_0000644 Ga0395901_0000644_19236_20090 280
214 3300038443 Ga0395901_0100689 Ga0395901_0100689_1286_2140 280
215 3300039447 Ga0436361_0887739 Ga0436361_0887739_1296_2150 280
216 3300044684 Ga0466966_0024501 Ga0466966_0024501_699_1553 280
217 3300046462 Ga0495651_0233501 Ga0495651_0233501_34_888 280
218 3300046471 Ga0495650_0000144 Ga0495650_0000144_116439_117293 280
219 3300046492 Ga0495585_0000091 Ga0495585_0000091_50655_51509 280
220 3300046492 Ga0495585_0000642 Ga0495585_0000642_28981_29835 280
221 3300046501 Ga0495607_0198071 Ga0495607_0198071_18_872 280
222 3300046507 Ga0495606_0000919 Ga0495606_0000919_37422_38276 280
223 3300046524 Ga0495648_0066806 Ga0495648_0066806_823_1677 280
224 3300046529 Ga0495652_0118795 Ga0495652_0118795_523_1377 280
225 3300046538 Ga0495609_0016237 Ga0495609_0016237_2323_3177 280
226 3300046558 Ga0495633_0000026 Ga0495633_0000026_121026_121880 280
227 3300046558 Ga0495633_0007299 Ga0495633_0007299_4280_5134 280
228 3300046616 Ga0495668_0000054 Ga0495668_0000054_91416_92270 280
229 3300046660 Ga0495625_0000059 Ga0495625_0000059_59472_60326 280
230 3300046660 Ga0495625_0001227 Ga0495625_0001227_8374_9228 280
231 3300046660 Ga0495625_0001942 Ga0495625_0001942_11408_12262 280
232 3300046660 Ga0495625_0009347 Ga0495625_0009347_1415_2269 280
233 3300046660 Ga0495625_0037628 Ga0495625_0037628_1596_2450 280
234 3300046660 Ga0495625_0136645 Ga0495625_0136645_705_1559 280
235 3300046665 Ga0495661_0003215 Ga0495661_0003215_1326_2180 280
236 3300046683 Ga0495658_0055719 Ga0495658_0055719_282_1136 280
237 3300046694 Ga0495649_0000031 Ga0495649_0000031_32182_33036 280
238 3300046694 Ga0495649_0051659 Ga0495649_0051659_1040_1894 280
239 3300047323 Ga0495683_0043965 Ga0495683_0043965_932_1786 280
240 3300047443 Ga0495687_001100 Ga0495687_001100_11948_12802 280
241 3300047472 Ga0495686_0000230 Ga0495686_0000230_19895_20737 280
242 3300047472 Ga0495686_0000533 Ga0495686_0000533_38775_39629 280
243 3300048089 Ga0495614_0036502 Ga0495614_0036502_121_975 280
244 3300049460 Ga0495682_0043051 Ga0495682_0043051_579_1433 280
245 3300050493 nmdc:mga0k408_1202_c1 nmdc:mga0k408_1202_c1_10214_11068 280
246 3300050493 nmdc:mga0k408_82_c1 nmdc:mga0k408_82_c1_6825_7679 280
247 3300053091 Ga0500647_0035688 Ga0500647_0035688_1185_2039 280
248 3300053116 Ga0500592_009917 Ga0500592_009917_364_1206 280
249 3300053122 Ga0500608_002212 Ga0500608_002212_5616_6470 280
250 3300053153 Ga0500616_0000868 Ga0500616_0000868_32564_33406 280
251 iso_pu_bacteria 2939664404 2939669176 280
252 3300002773 JGI25152J39213_1000300 JGI25152J39213_100030012 281
253 3300002774 JGI25150J39212_1000023 JGI25150J39212_100002319 281
254 3300003187 JGI25151J46595_10000082 JGI25151J46595_1000008219 281
255 3300003215 JGI25153J46596_10000060 JGI25153J46596_1000006020 281
256 3300003322 rootL2_10102636 rootL2_101026369 281
257 3300003323 rootH1_10061130 rootH1_1006113026 281
258 3300005288 Ga0065714_10002204 Ga0065714_1000220457 281
259 3300005288 Ga0065714_10002553 Ga0065714_1000255316 281
260 3300005288 Ga0065714_10007689 Ga0065714_100076893 281
261 3300005616 Ga0068852_100393268 Ga0068852_1003932682 281
262 3300005617 Ga0068859_100000272 Ga0068859_10000027234 281
263 3300006931 Ga0097620_100000272 Ga0097620_10000027234 281
264 3300009036 Ga0105244_10097085 Ga0105244_100970851 281
265 3300013100 Ga0157373_10014003 Ga0157373_100140033 281
266 3300013100 Ga0157373_10020052 Ga0157373_100200523 281
267 3300013102 Ga0157371_10000025 Ga0157371_10000025256 281
268 3300013102 Ga0157371_10000511 Ga0157371_100005115 281
269 3300013104 Ga0157370_10014967 Ga0157370_100149672 281
270 3300013104 Ga0157370_10467965 Ga0157370_104679652 281
271 3300013105 Ga0157369_10000038 Ga0157369_100000384 281
272 3300013105 Ga0157369_10377807 Ga0157369_103778072 281
273 3300013306 Ga0163162_10000123 Ga0163162_1000012343 281
274 3300013307 Ga0157372_10000241 Ga0157372_1000024145 281
275 3300013307 Ga0157372_10024320 Ga0157372_100243204 281
276 3300013308 Ga0157375_10012196 Ga0157375_100121963 281
277 3300014497 Ga0182008_10000052 Ga0182008_1000005285 281
278 3300015261 Ga0182006_1000276 Ga0182006_10002764 281
279 3300015261 Ga0182006_1001187 Ga0182006_10011874 281
280 3300015262 Ga0182007_10000024 Ga0182007_1000002444 281
281 3300015682 Ga0183373_1002 Ga0183373_100245 281
282 3300017792 Ga0163161_10000093 Ga0163161_1000009345 281
283 3300017792 Ga0163161_10000094 Ga0163161_1000009420 281
284 3300017792 Ga0163161_10001375 Ga0163161_100013754 281
285 3300017792 Ga0163161_10032876 Ga0163161_100328761 281
286 3300017792 Ga0163161_10099575 Ga0163161_100995752 281
287 3300025245 Ga0207425_1000051 Ga0207425_100005153 281
288 3300025258 Ga0209129_1000121 Ga0209129_100012120 281
289 3300025294 Ga0209025_1000160 Ga0209025_1000160107 281
290 3300025297 Ga0209758_1000147 Ga0209758_1000147107 281
291 3300026142 Ga0207698_10203921 Ga0207698_102039211 281
292 3300031548 Ga0307408_100000889 Ga0307408_1000008892 281
293 3300031731 Ga0307405_10000011 Ga0307405_1000001138 281
294 3300031903 Ga0307407_10000018 Ga0307407_100000182 281
295 3300031995 Ga0307409_100007913 Ga0307409_1000079132 281
296 3300032002 Ga0307416_100000050 Ga0307416_10000005065 281
297 3300032004 Ga0307414_10004830 Ga0307414_100048302 281
298 3300032004 Ga0307414_10092388 Ga0307414_100923882 281
299 3300037471 Ga0395905_0002456 Ga0395905_0002456_18917_19768 281
300 3300046507 Ga0495606_0064542 Ga0495606_0064542_1290_2144 281
301 3300046512 Ga0495610_0000219 Ga0495610_0000219_53673_54527 281
302 3300046512 Ga0495610_0002599 Ga0495610_0002599_10962_11816 281
303 3300046538 Ga0495609_0049323 Ga0495609_0049323_886_1737 281
304 3300048917 Ga0496114_0004685 Ga0496114_0004685_2604_3479 281
305 3300048918 Ga0496115_0123289 Ga0496115_0123289_1191_2042 281
306 3300049679 Ga0501249_018597 Ga0501249_018597_167_1021 281
307 3300003320 rootH2_10047461 rootH2_100474615 282
308 3300003320 rootH2_10198930 rootH2_101989303 282
309 3300003323 rootH1_10055014 rootH1_100550142 282
310 3300005288 Ga0065714_10007833 Ga0065714_100078332 282
311 3300005288 Ga0065714_10015308 Ga0065714_100153082 282
312 3300005288 Ga0065714_10150540 Ga0065714_101505402 282
313 3300005289 Ga0065704_10001732 Ga0065704_100017326 282
314 3300005289 Ga0065704_10006409 Ga0065704_100064093 282
315 3300005327 Ga0070658_10006144 Ga0070658_100061446 282
316 3300005331 Ga0070670_100504946 Ga0070670_1005049461 282
317 3300005344 Ga0070661_100313666 Ga0070661_1003136661 282
318 3300006931 Ga0097620_100093992 Ga0097620_1000939922 282
319 3300009094 Ga0111539_10137145 Ga0111539_101371452 282
320 3300009553 Ga0105249_10183886 Ga0105249_101838862 282
321 3300013100 Ga0157373_10005376 Ga0157373_100053763 282
322 3300013100 Ga0157373_10339836 Ga0157373_103398361 282
323 3300013102 Ga0157371_10007554 Ga0157371_100075544 282
324 3300013102 Ga0157371_10009528 Ga0157371_100095281 282
325 3300013102 Ga0157371_10033409 Ga0157371_100334093 282
326 3300013104 Ga0157370_10040234 Ga0157370_100402343 282
327 3300013104 Ga0157370_10049504 Ga0157370_100495042 282
328 3300013307 Ga0157372_10172189 Ga0157372_101721892 282
329 3300014497 Ga0182008_10000020 Ga0182008_10000020148 282
330 3300014497 Ga0182008_10073976 Ga0182008_100739761 282
331 3300015261 Ga0182006_1002937 Ga0182006_10029377 282
332 3300017792 Ga0163161_10010803 Ga0163161_100108033 282
333 3300025909 Ga0207705_10109677 Ga0207705_101096772 282
334 3300025914 Ga0207671_10000925 Ga0207671_1000092527 282
335 3300025949 Ga0207667_10117429 Ga0207667_101174292 282
336 3300026089 Ga0207648_10138436 Ga0207648_101384362 282
337 3300031250 Ga0265331_10109396 Ga0265331_101093962 282
338 3300031251 Ga0265327_10000013 Ga0265327_10000013140 282
339 3300031911 Ga0307412_10000001 Ga0307412_10000001247 282
340 3300031911 Ga0307412_10106720 Ga0307412_101067202 282
341 3300032004 Ga0307414_10000816 Ga0307414_1000081611 282
342 3300032004 Ga0307414_10025228 Ga0307414_100252283 282
343 3300032004 Ga0307414_10276225 Ga0307414_102762251 282
344 3300037312 Ga0395899_0039694 Ga0395899_0039694_1909_2763 282
345 3300037418 Ga0395900_0055381 Ga0395900_0055381_897_1751 282
346 3300037466 Ga0395898_0396359 Ga0395898_0396359_209_1063 282
347 3300037471 Ga0395905_0407966 Ga0395905_0407966_363_1217 282
348 3300038443 Ga0395901_0428910 Ga0395901_0428910_155_1009 282
349 3300046616 Ga0495668_0000449 Ga0495668_0000449_38349_39197 282
350 3300049579 Ga0501043_0146613 Ga0501043_0146613_564_1418 282
351 3300049758 Ga0501241_000534 Ga0501241_000534_2943_3797 282
352 3300050511 nmdc:mga08y16_253949_c1 nmdc:mga08y16_253949_c1_404_1258 282
353 3300053093 Ga0500651_0001126 Ga0500651_0001126_290_1144 282
354 3300005290 Ga0065712_10164954 Ga0065712_101649542 283
355 3300005329 Ga0070683_100319255 Ga0070683_1003192551 283
356 3300005330 Ga0070690_100096244 Ga0070690_1000962442 283
357 3300005331 Ga0070670_100009693 Ga0070670_1000096933 283
358 3300005458 Ga0070681_10113532 Ga0070681_101135322 283
359 3300005535 Ga0070684_100165640 Ga0070684_1001656402 283
360 3300005539 Ga0068853_100051494 Ga0068853_1000514944 283
361 3300005563 Ga0068855_100303912 Ga0068855_1003039122 283
362 3300005578 Ga0068854_100042783 Ga0068854_1000427834 283
363 3300005614 Ga0068856_100049718 Ga0068856_1000497184 283
364 3300006880 Ga0075429_100015472 Ga0075429_1000154722 283
365 3300009093 Ga0105240_10240960 Ga0105240_102409602 283
366 3300009147 Ga0114129_10018647 Ga0114129_100186476 283
367 3300009174 Ga0105241_10035417 Ga0105241_100354172 283
368 3300009545 Ga0105237_10052440 Ga0105237_100524403 283
369 3300010375 Ga0105239_10009059 Ga0105239_100090596 283
370 3300013100 Ga0157373_10037473 Ga0157373_100374732 283
371 3300013307 Ga0157372_10069376 Ga0157372_100693764 283
372 3300013307 Ga0157372_10443063 Ga0157372_104430632 283
373 3300014325 Ga0163163_10044177 Ga0163163_100441773 283
374 3300025913 Ga0207695_10099538 Ga0207695_100995382 283
375 3300025914 Ga0207671_10093179 Ga0207671_100931792 283
376 3300025921 Ga0207652_10056206 Ga0207652_100562062 283
377 3300025925 Ga0207650_10001645 Ga0207650_1000164516 283
378 3300025925 Ga0207650_10355542 Ga0207650_103555422 283
379 3300025944 Ga0207661_10317036 Ga0207661_103170362 283
380 3300025949 Ga0207667_10023957 Ga0207667_100239574 283
381 3300025981 Ga0207640_10413466 Ga0207640_104134661 283
382 3300026041 Ga0207639_10047672 Ga0207639_100476723 283
383 3300026041 Ga0207639_10062748 Ga0207639_100627482 283
384 3300026078 Ga0207702_10291775 Ga0207702_102917752 283
385 3300028794 Ga0307515_10000001 Ga0307515_100000012235 283
386 3300050507 nmdc:mga05p37_20345_c1 nmdc:mga05p37_20345_c1_1904_2764 283
387 3300050508 nmdc:mga09592_35482_c1 nmdc:mga09592_35482_c1_584_1444 283
388 3300050510 nmdc:mga06r32_23982_c1 nmdc:mga06r32_23982_c1_591_1451 283
389 3300053125 Ga0500618_036621 Ga0500618_036621_113_1039 283
390 3300003316 rootH1_10000428 rootH1_1000042821 284
391 3300003316 rootH1_10013947 rootH1_100139479 284
392 3300003316 rootH1_10123889 rootH1_101238893 284
393 3300003320 rootH2_10009276 rootH2_1000927619 284
394 3300003320 rootH2_10105521 rootH2_101055212 284
395 3300003322 rootL2_10006331 rootL2_1000633138 284
396 3300003322 rootL2_10125346 rootL2_101253462 284
397 3300003322 rootL2_10199322 rootL2_101993223 284
398 3300003323 rootH1_10005185 rootH1_1000518511 284
399 3300003323 rootH1_10010280 rootH1_100102805 284
400 3300003323 rootH1_10016834 rootH1_100168343 284
401 3300003323 rootH1_10016835 rootH1_100168353 284
402 3300003323 rootH1_10026116 rootH1_100261165 284
403 3300003323 rootH1_10065583 rootH1_1006558316 284
404 3300003794 Ga0055531_10000287 Ga0055531_1000028734 284
405 3300005262 Ga0065165_1001313 Ga0065165_100131322 284
406 3300005337 Ga0070682_100006134 Ga0070682_1000061344 284
407 3300005347 Ga0070668_100523284 Ga0070668_1005232841 284
408 3300005548 Ga0070665_100256672 Ga0070665_1002566722 284
409 3300005548 Ga0070665_100763166 Ga0070665_1007631661 284
410 3300005617 Ga0068859_100190473 Ga0068859_1001904732 284
411 3300005844 Ga0068862_100207461 Ga0068862_1002074611 284
412 3300006931 Ga0097620_100190471 Ga0097620_1001904712 284
413 3300009094 Ga0111539_10275785 Ga0111539_102757852 284
414 3300009553 Ga0105249_10589779 Ga0105249_105897791 284
415 3300013104 Ga0157370_10002659 Ga0157370_1000265915 284
416 3300014326 Ga0157380_10066264 Ga0157380_100662643 284
417 3300014497 Ga0182008_10000170 Ga0182008_100001707 284
418 3300015261 Ga0182006_1000270 Ga0182006_100027019 284
419 3300025304 Ga0209257_1000006 Ga0209257_1000006118 284
420 3300025949 Ga0207667_10154923 Ga0207667_101549232 284
421 3300027907 Ga0207428_10165457 Ga0207428_101654572 284
422 3300031548 Ga0307408_100056973 Ga0307408_1000569732 284
423 3300037471 Ga0395905_0076270 Ga0395905_0076270_1359_2282 284
424 3300046454 Ga0495592_0109311 Ga0495592_0109311_712_1596 284
425 3300046460 Ga0495638_0000036 Ga0495638_0000036_119916_120770 284
426 3300046543 Ga0495645_0109387 Ga0495645_0109387_268_1122 284
427 3300046642 Ga0495634_0016241 Ga0495634_0016241_760_1644 284
428 3300047322 Ga0495680_0374483 Ga0495680_0374483_82_966 284
429 3300048925 Ga0496122_0000876 Ga0496122_0000876_44599_45459 284
430 3300048926 Ga0496123_0019398 Ga0496123_0019398_2404_3264 284
431 3300048928 Ga0496125_0077654 Ga0496125_0077654_131_991 284
432 3300049661 Ga0501217_051790 Ga0501217_051790_188_1045 284
433 3300049662 Ga0501222_000312 Ga0501222_000312_1077_1931 284
434 3300049674 Ga0501242_001440 Ga0501242_001440_521_1375 284
435 3300049683 Ga0501253_012227 Ga0501253_012227_378_1232 284
436 3300049686 Ga0501257_000664 Ga0501257_000664_3976_4833 284
437 3300049761 Ga0501264_000044 Ga0501264_000044_15981_16838 284
438 3300050511 nmdc:mga08y16_18441_c1 nmdc:mga08y16_18441_c1_1506_2360 284
439 3300050511 nmdc:mga08y16_239016_c1 nmdc:mga08y16_239016_c1_621_1475 284
440 3300053104 Ga0500556_0009883 Ga0500556_0009883_1472_2326 284
441 3300053130 Ga0500642_0046343 Ga0500642_0046343_797_1651 284
442 3300053153 Ga0500616_0000004 Ga0500616_0000004_476922_477776 284
443 3300053153 Ga0500616_0028960 Ga0500616_0028960_188_1042 284
444 3300053153 Ga0500616_0109880 Ga0500616_0109880_397_1251 284
445 3300053156 Ga0500622_0001026 Ga0500622_0001026_92_946 284
446 3300053158 Ga0500627_0089500 Ga0500627_0089500_146_1000 284
447 iso_pu_bacteria 8055588893 8055589925 284
448 3300003322 rootL2_10194838 rootL2_101948381 285
449 3300003323 rootH1_10100344 rootH1_101003442 285
450 3300003323 rootH1_10174448 rootH1_101744483 285
451 3300025298 Ga0209050_1008089 Ga0209050_10080894 285
452 3300028794 Ga0307515_10000016 Ga0307515_10000016264 285
453 3300028794 Ga0307515_10212349 Ga0307515_102123492 285
454 3300031456 Ga0307513_10134206 Ga0307513_101342062 285
455 3300035695 Ga0373927_0105157 Ga0373927_0105157_108_986 285
456 3300053139 Ga0500568_0031471 Ga0500568_0031471_239_1126 285
457 3300013102 Ga0157371_10067622 Ga0157371_100676222 286
458 3300013307 Ga0157372_10166305 Ga0157372_101663053 286
459 3300009545 Ga0105237_10168228 Ga0105237_101682282 287
460 3300025914 Ga0207671_10000298 Ga0207671_1000029839 287
461 3300025981 Ga0207640_10097857 Ga0207640_100978572 287
462 3300009093 Ga0105240_10760491 Ga0105240_107604911 288
463 3300010375 Ga0105239_10141793 Ga0105239_101417932 288
464 3300039093 Ga0400489_08300 Ga0400489_08300_71_973 288
465 3300047318 Ga0495636_0000011 Ga0495636_0000011_84418_85299 288
466 3300031251 Ga0265327_10000006 Ga0265327_10000006295 289
467 3300032004 Ga0307414_10113908 Ga0307414_101139082 290
468 3300009093 Ga0105240_10000066 Ga0105240_1000006684 291
469 3300010375 Ga0105239_10001076 Ga0105239_1000107626 291
470 3300013297 Ga0157378_10028505 Ga0157378_100285052 291
471 3300013307 Ga0157372_10075801 Ga0157372_100758014 291
472 3300025913 Ga0207695_10000078 Ga0207695_10000078162 291
473 3300005548 Ga0070665_100001020 Ga0070665_10000102028 292
474 3300005563 Ga0068855_100316861 Ga0068855_1003168612 292
475 3300025904 Ga0207647_10106557 Ga0207647_101065572 292
476 3300025913 Ga0207695_10022995 Ga0207695_100229953 292
477 3300028379 Ga0268266_10001833 Ga0268266_1000183323 292
478 3300029957 Ga0265324_10006646 Ga0265324_100066464 293
479 3300031712 Ga0265342_10185149 Ga0265342_101851491 293
480 3300031251 Ga0265327_10000228 Ga0265327_1000022880 294
481 3300005842 Ga0068858_100453248 Ga0068858_1004532482 295
482 3300026035 Ga0207703_10467729 Ga0207703_104677292 295
483 3300044842 Ga0466957_0219227 Ga0466957_0219227_143_1048 295
484 2162886007 SwRhRL2b_contig_1762462 SwRhRL2b_0592.00002360 299
485 3300005289 Ga0065704_10000188 Ga0065704_1000018841 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

32

171

0.77

PF00149

Metallophos

Calcineurin-like phosphoesterase

32

233

0.62

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s3l-assembly1.cif.gz_A structural and functional characterization of a novel archaeal phosphodiesterase 0.6326 12 247
5wly-assembly1.cif.gz_A e. coli lpxh- 8 mutations 0.6281 12 248
5wly-assembly1.cif.gz_A e. coli lpxh- 8 mutations 0.6203 12 248
1s3l-assembly1.cif.gz_A structural and functional characterization of a novel archaeal phosphodiesterase 0.6195 12 247
7ss6-assembly1.cif.gz_A structure of klebsiella lpxh in complex with jh-lph-45 0.6063 12 247
ID Description Score Start End Superfamily
1s3lA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6326 12 247 3.60.21.10
1s3lA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6195 12 247 3.60.21.10
af_P46735_912_1105_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6007 98 121 2.30.29.30
af_G5ECZ0_808_1006_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5778 98 120 2.30.29.30
af_Q4AB27_1092_1286_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5569 98 121 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A3D1D5X7-F1-model_v4 deleted 0.9655 6 108
AF-A0A4Q5RDA2-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9637 7 116 GO:0005886
GO:0008758
GO:0009245
GO:0046872
AF-A0A3D1D5X7-F1-model_v4 deleted 0.9564 6 108
AF-A0A3D1H7X3-F1-model_v4 UDP-2,3-diacylglucosamine hydrolase 0.9523 7 129 GO:0005886
GO:0008758
GO:0009245
GO:0046872
AF-A0A6L4ZFX8-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9522 4 118 GO:0005886
GO:0008758
GO:0009245
GO:0046872

Feature Viewer

pLDDT pTM Quality
76.3 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map